F477580

General Info

Members Datasets Scaffolds Average Seq Length
724 221 682 167

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0093129|Ga0495672_0093129_116_706
Length 196
Sequence MFSGLVQTHGLTYAATQRFRYPVDSMGRGFLFILLLFVLPATAQIYKYTDANGVTAYSNQPPDGVSAQPVDLPPLNSVERQPPGEAAPAAETARNEQPRKAYEVLELTGLPTTEALRANNGTFTANVQIKPRLQSPHLLRLLLDDQPYGQPANVPILQLVNIDRGEHRLAVQVIDGENVVQQSPTVTFTVQRVHTR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231007 Pseudomonas sp. GM18 Isolate Nodule
3 2511231008 Pseudomonas sp. GM21 Isolate Nodule
4 2511231010 Pseudomonas sp. GM25 Isolate Nodule
5 2511231011 Pseudomonas sp. GM30 Isolate Nodule
6 2511231012 Pseudomonas sp. GM33 Isolate Nodule
7 2511231014 Pseudomonas sp. GM48 Isolate Nodule
8 2511231015 Pseudomonas sp. GM49 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231020 Pseudomonas sp. GM74 Isolate Nodule
11 2511231022 Pseudomonas sp. GM79 Isolate Nodule
12 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
13 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
14 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
15 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
16 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
17 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
18 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
19 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
20 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
21 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
22 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
23 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
24 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
25 2773857673 Pseudomonas sp. 443 Isolate Unclassified
26 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
27 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
28 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
29 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
30 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
31 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
32 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
33 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
34 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
35 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
36 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
37 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
38 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
39 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
40 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
90 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
91 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
92 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
93 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
94 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
95 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
96 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
97 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
98 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
99 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
100 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
101 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
102 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
103 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
104 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
105 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
106 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
107 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
108 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
109 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
110 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
111 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
114 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
117 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
118 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
121 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
122 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
207 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
208 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
209 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
217 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
218 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
219 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
220 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
221 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 0
Isolates 5.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.01
Nodule 1.66
Rhizoplane 1.52
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_9855 2124908027 Bacteria 1377
2 Ga0055536_1003342 3300003781 Bacteria 8673
3 Ga0055530_10005751 3300003791 Bacteria 5761
4 Ga0055540_1000763 3300003792 Bacteria 21879
5 Ga0055531_10000455 3300003794 Bacteria 38042
6 Ga0065714_10005435 3300005288 Bacteria 4995
7 Ga0065714_10010083 3300005288 Bacteria 2181
8 Ga0065714_10017593 3300005288 Bacteria 1727
9 Ga0065714_10024484 3300005288 Bacteria 2199
10 Ga0065714_10030293 3300005288 Bacteria 1022
11 Ga0065714_10094682 3300005288 Bacteria 1809
12 Ga0065714_10097799 3300005288 Bacteria 1726
13 Ga0065714_10190193 3300005288 Bacteria 930
14 Ga0065704_10105041 3300005289 Bacteria 2122
15 Ga0070669_100011132 3300005353 Bacteria 6385
16 Ga0070665_100006819 3300005548 Bacteria 11615
17 Ga0075364_10080064 3300006051 Bacteria 2159
18 Ga0075364_10099936 3300006051 Bacteria 1931
19 Ga0075364_10132500 3300006051 Bacteria 1673
20 Ga0075364_10321389 3300006051 Bacteria 1054
21 Ga0075364_10359726 3300006051 Bacteria 992
22 Ga0075432_10007328 3300006058 Bacteria 3756
23 Ga0075432_10032682 3300006058 Bacteria 1803
24 Ga0075432_10062569 3300006058 Bacteria 1327
25 Ga0075432_10079315 3300006058 Bacteria 1188
26 Ga0075432_10132682 3300006058 Bacteria 944
27 Ga0075362_10190322 3300006177 Bacteria 996
28 Ga0075369_10079354 3300006186 Bacteria 1454
29 Ga0075369_10237824 3300006186 Bacteria 844
30 Ga0075436_100249979 3300006914 Bacteria 1262
31 Ga0079104_1006262 3300006946 Bacteria 4547
32 Ga0105251_10000009 3300009011 Bacteria 192384
33 Ga0105251_10018282 3300009011 Bacteria 3730
34 Ga0105251_10047522 3300009011 Bacteria 2062
35 Ga0105251_10047871 3300009011 Bacteria 2052
36 Ga0105251_10199069 3300009011 Bacteria 903
37 Ga0105251_10258232 3300009011 Bacteria 786
38 Ga0105244_10021629 3300009036 Bacteria 3554
39 Ga0105244_10021781 3300009036 Bacteria 3537
40 Ga0105244_10021820 3300009036 Bacteria 3532
41 Ga0105244_10031031 3300009036 Bacteria 2839
42 Ga0105244_10031703 3300009036 Bacteria 2804
43 Ga0105244_10060611 3300009036 Bacteria 1906
44 Ga0105244_10071804 3300009036 Bacteria 1725
45 Ga0105244_10072997 3300009036 Bacteria 1709
46 Ga0105244_10099788 3300009036 Bacteria 1421
47 Ga0105244_10227233 3300009036 Bacteria 874
48 Ga0105250_10004530 3300009092 Bacteria 6377
49 Ga0105250_10014246 3300009092 Bacteria 3270
50 Ga0105250_10046421 3300009092 Bacteria 1742
51 Ga0105250_10096081 3300009092 Bacteria 1208
52 Ga0105250_10147477 3300009092 Bacteria 978
53 Ga0105250_10226613 3300009092 Bacteria 794
54 Ga0105243_10007026 3300009148 Bacteria 8662
55 Ga0105243_10028430 3300009148 Bacteria 4292
56 Ga0105243_10494171 3300009148 Bacteria 1158
57 Ga0105243_10563725 3300009148 Bacteria 1090
58 Ga0105242_10044355 3300009176 Bacteria 3601
59 Ga0105246_10076269 3300011119 Bacteria 2375
60 Ga0157345_1000667 3300012498 Bacteria 2831
61 Ga0157373_10055442 3300013100 Bacteria 2816
62 Ga0157373_10280478 3300013100 Bacteria 1181
63 Ga0157373_10436165 3300013100 Bacteria 941
64 Ga0157371_10043729 3300013102 Bacteria 3190
65 Ga0157370_10152159 3300013104 Bacteria 2153
66 Ga0157370_10791800 3300013104 Bacteria 863
67 Ga0157369_10111818 3300013105 Bacteria 2903
68 Ga0163162_10022085 3300013306 Bacteria 6271
69 Ga0157375_10198852 3300013308 Bacteria 2160
70 Ga0182008_10028605 3300014497 Bacteria 2819
71 Ga0182008_10033396 3300014497 Bacteria 2581
72 Ga0182008_10041918 3300014497 Bacteria 2281
73 Ga0182008_10052948 3300014497 Bacteria 2011
74 Ga0182008_10163441 3300014497 Bacteria 1121
75 Ga0182006_1026144 3300015261 Bacteria 2392
76 Ga0182006_1066070 3300015261 Bacteria 1352
77 Ga0182006_1124355 3300015261 Bacteria 893
78 Ga0182006_1126753 3300015261 Bacteria 882
79 Ga0182007_10020101 3300015262 Bacteria 2392
80 Ga0182007_10053144 3300015262 Bacteria 1334
81 Ga0182005_1010051 3300015265 Bacteria 2729
82 Ga0182005_1012176 3300015265 Bacteria 2435
83 Ga0182005_1029995 3300015265 Bacteria 1484
84 Ga0182005_1030696 3300015265 Bacteria 1464
85 Ga0163161_10049253 3300017792 Bacteria 3044
86 Ga0209675_1007548 3300025291 Bacteria 4150
87 Ga0209676_1000025 3300025292 Bacteria 577569
88 Ga0209050_1000099 3300025298 Bacteria 232176
89 Ga0209051_1000026 3300025303 Bacteria 413311
90 Ga0209257_1000034 3300025304 Bacteria 662719
91 Ga0207696_1000020 3300025711 Bacteria 434998
92 Ga0207696_1005329 3300025711 Bacteria 5352
93 Ga0207696_1036789 3300025711 Bacteria 1452
94 Ga0207655_1000014 3300025728 Bacteria 607124
95 Ga0207655_1003333 3300025728 Bacteria 12027
96 Ga0207655_1008336 3300025728 Bacteria 6593
97 Ga0207655_1013841 3300025728 Bacteria 4602
98 Ga0207655_1016883 3300025728 Bacteria 3969
99 Ga0207655_1026916 3300025728 Bacteria 2752
100 Ga0207655_1039791 3300025728 Bacteria 2037
101 Ga0207655_1069776 3300025728 Bacteria 1312
102 Ga0207655_1077237 3300025728 Bacteria 1215
103 Ga0207655_1082848 3300025728 Bacteria 1152
104 Ga0207655_1115786 3300025728 Bacteria 897
105 Ga0207713_1000032 3300025735 Bacteria 276465
106 Ga0207713_1014205 3300025735 Bacteria 4152
107 Ga0207713_1016086 3300025735 Bacteria 3810
108 Ga0207713_1020042 3300025735 Bacteria 3253
109 Ga0207713_1020633 3300025735 Bacteria 3186
110 Ga0207713_1036393 3300025735 Bacteria 2112
111 Ga0207681_10070757 3300025923 Bacteria 2430
112 Ga0207686_10021265 3300025934 Bacteria 3721
113 Ga0207709_10000040 3300025935 Bacteria 259497
114 Ga0207709_10015747 3300025935 Bacteria 4196
115 Ga0209281_1000026 3300027111 Bacteria 465877
116 Ga0207428_10070949 3300027907 Bacteria 2737
117 Ga0207428_10100560 3300027907 Bacteria 2235
118 Ga0207428_10151856 3300027907 Bacteria 1763
119 Ga0207428_10163079 3300027907 Bacteria 1692
120 Ga0207428_10273328 3300027907 Bacteria 1256
121 Ga0268266_10001806 3300028379 Bacteria 24227
122 Ga0307516_10281725 3300031730 Bacteria 1344
123 Ga0439438_009479 3300041405 Bacteria 3148
124 Ga0439438_011152 3300041405 Bacteria 2811
125 Ga0439438_027980 3300041405 Bacteria 1518
126 Ga0439438_030594 3300041405 Bacteria 1434
127 Ga0439438_037669 3300041405 Bacteria 1264
128 Ga0439438_074975 3300041405 Bacteria 834
129 Ga0439447_006358 3300041407 Bacteria 3844
130 Ga0439447_043814 3300041407 Bacteria 1083
131 Ga0439461_0008853 3300041410 Bacteria 1814
132 Ga0439466_0017035 3300041411 Bacteria 2619
133 Ga0439466_0030353 3300041411 Bacteria 1854
134 Ga0439466_0038130 3300041411 Bacteria 1615
135 Ga0439466_0056701 3300041411 Bacteria 1270
136 Ga0439466_0068400 3300041411 Bacteria 1135
137 Ga0439466_0079648 3300041411 Bacteria 1034
138 Ga0439465_0013674 3300041413 Bacteria 2528
139 Ga0439465_0042087 3300041413 Bacteria 1480
140 Ga0439465_0187931 3300041413 Bacteria 749
141 Ga0439442_020198 3300042002 Bacteria 1380
142 Ga0439432_021925 3300042006 Bacteria 2112
143 Ga0439432_042341 3300042006 Bacteria 1439
144 Ga0439432_042897 3300042006 Bacteria 1429
145 Ga0439432_056931 3300042006 Bacteria 1210
146 Ga0439451_004476 3300042009 Bacteria 2839
147 Ga0439451_017408 3300042009 Bacteria 1448
148 Ga0439451_030983 3300042009 Bacteria 1075
149 Ga0439451_036545 3300042009 Bacteria 987
150 Ga0439452_032962 3300042010 Bacteria 1260
151 Ga0439452_037621 3300042010 Bacteria 1152
152 Ga0439452_038815 3300042010 Bacteria 1129
153 Ga0439452_056087 3300042010 Bacteria 891
154 Ga0439456_005716 3300042013 Bacteria 2527
155 Ga0439456_013570 3300042013 Bacteria 1696
156 Ga0439463_004715 3300042016 Bacteria 3406
157 Ga0439463_014296 3300042016 Bacteria 1956
158 Ga0450911_006770 3300042115 Bacteria 1688
159 Ga0450919_002459 3300042121 Bacteria 2400
160 Ga0450920_014225 3300042122 Bacteria 1503
161 Ga0450920_026865 3300042122 Bacteria 1124
162 Ga0450922_000863 3300042124 Bacteria 3102
163 Ga0450922_001792 3300042124 Bacteria 2070
164 Ga0450890_001350 3300042127 Bacteria 3542
165 Ga0450902_005890 3300042137 Bacteria 1866
166 Ga0450902_016712 3300042137 Bacteria 1197
167 Ga0450903_006466 3300042138 Bacteria 1943
168 Ga0450903_010440 3300042138 Bacteria 1502
169 Ga0450903_013248 3300042138 Bacteria 1312
170 Ga0450904_003201 3300042139 Bacteria 1800
171 Ga0450904_010528 3300042139 Bacteria 914
172 Ga0450904_030267 3300042139 Bacteria 565
173 Ga0450905_013462 3300042142 Bacteria 1159
174 Ga0450905_018591 3300042142 Bacteria 1013
175 Ga0450889_003748 3300042144 Bacteria 1499
176 Ga0450906_018855 3300042145 Bacteria 1236
177 Ga0450906_032230 3300042145 Bacteria 927
178 Ga0450906_040661 3300042145 Bacteria 820
179 Ga0450907_003628 3300042146 Bacteria 2729
180 Ga0450907_014196 3300042146 Bacteria 1329
181 Ga0450907_017733 3300042146 Bacteria 1188
182 Ga0450907_024258 3300042146 Bacteria 1024
183 Ga0450910_002330 3300042147 Bacteria 2487
184 Ga0450910_006816 3300042147 Bacteria 1582
185 Ga0450910_009454 3300042147 Bacteria 1380
186 Ga0439446_0010570 3300042156 Bacteria 2488
187 Ga0439446_0024126 3300042156 Bacteria 1733
188 Ga0439446_0024147 3300042156 Bacteria 1733
189 Ga0450908_001017 3300042184 Bacteria 5431
190 Ga0450908_015742 3300042184 Bacteria 1352
191 Ga0450908_016795 3300042184 Bacteria 1303
192 Ga0450909_006648 3300042185 Bacteria 1665
193 Ga0450909_011158 3300042185 Bacteria 1316
194 Ga0450909_021995 3300042185 Bacteria 954
195 Ga0439434_0007800 3300042435 Bacteria 3137
196 Ga0439434_0021220 3300042435 Bacteria 1951
197 Ga0439464_0014921 3300042439 Bacteria 2093
198 Ga0439460_0005613 3300042461 Bacteria 3088
199 Ga0450918_002698 3300042531 Bacteria 3333
200 Ga0450918_011748 3300042531 Bacteria 1525
201 Ga0450893_0015554 3300042532 Bacteria 1283
202 Ga0450893_0037499 3300042532 Bacteria 879
203 Ga0450901_002834 3300042533 Bacteria 1839
204 Ga0439440_0006000 3300042993 Bacteria 2430
205 Ga0439440_0057499 3300042993 Bacteria 985
206 Ga0495617_008812 3300046452 Bacteria 3473
207 Ga0495617_013735 3300046452 Bacteria 2753
208 Ga0495617_018480 3300046452 Bacteria 2357
209 Ga0495617_018504 3300046452 Bacteria 2355
210 Ga0495617_028902 3300046452 Bacteria 1864
211 Ga0495617_031330 3300046452 Bacteria 1786
212 Ga0495617_037924 3300046452 Bacteria 1613
213 Ga0495617_039660 3300046452 Bacteria 1575
214 Ga0495617_040568 3300046452 Bacteria 1556
215 Ga0495617_048679 3300046452 Bacteria 1410
216 Ga0495617_075611 3300046452 Bacteria 1105
217 Ga0495617_082801 3300046452 Bacteria 1050
218 Ga0495617_127600 3300046452 Bacteria 817
219 Ga0495617_148349 3300046452 Bacteria 746
220 Ga0495627_004052 3300046453 Bacteria 6244
221 Ga0495627_022519 3300046453 Bacteria 2073
222 Ga0495603_0076012 3300046455 Bacteria 1971
223 Ga0495603_0247462 3300046455 Bacteria 1026
224 Ga0495590_0014560 3300046457 Bacteria 2867
225 Ga0495590_0016295 3300046457 Bacteria 2686
226 Ga0495590_0023761 3300046457 Bacteria 2162
227 Ga0495590_0028003 3300046457 Bacteria 1977
228 Ga0495590_0031130 3300046457 Bacteria 1868
229 Ga0495590_0046600 3300046457 Bacteria 1512
230 Ga0495591_012302 3300046458 Bacteria 3192
231 Ga0495591_019297 3300046458 Bacteria 2286
232 Ga0495591_019932 3300046458 Bacteria 2230
233 Ga0495591_026265 3300046458 Bacteria 1812
234 Ga0495591_027321 3300046458 Bacteria 1761
235 Ga0495591_032289 3300046458 Bacteria 1560
236 Ga0495591_035936 3300046458 Bacteria 1445
237 Ga0495591_035983 3300046458 Bacteria 1444
238 Ga0495591_064850 3300046458 Bacteria 961
239 Ga0495591_107314 3300046458 Bacteria 687
240 Ga0495638_0043662 3300046460 Bacteria 2827
241 Ga0495638_0051303 3300046460 Bacteria 2572
242 Ga0495638_0068355 3300046460 Bacteria 2178
243 Ga0495638_0076068 3300046460 Bacteria 2045
244 Ga0495638_0078708 3300046460 Bacteria 2005
245 Ga0495638_0081225 3300046460 Bacteria 1968
246 Ga0495638_0082984 3300046460 Bacteria 1942
247 Ga0495638_0088348 3300046460 Bacteria 1871
248 Ga0495638_0199775 3300046460 Bacteria 1129
249 Ga0495638_0208337 3300046460 Bacteria 1099
250 Ga0495638_0350330 3300046460 Bacteria 780
251 Ga0495638_0380632 3300046460 Bacteria 737
252 Ga0495653_0071671 3300046463 Bacteria 2589
253 Ga0495650_0022567 3300046471 Bacteria 3015
254 Ga0495650_0028050 3300046471 Bacteria 2591
255 Ga0495650_0038149 3300046471 Bacteria 2084
256 Ga0495650_0038925 3300046471 Bacteria 2055
257 Ga0495650_0053131 3300046471 Bacteria 1660
258 Ga0495650_0060971 3300046471 Bacteria 1512
259 Ga0495650_0163068 3300046471 Bacteria 793
260 Ga0495650_0219314 3300046471 Bacteria 655
261 Ga0495582_0037880 3300046473 Bacteria 2652
262 Ga0495605_0028837 3300046474 Bacteria 2861
263 Ga0495605_0036904 3300046474 Bacteria 2461
264 Ga0495605_0040929 3300046474 Bacteria 2310
265 Ga0495605_0044256 3300046474 Bacteria 2202
266 Ga0495605_0052952 3300046474 Bacteria 1970
267 Ga0495605_0054274 3300046474 Bacteria 1941
268 Ga0495605_0063138 3300046474 Bacteria 1767
269 Ga0495605_0111294 3300046474 Bacteria 1249
270 Ga0495605_0120156 3300046474 Bacteria 1191
271 Ga0495605_0120163 3300046474 Bacteria 1191
272 Ga0495605_0128474 3300046474 Bacteria 1144
273 Ga0495605_0265256 3300046474 Bacteria 732
274 Ga0495639_0009061 3300046475 Bacteria 4268
275 Ga0495639_0025876 3300046475 Bacteria 2590
276 Ga0495662_0353124 3300046476 Bacteria 723
277 Ga0495664_0484563 3300046477 Bacteria 739
278 Ga0495584_0021275 3300046491 Bacteria 3295
279 Ga0495584_0029117 3300046491 Bacteria 2798
280 Ga0495584_0047382 3300046491 Bacteria 2167
281 Ga0495584_0049595 3300046491 Bacteria 2115
282 Ga0495584_0058813 3300046491 Bacteria 1933
283 Ga0495584_0059012 3300046491 Bacteria 1930
284 Ga0495584_0082386 3300046491 Bacteria 1619
285 Ga0495584_0091542 3300046491 Bacteria 1534
286 Ga0495584_0100017 3300046491 Bacteria 1465
287 Ga0495584_0106975 3300046491 Bacteria 1414
288 Ga0495585_0019369 3300046492 Bacteria 3923
289 Ga0495585_0033602 3300046492 Bacteria 2902
290 Ga0495585_0056966 3300046492 Bacteria 2157
291 Ga0495585_0064711 3300046492 Bacteria 2004
292 Ga0495585_0079730 3300046492 Bacteria 1775
293 Ga0495585_0096250 3300046492 Bacteria 1588
294 Ga0495585_0102739 3300046492 Bacteria 1527
295 Ga0495585_0120904 3300046492 Bacteria 1385
296 Ga0495585_0158686 3300046492 Bacteria 1175
297 Ga0495594_0022302 3300046499 Bacteria 3386
298 Ga0495594_0167291 3300046499 Bacteria 1250
299 Ga0495596_0059836 3300046500 Bacteria 1484
300 Ga0495607_0018722 3300046501 Bacteria 4405
301 Ga0495607_0051600 3300046501 Bacteria 2388
302 Ga0495607_0056014 3300046501 Bacteria 2265
303 Ga0495607_0076794 3300046501 Bacteria 1846
304 Ga0495607_0083953 3300046501 Bacteria 1743
305 Ga0495607_0231455 3300046501 Bacteria 898
306 Ga0495583_0043180 3300046506 Bacteria 2100
307 Ga0495583_0055364 3300046506 Bacteria 1792
308 Ga0495583_0112208 3300046506 Bacteria 1154
309 Ga0495606_0013340 3300046507 Bacteria 6503
310 Ga0495606_0063549 3300046507 Bacteria 2352
311 Ga0495606_0074477 3300046507 Bacteria 2126
312 Ga0495606_0075394 3300046507 Bacteria 2110
313 Ga0495606_0084294 3300046507 Bacteria 1968
314 Ga0495606_0089778 3300046507 Bacteria 1893
315 Ga0495606_0097694 3300046507 Bacteria 1793
316 Ga0495610_0026866 3300046512 Bacteria 3068
317 Ga0495610_0033978 3300046512 Bacteria 2630
318 Ga0495610_0034606 3300046512 Bacteria 2601
319 Ga0495610_0053667 3300046512 Bacteria 1950
320 Ga0495610_0057997 3300046512 Bacteria 1854
321 Ga0495610_0060409 3300046512 Bacteria 1804
322 Ga0495610_0063234 3300046512 Bacteria 1753
323 Ga0495610_0095554 3300046512 Bacteria 1339
324 Ga0495610_0228230 3300046512 Bacteria 748
325 Ga0495616_0041909 3300046513 Bacteria 2333
326 Ga0495616_0048882 3300046513 Bacteria 2122
327 Ga0495616_0049188 3300046513 Bacteria 2115
328 Ga0495616_0068253 3300046513 Bacteria 1726
329 Ga0495616_0068327 3300046513 Bacteria 1725
330 Ga0495616_0089816 3300046513 Bacteria 1456
331 Ga0495616_0127117 3300046513 Bacteria 1171
332 Ga0495616_0200457 3300046513 Bacteria 877
333 Ga0495616_0268196 3300046513 Bacteria 728
334 Ga0495616_0397101 3300046513 Bacteria 567
335 Ga0495620_0033044 3300046515 Bacteria 2351
336 Ga0495620_0044279 3300046515 Bacteria 1934
337 Ga0495620_0054876 3300046515 Bacteria 1681
338 Ga0495620_0055479 3300046515 Bacteria 1669
339 Ga0495620_0057617 3300046515 Bacteria 1629
340 Ga0495620_0062390 3300046515 Bacteria 1548
341 Ga0495620_0068874 3300046515 Bacteria 1452
342 Ga0495630_0120810 3300046517 Bacteria 1987
343 Ga0495630_0134661 3300046517 Bacteria 1877
344 Ga0495630_0181255 3300046517 Bacteria 1606
345 Ga0495631_0039391 3300046518 Bacteria 2097
346 Ga0495631_0052976 3300046518 Bacteria 1771
347 Ga0495631_0100270 3300046518 Bacteria 1246
348 Ga0495631_0258881 3300046518 Bacteria 741
349 Ga0495632_0019920 3300046519 Bacteria 3644
350 Ga0495632_0029658 3300046519 Bacteria 2845
351 Ga0495632_0046246 3300046519 Bacteria 2163
352 Ga0495632_0058151 3300046519 Bacteria 1885
353 Ga0495632_0060974 3300046519 Bacteria 1831
354 Ga0495632_0077148 3300046519 Bacteria 1593
355 Ga0495632_0125940 3300046519 Bacteria 1194
356 Ga0495632_0127844 3300046519 Bacteria 1184
357 Ga0495632_0133045 3300046519 Bacteria 1156
358 Ga0495632_0157993 3300046519 Bacteria 1045
359 Ga0495632_0211410 3300046519 Bacteria 880
360 Ga0495632_0252330 3300046519 Bacteria 791
361 Ga0495632_0260106 3300046519 Bacteria 776
362 Ga0495637_0014003 3300046520 Bacteria 3793
363 Ga0495637_0017667 3300046520 Bacteria 3318
364 Ga0495637_0036841 3300046520 Bacteria 2127
365 Ga0495637_0039219 3300046520 Bacteria 2045
366 Ga0495637_0041323 3300046520 Bacteria 1978
367 Ga0495637_0045026 3300046520 Bacteria 1874
368 Ga0495637_0045964 3300046520 Bacteria 1848
369 Ga0495637_0048599 3300046520 Bacteria 1785
370 Ga0495637_0055752 3300046520 Bacteria 1638
371 Ga0495637_0080201 3300046520 Bacteria 1302
372 Ga0495637_0094536 3300046520 Bacteria 1174
373 Ga0495637_0162627 3300046520 Bacteria 836
374 Ga0495643_0030917 3300046522 Bacteria 2984
375 Ga0495643_0056343 3300046522 Bacteria 2098
376 Ga0495643_0062737 3300046522 Bacteria 1966
377 Ga0495643_0122353 3300046522 Bacteria 1313
378 Ga0495643_0165750 3300046522 Bacteria 1084
379 Ga0495643_0177549 3300046522 Bacteria 1037
380 Ga0495644_0019692 3300046523 Bacteria 2576
381 Ga0495644_0030970 3300046523 Bacteria 2020
382 Ga0495644_0071946 3300046523 Bacteria 1300
383 Ga0495648_0017811 3300046524 Bacteria 5063
384 Ga0495648_0055476 3300046524 Bacteria 2388
385 Ga0495648_0055738 3300046524 Bacteria 2381
386 Ga0495648_0059001 3300046524 Bacteria 2291
387 Ga0495648_0078452 3300046524 Bacteria 1888
388 Ga0495648_0085718 3300046524 Bacteria 1778
389 Ga0495648_0086753 3300046524 Bacteria 1764
390 Ga0495648_0089699 3300046524 Bacteria 1724
391 Ga0495648_0203044 3300046524 Bacteria 990
392 Ga0495648_0209189 3300046524 Bacteria 970
393 Ga0495648_0243061 3300046524 Bacteria 873
394 Ga0495666_0040456 3300046526 Bacteria 2260
395 Ga0495666_0045737 3300046526 Bacteria 2110
396 Ga0495666_0049736 3300046526 Bacteria 2016
397 Ga0495642_0017001 3300046528 Bacteria 2839
398 Ga0495642_0030779 3300046528 Bacteria 2148
399 Ga0495642_0064223 3300046528 Bacteria 1527
400 Ga0495642_0343907 3300046528 Bacteria 655
401 Ga0495654_0015958 3300046530 Bacteria 3979
402 Ga0495654_0018076 3300046530 Bacteria 3697
403 Ga0495654_0023639 3300046530 Bacteria 3181
404 Ga0495654_0031701 3300046530 Bacteria 2682
405 Ga0495654_0036978 3300046530 Bacteria 2451
406 Ga0495654_0044064 3300046530 Bacteria 2208
407 Ga0495654_0047838 3300046530 Bacteria 2101
408 Ga0495654_0053548 3300046530 Bacteria 1960
409 Ga0495654_0057229 3300046530 Bacteria 1884
410 Ga0495654_0062202 3300046530 Bacteria 1790
411 Ga0495654_0065255 3300046530 Bacteria 1738
412 Ga0495654_0072927 3300046530 Bacteria 1624
413 Ga0495654_0089787 3300046530 Bacteria 1427
414 Ga0495654_0090192 3300046530 Bacteria 1423
415 Ga0495654_0102885 3300046530 Bacteria 1312
416 Ga0495654_0167959 3300046530 Bacteria 958
417 Ga0495654_0174058 3300046530 Bacteria 936
418 Ga0495586_0045766 3300046535 Bacteria 2358
419 Ga0495587_0045028 3300046536 Bacteria 2623
420 Ga0495587_0079837 3300046536 Bacteria 1897
421 Ga0495587_0155332 3300046536 Bacteria 1303
422 Ga0495587_0384027 3300046536 Bacteria 781
423 Ga0495609_0029615 3300046538 Bacteria 2492
424 Ga0495609_0035436 3300046538 Bacteria 2258
425 Ga0495609_0055240 3300046538 Bacteria 1762
426 Ga0495609_0066751 3300046538 Bacteria 1584
427 Ga0495609_0077689 3300046538 Bacteria 1453
428 Ga0495609_0081597 3300046538 Bacteria 1413
429 Ga0495609_0121331 3300046538 Bacteria 1123
430 Ga0495609_0172301 3300046538 Bacteria 913
431 Ga0495597_0025986 3300046542 Bacteria 2691
432 Ga0495597_0040027 3300046542 Bacteria 2095
433 Ga0495597_0045606 3300046542 Bacteria 1944
434 Ga0495597_0095923 3300046542 Bacteria 1254
435 Ga0495597_0096527 3300046542 Bacteria 1249
436 Ga0495597_0121658 3300046542 Bacteria 1087
437 Ga0495622_0020444 3300046557 Bacteria 3083
438 Ga0495622_0095271 3300046557 Bacteria 1366
439 Ga0495633_0039347 3300046558 Bacteria 2256
440 Ga0495633_0066843 3300046558 Bacteria 1678
441 Ga0495668_0018346 3300046616 Bacteria 4042
442 Ga0495668_0042269 3300046616 Bacteria 2537
443 Ga0495668_0070665 3300046616 Bacteria 1919
444 Ga0495634_0367415 3300046642 Bacteria 859
445 Ga0495611_0020755 3300046648 Bacteria 2831
446 Ga0495611_0026324 3300046648 Bacteria 2537
447 Ga0495611_0056009 3300046648 Bacteria 1784
448 Ga0495611_0058070 3300046648 Bacteria 1754
449 Ga0495611_0062809 3300046648 Bacteria 1689
450 Ga0495611_0112564 3300046648 Bacteria 1267
451 Ga0495625_0052388 3300046660 Bacteria 2922
452 Ga0495625_0061490 3300046660 Bacteria 2657
453 Ga0495625_0066657 3300046660 Bacteria 2535
454 Ga0495625_0084477 3300046660 Bacteria 2204
455 Ga0495625_0088593 3300046660 Bacteria 2143
456 Ga0495625_0105988 3300046660 Bacteria 1925
457 Ga0495625_0167693 3300046660 Bacteria 1467
458 Ga0495625_0173091 3300046660 Bacteria 1440
459 Ga0495625_0204067 3300046660 Bacteria 1303
460 Ga0495625_0319355 3300046660 Bacteria 989
461 Ga0495625_0347946 3300046660 Bacteria 937
462 Ga0495625_0407953 3300046660 Bacteria 847
463 Ga0495625_0428691 3300046660 Bacteria 821
464 Ga0495625_0444170 3300046660 Bacteria 802
465 Ga0495635_0067579 3300046663 Bacteria 2451
466 Ga0495635_0103801 3300046663 Bacteria 1942
467 Ga0495659_0005866 3300046664 Bacteria 3877
468 Ga0495659_0043848 3300046664 Bacteria 1606
469 Ga0495659_0053173 3300046664 Bacteria 1479
470 Ga0495661_0051020 3300046665 Bacteria 2500
471 Ga0495661_0086156 3300046665 Bacteria 1798
472 Ga0495661_0118276 3300046665 Bacteria 1467
473 Ga0495661_0198436 3300046665 Bacteria 1052
474 Ga0495661_0272087 3300046665 Bacteria 857
475 Ga0495661_0301244 3300046665 Bacteria 802
476 Ga0495661_0413260 3300046665 Bacteria 654
477 Ga0495588_0126423 3300046674 Bacteria 1348
478 Ga0495588_0286199 3300046674 Bacteria 868
479 Ga0495623_0079283 3300046679 Bacteria 2034
480 Ga0495646_0048639 3300046680 Bacteria 2575
481 Ga0495646_0065391 3300046680 Bacteria 2153
482 Ga0495669_0233041 3300046684 Bacteria 883
483 Ga0495613_0316221 3300046689 Bacteria 1078
484 Ga0495670_0031870 3300046691 Bacteria 2620
485 Ga0495670_0060597 3300046691 Bacteria 1901
486 Ga0495670_0078581 3300046691 Bacteria 1678
487 Ga0495670_0126708 3300046691 Bacteria 1329
488 Ga0495670_0217948 3300046691 Bacteria 1013
489 Ga0495671_0018600 3300046692 Bacteria 3685
490 Ga0495671_0041942 3300046692 Bacteria 2302
491 Ga0495671_0044032 3300046692 Bacteria 2239
492 Ga0495671_0048675 3300046692 Bacteria 2114
493 Ga0495671_0051598 3300046692 Bacteria 2045
494 Ga0495671_0086233 3300046692 Bacteria 1538
495 Ga0495671_0105467 3300046692 Bacteria 1376
496 Ga0495671_0116151 3300046692 Bacteria 1306
497 Ga0495671_0124928 3300046692 Bacteria 1254
498 Ga0495671_0157913 3300046692 Bacteria 1103
499 Ga0495671_0176987 3300046692 Bacteria 1036
500 Ga0495671_0191289 3300046692 Bacteria 993
501 Ga0495649_0023264 3300046694 Bacteria 3463
502 Ga0495649_0031616 3300046694 Bacteria 2917
503 Ga0495649_0048550 3300046694 Bacteria 2307
504 Ga0495649_0059923 3300046694 Bacteria 2048
505 Ga0495649_0068406 3300046694 Bacteria 1905
506 Ga0495649_0073567 3300046694 Bacteria 1830
507 Ga0495649_0084431 3300046694 Bacteria 1695
508 Ga0495649_0096334 3300046694 Bacteria 1574
509 Ga0495649_0099844 3300046694 Bacteria 1543
510 Ga0495649_0149667 3300046694 Bacteria 1226
511 Ga0495649_0164746 3300046694 Bacteria 1161
512 Ga0495649_0215875 3300046694 Bacteria 993
513 Ga0495649_0289972 3300046694 Bacteria 835
514 Ga0495589_0011789 3300046794 Bacteria 4535
515 Ga0495589_0022704 3300046794 Bacteria 3200
516 Ga0495589_0039364 3300046794 Bacteria 2362
517 Ga0495589_0039772 3300046794 Bacteria 2349
518 Ga0495589_0041936 3300046794 Bacteria 2281
519 Ga0495589_0069052 3300046794 Bacteria 1728
520 Ga0495589_0101465 3300046794 Bacteria 1392
521 Ga0495600_0195638 3300046809 Bacteria 1299
522 Ga0495660_0043601 3300046810 Bacteria 2473
523 Ga0495660_0053282 3300046810 Bacteria 2196
524 Ga0495660_0055364 3300046810 Bacteria 2147
525 Ga0495660_0059432 3300046810 Bacteria 2056
526 Ga0495660_0063516 3300046810 Bacteria 1976
527 Ga0495660_0075644 3300046810 Bacteria 1775
528 Ga0495660_0076045 3300046810 Bacteria 1769
529 Ga0495660_0081715 3300046810 Bacteria 1693
530 Ga0495660_0083858 3300046810 Bacteria 1667
531 Ga0495660_0124573 3300046810 Bacteria 1299
532 Ga0495660_0136947 3300046810 Bacteria 1222
533 Ga0495660_0137976 3300046810 Bacteria 1216
534 Ga0495660_0153564 3300046810 Bacteria 1134
535 Ga0495660_0203719 3300046810 Bacteria 943
536 Ga0495581_0026026 3300047315 Bacteria 3393
537 Ga0495581_0065128 3300047315 Bacteria 2106
538 Ga0495604_0075849 3300047317 Bacteria 2530
539 Ga0495604_0141537 3300047317 Bacteria 1718
540 Ga0495636_0006978 3300047318 Bacteria 4444
541 Ga0495672_0025014 3300047320 Bacteria 3832
542 Ga0495672_0027259 3300047320 Bacteria 3632
543 Ga0495672_0027788 3300047320 Bacteria 3590
544 Ga0495672_0046221 3300047320 Bacteria 2597
545 Ga0495672_0048008 3300047320 Bacteria 2534
546 Ga0495672_0051761 3300047320 Bacteria 2416
547 Ga0495672_0064657 3300047320 Bacteria 2093
548 Ga0495672_0082013 3300047320 Bacteria 1794
549 Ga0495672_0093129 3300047320 Bacteria 1650
550 Ga0495672_0132825 3300047320 Bacteria 1307
551 Ga0495672_0160491 3300047320 Bacteria 1156
552 Ga0495672_0189740 3300047320 Bacteria 1034
553 Ga0495680_0088734 3300047322 Bacteria 2323
554 Ga0495680_0146597 3300047322 Bacteria 1723
555 Ga0495680_0151797 3300047322 Bacteria 1688
556 Ga0495680_0164442 3300047322 Bacteria 1609
557 Ga0495680_0205489 3300047322 Bacteria 1411
558 Ga0495683_0046815 3300047323 Bacteria 2170
559 Ga0495683_0053527 3300047323 Bacteria 2012
560 Ga0495683_0056761 3300047323 Bacteria 1947
561 Ga0495683_0067640 3300047323 Bacteria 1758
562 Ga0495683_0094394 3300047323 Bacteria 1445
563 Ga0495683_0160385 3300047323 Bacteria 1040
564 Ga0495683_0184942 3300047323 Bacteria 949
565 Ga0495687_010316 3300047443 Bacteria 5129
566 Ga0495687_017014 3300047443 Bacteria 3641
567 Ga0495687_025205 3300047443 Bacteria 2815
568 Ga0495675_0077411 3300047444 Bacteria 2095
569 Ga0495677_0043564 3300047445 Bacteria 1645
570 Ga0495677_0378549 3300047445 Bacteria 559
571 Ga0495679_016209 3300047446 Bacteria 2701
572 Ga0495679_020495 3300047446 Bacteria 2301
573 Ga0495679_024143 3300047446 Bacteria 2052
574 Ga0495679_033539 3300047446 Bacteria 1639
575 Ga0495679_046810 3300047446 Bacteria 1314
576 Ga0495679_054614 3300047446 Bacteria 1189
577 Ga0495679_133672 3300047446 Bacteria 672
578 Ga0495685_021251 3300047447 Bacteria 2233
579 Ga0495673_0021477 3300047469 Bacteria 3185
580 Ga0495673_0033513 3300047469 Bacteria 2382
581 Ga0495673_0036921 3300047469 Bacteria 2236
582 Ga0495673_0042663 3300047469 Bacteria 2034
583 Ga0495673_0053153 3300047469 Bacteria 1767
584 Ga0495673_0053658 3300047469 Bacteria 1756
585 Ga0495673_0054866 3300047469 Bacteria 1731
586 Ga0495673_0055353 3300047469 Bacteria 1720
587 Ga0495673_0060265 3300047469 Bacteria 1628
588 Ga0495673_0065683 3300047469 Bacteria 1540
589 Ga0495673_0148626 3300047469 Bacteria 907
590 Ga0495681_0039449 3300047470 Bacteria 2305
591 Ga0495681_0043825 3300047470 Bacteria 2155
592 Ga0495681_0045411 3300047470 Bacteria 2102
593 Ga0495681_0066396 3300047470 Bacteria 1646
594 Ga0495681_0067743 3300047470 Bacteria 1625
595 Ga0495681_0071310 3300047470 Bacteria 1573
596 Ga0495681_0080446 3300047470 Bacteria 1455
597 Ga0495681_0095147 3300047470 Bacteria 1309
598 Ga0495681_0097633 3300047470 Bacteria 1288
599 Ga0495684_0108225 3300047471 Bacteria 2099
600 Ga0495686_0055193 3300047472 Bacteria 2485
601 Ga0495686_0081703 3300047472 Bacteria 1972
602 Ga0495686_0083044 3300047472 Bacteria 1954
603 Ga0495686_0230581 3300047472 Bacteria 1049
604 Ga0495686_0526446 3300047472 Bacteria 620
605 Ga0495593_0041237 3300047673 Bacteria 2482
606 Ga0495593_0054416 3300047673 Bacteria 2110
607 Ga0495593_0055039 3300047673 Bacteria 2095
608 Ga0495593_0087182 3300047673 Bacteria 1609
609 Ga0495593_0103859 3300047673 Bacteria 1455
610 Ga0495602_0188018 3300048088 Bacteria 1586
611 Ga0495626_0018006 3300048091 Bacteria 3557
612 Ga0495626_0026086 3300048091 Bacteria 2852
613 Ga0495626_0027406 3300048091 Bacteria 2771
614 Ga0495626_0028191 3300048091 Bacteria 2724
615 Ga0495626_0030563 3300048091 Bacteria 2597
616 Ga0495626_0041953 3300048091 Bacteria 2151
617 Ga0495626_0043329 3300048091 Bacteria 2111
618 Ga0495626_0054623 3300048091 Bacteria 1833
619 Ga0495626_0074667 3300048091 Bacteria 1516
620 Ga0495626_0075667 3300048091 Bacteria 1504
621 Ga0495626_0122294 3300048091 Bacteria 1117
622 Ga0495626_0157079 3300048091 Bacteria 955
623 Ga0496102_0312023 3300048905 Bacteria 1482
624 Ga0496102_1395604 3300048905 Bacteria 619
625 Ga0496104_0659651 3300048907 Bacteria 955
626 Ga0496105_0249695 3300048908 Bacteria 1438
627 Ga0496106_0270911 3300048909 Bacteria 1359
628 Ga0496107_0284576 3300048910 Bacteria 1230
629 Ga0496114_0147414 3300048917 Bacteria 2041
630 Ga0496115_0132930 3300048918 Bacteria 2051
631 Ga0496116_0026565 3300048919 Bacteria 4231
632 Ga0496116_0049433 3300048919 Bacteria 2813
633 Ga0496116_0100073 3300048919 Bacteria 1735
634 Ga0496116_0161685 3300048919 Bacteria 1227
635 Ga0496117_0042375 3300048920 Bacteria 3323
636 Ga0496117_0065352 3300048920 Bacteria 2474
637 Ga0496117_0193849 3300048920 Bacteria 1154
638 Ga0496118_0044768 3300048921 Bacteria 3462
639 Ga0496118_0081022 3300048921 Bacteria 2281
640 Ga0496118_0193049 3300048921 Bacteria 1215
641 Ga0496121_0069421 3300048924 Bacteria 2843
642 Ga0496121_0151708 3300048924 Bacteria 1704
643 Ga0496122_0039078 3300048925 Bacteria 3789
644 Ga0496122_0074695 3300048925 Bacteria 2396
645 Ga0496123_0035544 3300048926 Bacteria 3547
646 Ga0496123_0073984 3300048926 Bacteria 2111
647 Ga0496124_0096523 3300048927 Bacteria 2401
648 Ga0496124_0096824 3300048927 Bacteria 2396
649 Ga0496124_0099295 3300048927 Bacteria 2361
650 Ga0496124_0185792 3300048927 Bacteria 1595
651 Ga0496124_0190783 3300048927 Bacteria 1568
652 Ga0495678_012139 3300049459 Bacteria 4091
653 Ga0495678_026231 3300049459 Bacteria 2491
654 Ga0495678_038494 3300049459 Bacteria 1934
655 Ga0495678_041243 3300049459 Bacteria 1848
656 Ga0495678_041820 3300049459 Bacteria 1830
657 Ga0495678_043031 3300049459 Bacteria 1796
658 Ga0495678_045663 3300049459 Bacteria 1726
659 Ga0495678_047955 3300049459 Bacteria 1669
660 Ga0495682_0001177 3300049460 Bacteria 14917
661 Ga0495682_0021979 3300049460 Bacteria 2388
662 Ga0495682_0021998 3300049460 Bacteria 2387
663 Ga0495682_0035118 3300049460 Bacteria 1847
664 Ga0495682_0037227 3300049460 Bacteria 1790
665 Ga0495682_0068460 3300049460 Bacteria 1278
666 Ga0495682_0098758 3300049460 Bacteria 1047
667 Ga0495682_0127090 3300049460 Bacteria 912
668 Ga0495682_0163945 3300049460 Bacteria 791
669 nmdc:mga03683_247202_c1 3300050489 Bacteria 828
670 nmdc:mga03683_336380_c1 3300050489 Bacteria 713
671 nmdc:mga03683_50443_c1 3300050489 Bacteria 1735
672 nmdc:mga00v17_161906_c1 3300050491 Bacteria 1441
673 nmdc:mga00v17_226567_c1 3300050491 Bacteria 1211
674 nmdc:mga00v17_449406_c1 3300050491 Bacteria 837
675 nmdc:mga00v17_97716_c1 3300050491 Bacteria 1851
676 nmdc:mga08x19_142583_c1 3300050514 Bacteria 1619
677 nmdc:mga08x19_358313_c1 3300050514 Bacteria 1019
678 nmdc:mga0sz30_195038_c1 3300050516 Bacteria 899
679 nmdc:mga0sz30_212972_c1 3300050516 Bacteria 859
680 Ga0500572_008123 3300053111 Bacteria 2445
681 Ga0500572_208079 3300053111 Bacteria 640
682 Ga0500586_038459 3300053145 Bacteria 1612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046457 Ga0495590_0028003 Ga0495590_0028003_1085_1507 129
2 3300005288 Ga0065714_10094682 Ga0065714_100946822 146
3 3300046458 Ga0495591_064850 Ga0495591_064850_324_884 148
4 3300046523 Ga0495644_0071946 Ga0495644_0071946_298_858 148
5 3300005288 Ga0065714_10024484 Ga0065714_100244841 149
6 3300046452 Ga0495617_018480 Ga0495617_018480_1342_1902 149
7 3300046458 Ga0495591_035936 Ga0495591_035936_269_829 149
8 3300046460 Ga0495638_0350330 Ga0495638_0350330_147_707 149
9 3300046471 Ga0495650_0053131 Ga0495650_0053131_1008_1568 149
10 3300046474 Ga0495605_0128474 Ga0495605_0128474_124_684 149
11 3300046491 Ga0495584_0049595 Ga0495584_0049595_296_856 149
12 3300046501 Ga0495607_0231455 Ga0495607_0231455_319_879 149
13 3300046506 Ga0495583_0112208 Ga0495583_0112208_476_1036 149
14 3300046507 Ga0495606_0084294 Ga0495606_0084294_288_848 149
15 3300046512 Ga0495610_0057997 Ga0495610_0057997_1004_1564 149
16 3300046513 Ga0495616_0268196 Ga0495616_0268196_115_675 149
17 3300046515 Ga0495620_0055479 Ga0495620_0055479_932_1492 149
18 3300046520 Ga0495637_0036841 Ga0495637_0036841_296_856 149
19 3300046520 Ga0495637_0162627 Ga0495637_0162627_36_560 149
20 3300046660 Ga0495625_0084477 Ga0495625_0084477_603_1163 149
21 3300046692 Ga0495671_0191289 Ga0495671_0191289_134_694 149
22 3300046810 Ga0495660_0063516 Ga0495660_0063516_1179_1739 149
23 3300046810 Ga0495660_0203719 Ga0495660_0203719_91_651 149
24 3300047446 Ga0495679_046810 Ga0495679_046810_478_1038 149
25 3300047470 Ga0495681_0067743 Ga0495681_0067743_800_1360 149
26 3300047472 Ga0495686_0526446 Ga0495686_0526446_37_597 149
27 3300048091 Ga0495626_0041953 Ga0495626_0041953_296_856 149
28 3300049459 Ga0495678_047955 Ga0495678_047955_816_1376 149
29 iso_pu_bacteria 2860339153 2860344842 149
30 3300048917 Ga0496114_0147414 Ga0496114_0147414_992_1486 150
31 3300048918 Ga0496115_0132930 Ga0496115_0132930_790_1284 150
32 3300046452 Ga0495617_037924 Ga0495617_037924_164_772 151
33 3300046471 Ga0495650_0038149 Ga0495650_0038149_1251_1859 151
34 3300046519 Ga0495632_0157993 Ga0495632_0157993_408_1016 151
35 3300042010 Ga0439452_038815 Ga0439452_038815_361_894 152
36 3300046491 Ga0495584_0100017 Ga0495584_0100017_423_938 152
37 3300046512 Ga0495610_0095554 Ga0495610_0095554_428_943 152
38 3300046692 Ga0495671_0176987 Ga0495671_0176987_148_663 152
39 3300013105 Ga0157369_10111818 Ga0157369_101118183 153
40 3300046453 Ga0495627_004052 Ga0495627_004052_3572_4180 153
41 3300046518 Ga0495631_0039391 Ga0495631_0039391_241_849 153
42 3300046519 Ga0495632_0058151 Ga0495632_0058151_855_1463 153
43 3300046530 Ga0495654_0031701 Ga0495654_0031701_491_1099 153
44 3300047320 Ga0495672_0027259 Ga0495672_0027259_317_925 153
45 3300046460 Ga0495638_0380632 Ga0495638_0380632_28_567 154
46 3300047470 Ga0495681_0097633 Ga0495681_0097633_154_663 154
47 3300005288 Ga0065714_10190193 Ga0065714_101901932 155
48 3300009011 Ga0105251_10047871 Ga0105251_100478712 155
49 3300009036 Ga0105244_10021629 Ga0105244_100216292 155
50 3300013100 Ga0157373_10436165 Ga0157373_104361651 155
51 3300013306 Ga0163162_10022085 Ga0163162_100220854 155
52 3300015261 Ga0182006_1124355 Ga0182006_11243552 155
53 3300025728 Ga0207655_1026916 Ga0207655_10269161 155
54 3300025735 Ga0207713_1020633 Ga0207713_10206333 155
55 3300042533 Ga0450901_002834 Ga0450901_002834_985_1524 155
56 3300046452 Ga0495617_148349 Ga0495617_148349_106_618 155
57 3300046457 Ga0495590_0046600 Ga0495590_0046600_398_910 155
58 3300046460 Ga0495638_0051303 Ga0495638_0051303_1301_1816 155
59 3300046491 Ga0495584_0058813 Ga0495584_0058813_689_1204 155
60 3300046492 Ga0495585_0079730 Ga0495585_0079730_984_1496 155
61 3300046501 Ga0495607_0083953 Ga0495607_0083953_955_1467 155
62 3300046507 Ga0495606_0089778 Ga0495606_0089778_400_912 155
63 3300046512 Ga0495610_0060409 Ga0495610_0060409_393_905 155
64 3300046513 Ga0495616_0068327 Ga0495616_0068327_155_670 155
65 3300046513 Ga0495616_0200457 Ga0495616_0200457_312_824 155
66 3300046515 Ga0495620_0062390 Ga0495620_0062390_296_811 155
67 3300046519 Ga0495632_0046246 Ga0495632_0046246_1252_1764 155
68 3300046519 Ga0495632_0125940 Ga0495632_0125940_276_791 155
69 3300046538 Ga0495609_0081597 Ga0495609_0081597_638_1150 155
70 3300046542 Ga0495597_0040027 Ga0495597_0040027_181_693 155
71 3300046542 Ga0495597_0095923 Ga0495597_0095923_162_674 155
72 3300046648 Ga0495611_0056009 Ga0495611_0056009_1061_1573 155
73 3300046648 Ga0495611_0058070 Ga0495611_0058070_507_1022 155
74 3300046810 Ga0495660_0076045 Ga0495660_0076045_885_1397 155
75 3300047320 Ga0495672_0046221 Ga0495672_0046221_776_1291 155
76 3300047445 Ga0495677_0378549 Ga0495677_0378549_29_544 155
77 3300047446 Ga0495679_054614 Ga0495679_054614_565_1077 155
78 3300047469 Ga0495673_0042663 Ga0495673_0042663_738_1253 155
79 3300047469 Ga0495673_0054866 Ga0495673_0054866_265_777 155
80 3300048091 Ga0495626_0122294 Ga0495626_0122294_530_1042 155
81 3300049459 Ga0495678_043031 Ga0495678_043031_529_1044 155
82 3300049460 Ga0495682_0021998 Ga0495682_0021998_1477_1989 155
83 3300050514 nmdc:mga08x19_358313_c1 nmdc:mga08x19_358313_c1_181_690 155
84 3300053111 Ga0500572_008123 Ga0500572_008123_1521_2033 155
85 3300053111 Ga0500572_208079 Ga0500572_208079_23_535 155
86 3300005289 Ga0065704_10105041 Ga0065704_101050413 156
87 3300041405 Ga0439438_030594 Ga0439438_030594_415_924 156
88 3300041407 Ga0439447_006358 Ga0439447_006358_123_632 156
89 3300041413 Ga0439465_0013674 Ga0439465_0013674_189_698 156
90 3300042006 Ga0439432_056931 Ga0439432_056931_415_924 156
91 3300042009 Ga0439451_036545 Ga0439451_036545_387_896 156
92 3300042010 Ga0439452_032962 Ga0439452_032962_345_854 156
93 3300042156 Ga0439446_0010570 Ga0439446_0010570_1792_2301 156
94 3300042993 Ga0439440_0057499 Ga0439440_0057499_402_911 156
95 3300046517 Ga0495630_0120810 Ga0495630_0120810_1169_1702 156
96 3300046519 Ga0495632_0077148 Ga0495632_0077148_714_1229 156
97 3300046519 Ga0495632_0260106 Ga0495632_0260106_74_586 156
98 3300046535 Ga0495586_0045766 Ga0495586_0045766_1493_2026 156
99 3300046663 Ga0495635_0103801 Ga0495635_0103801_171_704 156
100 3300046810 Ga0495660_0055364 Ga0495660_0055364_1246_1758 156
101 3300047317 Ga0495604_0075849 Ga0495604_0075849_366_899 156
102 3300014497 Ga0182008_10028605 Ga0182008_100286052 157
103 3300042435 Ga0439434_0007800 Ga0439434_0007800_1801_2310 157
104 3300046453 Ga0495627_022519 Ga0495627_022519_1190_1702 157
105 3300046457 Ga0495590_0023761 Ga0495590_0023761_1253_1777 157
106 3300046457 Ga0495590_0031130 Ga0495590_0031130_543_1058 157
107 3300046463 Ga0495653_0071671 Ga0495653_0071671_180_713 157
108 3300046471 Ga0495650_0038925 Ga0495650_0038925_1144_1668 157
109 3300046471 Ga0495650_0060971 Ga0495650_0060971_922_1434 157
110 3300046473 Ga0495582_0037880 Ga0495582_0037880_1513_2046 157
111 3300046474 Ga0495605_0044256 Ga0495605_0044256_370_882 157
112 3300046475 Ga0495639_0025876 Ga0495639_0025876_151_684 157
113 3300046476 Ga0495662_0353124 Ga0495662_0353124_162_695 157
114 3300046477 Ga0495664_0484563 Ga0495664_0484563_147_680 157
115 3300046499 Ga0495594_0167291 Ga0495594_0167291_610_1143 157
116 3300046500 Ga0495596_0059836 Ga0495596_0059836_876_1388 157
117 3300046501 Ga0495607_0051600 Ga0495607_0051600_756_1271 157
118 3300046501 Ga0495607_0076794 Ga0495607_0076794_363_875 157
119 3300046513 Ga0495616_0041909 Ga0495616_0041909_370_882 157
120 3300046513 Ga0495616_0049188 Ga0495616_0049188_387_911 157
121 3300046519 Ga0495632_0060974 Ga0495632_0060974_142_654 157
122 3300046520 Ga0495637_0080201 Ga0495637_0080201_317_829 157
123 3300046522 Ga0495643_0122353 Ga0495643_0122353_101_613 157
124 3300046523 Ga0495644_0019692 Ga0495644_0019692_762_1277 157
125 3300046524 Ga0495648_0059001 Ga0495648_0059001_1372_1884 157
126 3300046524 Ga0495648_0085718 Ga0495648_0085718_1188_1700 157
127 3300046526 Ga0495666_0045737 Ga0495666_0045737_409_942 157
128 3300046530 Ga0495654_0018076 Ga0495654_0018076_371_883 157
129 3300046530 Ga0495654_0062202 Ga0495654_0062202_1047_1571 157
130 3300046536 Ga0495587_0079837 Ga0495587_0079837_391_924 157
131 3300046538 Ga0495609_0055240 Ga0495609_0055240_899_1411 157
132 3300046557 Ga0495622_0095271 Ga0495622_0095271_101_634 157
133 3300046642 Ga0495634_0367415 Ga0495634_0367415_96_629 157
134 3300046660 Ga0495625_0088593 Ga0495625_0088593_1251_1763 157
135 3300046674 Ga0495588_0126423 Ga0495588_0126423_341_874 157
136 3300046680 Ga0495646_0065391 Ga0495646_0065391_1485_2018 157
137 3300046689 Ga0495613_0316221 Ga0495613_0316221_147_680 157
138 3300046692 Ga0495671_0116151 Ga0495671_0116151_233_757 157
139 3300046694 Ga0495649_0059923 Ga0495649_0059923_1138_1650 157
140 3300046694 Ga0495649_0084431 Ga0495649_0084431_432_947 157
141 3300046810 Ga0495660_0075644 Ga0495660_0075644_371_883 157
142 3300046810 Ga0495660_0137976 Ga0495660_0137976_580_1095 157
143 3300047315 Ga0495581_0065128 Ga0495581_0065128_172_705 157
144 3300047322 Ga0495680_0205489 Ga0495680_0205489_403_936 157
145 3300047323 Ga0495683_0053527 Ga0495683_0053527_740_1255 157
146 3300047323 Ga0495683_0094394 Ga0495683_0094394_585_1097 157
147 3300047444 Ga0495675_0077411 Ga0495675_0077411_1169_1702 157
148 3300047446 Ga0495679_024143 Ga0495679_024143_1179_1691 157
149 3300047470 Ga0495681_0043825 Ga0495681_0043825_1249_1773 157
150 3300047673 Ga0495593_0054416 Ga0495593_0054416_1444_1977 157
151 3300048091 Ga0495626_0043329 Ga0495626_0043329_366_878 157
152 3300048927 Ga0496124_0096824 Ga0496124_0096824_1169_1684 157
153 3300049459 Ga0495678_038494 Ga0495678_038494_1071_1583 157
154 3300049460 Ga0495682_0035118 Ga0495682_0035118_953_1477 157
155 3300050491 nmdc:mga00v17_226567_c1 nmdc:mga00v17_226567_c1_368_880 157
156 3300015261 Ga0182006_1126753 Ga0182006_11267532 158
157 3300041411 Ga0439466_0079648 Ga0439466_0079648_321_848 158
158 3300042009 Ga0439451_017408 Ga0439451_017408_564_1073 158
159 3300042013 Ga0439456_013570 Ga0439456_013570_542_1069 158
160 3300042016 Ga0439463_014296 Ga0439463_014296_1056_1583 158
161 3300042137 Ga0450902_005890 Ga0450902_005890_1004_1531 158
162 3300042139 Ga0450904_010528 Ga0450904_010528_134_661 158
163 3300042142 Ga0450905_018591 Ga0450905_018591_132_659 158
164 3300042146 Ga0450907_017733 Ga0450907_017733_60_587 158
165 3300046458 Ga0495591_019932 Ga0495591_019932_371_883 158
166 3300046458 Ga0495591_027321 Ga0495591_027321_336_848 158
167 3300046492 Ga0495585_0102739 Ga0495585_0102739_684_1196 158
168 3300046519 Ga0495632_0029658 Ga0495632_0029658_408_920 158
169 3300046520 Ga0495637_0055752 Ga0495637_0055752_932_1447 158
170 3300046524 Ga0495648_0086753 Ga0495648_0086753_321_833 158
171 3300046660 Ga0495625_0428691 Ga0495625_0428691_11_523 158
172 3300049459 Ga0495678_041243 Ga0495678_041243_402_917 158
173 3300013100 Ga0157373_10055442 Ga0157373_100554423 159
174 3300042139 Ga0450904_003201 Ga0450904_003201_488_1009 159
175 3300046460 Ga0495638_0076068 Ga0495638_0076068_927_1439 159
176 3300046507 Ga0495606_0013340 Ga0495606_0013340_1622_2134 159
177 3300046507 Ga0495606_0074477 Ga0495606_0074477_1225_1740 159
178 3300046515 Ga0495620_0068874 Ga0495620_0068874_79_594 159
179 3300046694 Ga0495649_0031616 Ga0495649_0031616_786_1298 159
180 3300048091 Ga0495626_0027406 Ga0495626_0027406_1632_2144 159
181 3300048091 Ga0495626_0074667 Ga0495626_0074667_856_1368 159
182 3300048919 Ga0496116_0026565 Ga0496116_0026565_1356_1868 159
183 3300048919 Ga0496116_0049433 Ga0496116_0049433_1895_2410 159
184 3300048920 Ga0496117_0042375 Ga0496117_0042375_1145_1657 159
185 3300048921 Ga0496118_0044768 Ga0496118_0044768_1284_1796 159
186 3300009011 Ga0105251_10258232 Ga0105251_102582321 160
187 3300009036 Ga0105244_10021781 Ga0105244_100217813 160
188 3300009036 Ga0105244_10031031 Ga0105244_100310311 160
189 3300009036 Ga0105244_10071804 Ga0105244_100718042 160
190 3300009092 Ga0105250_10046421 Ga0105250_100464211 160
191 3300009148 Ga0105243_10007026 Ga0105243_100070269 160
192 3300013308 Ga0157375_10198852 Ga0157375_101988522 160
193 3300025711 Ga0207696_1036789 Ga0207696_10367892 160
194 3300025728 Ga0207655_1003333 Ga0207655_10033334 160
195 3300025728 Ga0207655_1013841 Ga0207655_10138413 160
196 3300025728 Ga0207655_1077237 Ga0207655_10772372 160
197 3300025935 Ga0207709_10000040 Ga0207709_10000040222 160
198 3300046452 Ga0495617_028902 Ga0495617_028902_403_918 160
199 3300046458 Ga0495591_026265 Ga0495591_026265_351_866 160
200 3300046471 Ga0495650_0163068 Ga0495650_0163068_22_537 160
201 3300046513 Ga0495616_0048882 Ga0495616_0048882_390_905 160
202 3300046517 Ga0495630_0181255 Ga0495630_0181255_888_1370 160
203 3300046518 Ga0495631_0258881 Ga0495631_0258881_38_553 160
204 3300046520 Ga0495637_0014003 Ga0495637_0014003_2853_3368 160
205 3300046520 Ga0495637_0048599 Ga0495637_0048599_314_826 160
206 3300046522 Ga0495643_0062737 Ga0495643_0062737_400_915 160
207 3300046536 Ga0495587_0155332 Ga0495587_0155332_731_1213 160
208 3300046648 Ga0495611_0020755 Ga0495611_0020755_1907_2422 160
209 3300046660 Ga0495625_0052388 Ga0495625_0052388_1392_1907 160
210 3300046660 Ga0495625_0167693 Ga0495625_0167693_631_1146 160
211 3300046665 Ga0495661_0118276 Ga0495661_0118276_166_678 160
212 3300046794 Ga0495589_0101465 Ga0495589_0101465_602_1114 160
213 3300046810 Ga0495660_0153564 Ga0495660_0153564_133_648 160
214 3300047320 Ga0495672_0082013 Ga0495672_0082013_950_1465 160
215 3300047322 Ga0495680_0151797 Ga0495680_0151797_222_704 160
216 3300047472 Ga0495686_0083044 Ga0495686_0083044_398_913 160
217 3300047673 Ga0495593_0103859 Ga0495593_0103859_189_671 160
218 3300005548 Ga0070665_100006819 Ga0070665_1000068198 161
219 3300006051 Ga0075364_10321389 Ga0075364_103213892 161
220 3300009092 Ga0105250_10014246 Ga0105250_100142464 161
221 3300009148 Ga0105243_10028430 Ga0105243_100284304 161
222 3300012498 Ga0157345_1000667 Ga0157345_10006673 161
223 3300015265 Ga0182005_1029995 Ga0182005_10299952 161
224 3300025711 Ga0207696_1005329 Ga0207696_10053293 161
225 3300025935 Ga0207709_10015747 Ga0207709_100157473 161
226 3300028379 Ga0268266_10001806 Ga0268266_1000180622 161
227 3300046452 Ga0495617_018504 Ga0495617_018504_994_1503 161
228 3300046452 Ga0495617_040568 Ga0495617_040568_149_661 161
229 3300046452 Ga0495617_048679 Ga0495617_048679_158_682 161
230 3300046460 Ga0495638_0078708 Ga0495638_0078708_820_1329 161
231 3300046471 Ga0495650_0219314 Ga0495650_0219314_114_638 161
232 3300046474 Ga0495605_0063138 Ga0495605_0063138_303_812 161
233 3300046492 Ga0495585_0019369 Ga0495585_0019369_1662_2174 161
234 3300046492 Ga0495585_0056966 Ga0495585_0056966_937_1446 161
235 3300046506 Ga0495583_0055364 Ga0495583_0055364_943_1452 161
236 3300046513 Ga0495616_0068253 Ga0495616_0068253_321_830 161
237 3300046519 Ga0495632_0127844 Ga0495632_0127844_324_836 161
238 3300046519 Ga0495632_0252330 Ga0495632_0252330_158_667 161
239 3300046524 Ga0495648_0055738 Ga0495648_0055738_956_1465 161
240 3300046528 Ga0495642_0064223 Ga0495642_0064223_198_707 161
241 3300046530 Ga0495654_0053548 Ga0495654_0053548_1037_1561 161
242 3300046530 Ga0495654_0072927 Ga0495654_0072927_711_1223 161
243 3300046538 Ga0495609_0066751 Ga0495609_0066751_240_764 161
244 3300046542 Ga0495597_0025986 Ga0495597_0025986_843_1358 161
245 3300046558 Ga0495633_0039347 Ga0495633_0039347_381_905 161
246 3300046616 Ga0495668_0018346 Ga0495668_0018346_1901_2413 161
247 3300046648 Ga0495611_0062809 Ga0495611_0062809_984_1508 161
248 3300046660 Ga0495625_0173091 Ga0495625_0173091_80_589 161
249 3300046660 Ga0495625_0347946 Ga0495625_0347946_12_521 161
250 3300046660 Ga0495625_0407953 Ga0495625_0407953_169_678 161
251 3300046665 Ga0495661_0086156 Ga0495661_0086156_64_588 161
252 3300046684 Ga0495669_0233041 Ga0495669_0233041_332_841 161
253 3300046692 Ga0495671_0041942 Ga0495671_0041942_877_1386 161
254 3300046810 Ga0495660_0053282 Ga0495660_0053282_975_1484 161
255 3300047320 Ga0495672_0048008 Ga0495672_0048008_955_1464 161
256 3300047323 Ga0495683_0184942 Ga0495683_0184942_357_881 161
257 3300047470 Ga0495681_0071310 Ga0495681_0071310_393_917 161
258 3300048091 Ga0495626_0054623 Ga0495626_0054623_341_850 161
259 3300048925 Ga0496122_0074695 Ga0496122_0074695_238_750 161
260 3300048926 Ga0496123_0035544 Ga0496123_0035544_1385_1897 161
261 3300048927 Ga0496124_0096523 Ga0496124_0096523_1167_1679 161
262 3300049460 Ga0495682_0037227 Ga0495682_0037227_959_1468 161
263 3300003781 Ga0055536_1003342 Ga0055536_10033427 162
264 3300003791 Ga0055530_10005751 Ga0055530_100057514 162
265 3300003792 Ga0055540_1000763 Ga0055540_10007634 162
266 3300003794 Ga0055531_10000455 Ga0055531_100004559 162
267 3300005288 Ga0065714_10010083 Ga0065714_100100832 162
268 3300009011 Ga0105251_10047522 Ga0105251_100475222 162
269 3300009092 Ga0105250_10147477 Ga0105250_101474772 162
270 3300025292 Ga0209676_1000025 Ga0209676_1000025358 162
271 3300025298 Ga0209050_1000099 Ga0209050_10000994 162
272 3300025303 Ga0209051_1000026 Ga0209051_1000026153 162
273 3300025304 Ga0209257_1000034 Ga0209257_1000034358 162
274 3300025735 Ga0207713_1036393 Ga0207713_10363932 162
275 3300046452 Ga0495617_127600 Ga0495617_127600_165_677 162
276 3300046460 Ga0495638_0068355 Ga0495638_0068355_1351_1863 162
277 3300046474 Ga0495605_0111294 Ga0495605_0111294_630_1142 162
278 3300046491 Ga0495584_0059012 Ga0495584_0059012_1058_1570 162
279 3300046492 Ga0495585_0064711 Ga0495585_0064711_1175_1687 162
280 3300046512 Ga0495610_0026866 Ga0495610_0026866_900_1412 162
281 3300046513 Ga0495616_0127117 Ga0495616_0127117_12_524 162
282 3300046522 Ga0495643_0056343 Ga0495643_0056343_1209_1721 162
283 3300046530 Ga0495654_0057229 Ga0495654_0057229_867_1379 162
284 3300046530 Ga0495654_0102885 Ga0495654_0102885_642_1154 162
285 3300046648 Ga0495611_0112564 Ga0495611_0112564_619_1131 162
286 3300046691 Ga0495670_0078581 Ga0495670_0078581_16_504 162
287 3300046692 Ga0495671_0048675 Ga0495671_0048675_336_848 162
288 3300046692 Ga0495671_0051598 Ga0495671_0051598_361_873 162
289 3300046692 Ga0495671_0157913 Ga0495671_0157913_130_642 162
290 3300046694 Ga0495649_0149667 Ga0495649_0149667_394_906 162
291 3300046694 Ga0495649_0164746 Ga0495649_0164746_329_841 162
292 3300046810 Ga0495660_0124573 Ga0495660_0124573_343_855 162
293 3300047323 Ga0495683_0160385 Ga0495683_0160385_513_1025 162
294 3300047446 Ga0495679_020495 Ga0495679_020495_1445_1957 162
295 3300047469 Ga0495673_0036921 Ga0495673_0036921_1355_1867 162
296 3300047469 Ga0495673_0148626 Ga0495673_0148626_39_551 162
297 3300047472 Ga0495686_0055193 Ga0495686_0055193_397_909 162
298 3300047673 Ga0495593_0055039 Ga0495593_0055039_797_1285 162
299 3300048924 Ga0496121_0151708 Ga0496121_0151708_303_791 162
300 3300049459 Ga0495678_045663 Ga0495678_045663_283_795 162
301 3300049460 Ga0495682_0098758 Ga0495682_0098758_246_758 162
302 3300053145 Ga0500586_038459 Ga0500586_038459_152_664 162
303 3300009036 Ga0105244_10031703 Ga0105244_100317032 163
304 3300025728 Ga0207655_1016883 Ga0207655_10168833 163
305 3300013102 Ga0157371_10043729 Ga0157371_100437293 164
306 3300013104 Ga0157370_10152159 Ga0157370_101521592 164
307 3300014497 Ga0182008_10163441 Ga0182008_101634411 164
308 3300015261 Ga0182006_1066070 Ga0182006_10660701 164
309 3300015262 Ga0182007_10053144 Ga0182007_100531441 164
310 3300046471 Ga0495650_0022567 Ga0495650_0022567_1433_1927 164
311 3300046474 Ga0495605_0052952 Ga0495605_0052952_742_1236 164
312 3300046512 Ga0495610_0033978 Ga0495610_0033978_701_1195 164
313 3300046530 Ga0495654_0023639 Ga0495654_0023639_973_1467 164
314 3300046536 Ga0495587_0045028 Ga0495587_0045028_1072_1566 164
315 3300046616 Ga0495668_0070665 Ga0495668_0070665_604_1098 164
316 3300046663 Ga0495635_0067579 Ga0495635_0067579_1097_1591 164
317 3300046680 Ga0495646_0048639 Ga0495646_0048639_1906_2400 164
318 3300048088 Ga0495602_0188018 Ga0495602_0188018_773_1267 164
319 iso_pu_bacteria 2511231008 2511280602 165
320 iso_pu_bacteria 2511231010 2511288874 165
321 iso_pu_bacteria 2511231011 2511293885 165
322 iso_pu_bacteria 2600255318 2601797743 165
323 iso_pu_bacteria 2603880185 2606076774 165
324 iso_pu_bacteria 2603880199 2606128812 165
325 iso_pu_bacteria 2623620443 2624478129 165
326 iso_pu_bacteria 2643221589 2643955004 165
327 iso_pu_bacteria 2643221602 2644024640 165
328 iso_pu_bacteria 2713897149 2715754389 165
329 iso_pu_bacteria 2808606445 2809217891 165
330 iso_pu_bacteria 2878029506 2878030075 165
331 iso_pu_bacteria 2919063839 2919066243 165
332 iso_pu_bacteria 2931396565 2931398747 165
333 iso_pu_bacteria 2939636861 2939641011 165
334 iso_pu_bacteria 3007619802 3007625364 165
335 iso_pu_bacteria 3007718800 3007724034 165
336 3300009011 Ga0105251_10000009 Ga0105251_100000095 166
337 3300009092 Ga0105250_10004530 Ga0105250_100045303 166
338 3300046458 Ga0495591_012302 Ga0495591_012302_1048_1551 166
339 3300047322 Ga0495680_0164442 Ga0495680_0164442_710_1210 166
340 3300047446 Ga0495679_016209 Ga0495679_016209_1493_1996 166
341 iso_pu_bacteria 2713897148 2715749119 166
342 iso_pu_bacteria 2773857673 2774134652 166
343 iso_pu_bacteria 2904518522 2904519485 166
344 iso_pu_bacteria 2998139840 2998140372 166
345 iso_pu_bacteria 3007861166 3007864422 166
346 iso_pu_bacteria 2511231007 2511272594 167
347 iso_pu_bacteria 2511231012 2511299469 167
348 iso_pu_bacteria 2511231014 2511315167 167
349 iso_pu_bacteria 2511231015 2511322567 167
350 iso_pu_bacteria 2511231016 2511323766 167
351 iso_pu_bacteria 2511231020 2511349017 167
352 iso_pu_bacteria 2511231022 2511361397 167
353 iso_pu_bacteria 2623620446 2624489674 167
354 iso_pu_bacteria 2738543004 2739197937 167
355 iso_pu_bacteria 2738543015 2739260402 167
356 iso_pu_bacteria 2738543025 2739311194 167
357 iso_pu_bacteria 2919487758 2919488794 167
358 iso_pu_bacteria 2919697872 2919699047 167
359 iso_pu_bacteria 8019775933 8019777248 167
360 iso_pu_bacteria 8056125926 8056126379 167
361 iso_pu_bacteria 8056155041 8056158426 167
362 3300005288 Ga0065714_10017593 Ga0065714_100175932 168
363 3300005288 Ga0065714_10097799 Ga0065714_100977991 168
364 3300005353 Ga0070669_100011132 Ga0070669_1000111324 168
365 3300006058 Ga0075432_10032682 Ga0075432_100326822 168
366 3300006946 Ga0079104_1006262 Ga0079104_10062624 168
367 3300009148 Ga0105243_10563725 Ga0105243_105637252 168
368 3300009176 Ga0105242_10044355 Ga0105242_100443552 168
369 3300013104 Ga0157370_10791800 Ga0157370_107918002 168
370 3300015265 Ga0182005_1010051 Ga0182005_10100512 168
371 3300015265 Ga0182005_1030696 Ga0182005_10306962 168
372 3300017792 Ga0163161_10049253 Ga0163161_100492532 168
373 3300025291 Ga0209675_1007548 Ga0209675_10075483 168
374 3300025923 Ga0207681_10070757 Ga0207681_100707572 168
375 3300025934 Ga0207686_10021265 Ga0207686_100212651 168
376 3300027111 Ga0209281_1000026 Ga0209281_1000026203 168
377 3300031730 Ga0307516_10281725 Ga0307516_102817252 168
378 3300041405 Ga0439438_009479 Ga0439438_009479_1880_2395 168
379 3300041405 Ga0439438_027980 Ga0439438_027980_183_692 168
380 3300041407 Ga0439447_043814 Ga0439447_043814_405_914 168
381 3300041411 Ga0439466_0030353 Ga0439466_0030353_279_794 168
382 3300041411 Ga0439466_0038130 Ga0439466_0038130_132_641 168
383 3300042010 Ga0439452_056087 Ga0439452_056087_17_526 168
384 3300042122 Ga0450920_014225 Ga0450920_014225_303_818 168
385 3300042124 Ga0450922_000863 Ga0450922_000863_704_1219 168
386 3300042145 Ga0450906_032230 Ga0450906_032230_249_764 168
387 3300042146 Ga0450907_003628 Ga0450907_003628_694_1209 168
388 3300042147 Ga0450910_002330 Ga0450910_002330_1066_1581 168
389 3300042156 Ga0439446_0024147 Ga0439446_0024147_942_1457 168
390 3300042184 Ga0450908_016795 Ga0450908_016795_109_624 168
391 3300042185 Ga0450909_011158 Ga0450909_011158_194_709 168
392 3300042531 Ga0450918_011748 Ga0450918_011748_569_1084 168
393 3300046452 Ga0495617_013735 Ga0495617_013735_742_1257 168
394 3300046452 Ga0495617_082801 Ga0495617_082801_497_1006 168
395 3300046455 Ga0495603_0247462 Ga0495603_0247462_431_940 168
396 3300046460 Ga0495638_0088348 Ga0495638_0088348_190_714 168
397 3300046474 Ga0495605_0036904 Ga0495605_0036904_397_906 168
398 3300046491 Ga0495584_0106975 Ga0495584_0106975_504_1013 168
399 3300046492 Ga0495585_0033602 Ga0495585_0033602_1772_2281 168
400 3300046492 Ga0495585_0096250 Ga0495585_0096250_646_1155 168
401 3300046501 Ga0495607_0056014 Ga0495607_0056014_1357_1881 168
402 3300046507 Ga0495606_0075394 Ga0495606_0075394_985_1494 168
403 3300046515 Ga0495620_0044279 Ga0495620_0044279_778_1287 168
404 3300046520 Ga0495637_0041323 Ga0495637_0041323_899_1408 168
405 3300046520 Ga0495637_0045964 Ga0495637_0045964_1038_1547 168
406 3300046522 Ga0495643_0165750 Ga0495643_0165750_408_995 168
407 3300046522 Ga0495643_0177549 Ga0495643_0177549_449_958 168
408 3300046524 Ga0495648_0243061 Ga0495648_0243061_134_643 168
409 3300046528 Ga0495642_0343907 Ga0495642_0343907_130_639 168
410 3300046538 Ga0495609_0077689 Ga0495609_0077689_135_650 168
411 3300046558 Ga0495633_0066843 Ga0495633_0066843_220_729 168
412 3300046665 Ga0495661_0413260 Ga0495661_0413260_38_562 168
413 3300046694 Ga0495649_0099844 Ga0495649_0099844_568_1077 168
414 3300046794 Ga0495589_0069052 Ga0495589_0069052_442_951 168
415 3300046810 Ga0495660_0083858 Ga0495660_0083858_820_1329 168
416 3300047446 Ga0495679_033539 Ga0495679_033539_996_1505 168
417 3300047469 Ga0495673_0033513 Ga0495673_0033513_449_958 168
418 3300047469 Ga0495673_0055353 Ga0495673_0055353_220_729 168
419 3300047470 Ga0495681_0080446 Ga0495681_0080446_848_1357 168
420 3300047470 Ga0495681_0095147 Ga0495681_0095147_183_698 168
421 3300047472 Ga0495686_0230581 Ga0495686_0230581_192_701 168
422 3300048927 Ga0496124_0185792 Ga0496124_0185792_829_1338 168
423 3300049460 Ga0495682_0021979 Ga0495682_0021979_176_688 168
424 iso_pu_bacteria 2643221633 2644186032 168
425 iso_pu_bacteria 3007419365 3007419926 168
426 3300014497 Ga0182008_10033396 Ga0182008_100333961 169
427 3300025735 Ga0207713_1020042 Ga0207713_10200423 169
428 3300042138 Ga0450903_013248 Ga0450903_013248_165_677 169
429 3300042144 Ga0450889_003748 Ga0450889_003748_340_852 169
430 3300042532 Ga0450893_0015554 Ga0450893_0015554_689_1201 169
431 3300046452 Ga0495617_031330 Ga0495617_031330_947_1459 169
432 3300046458 Ga0495591_019297 Ga0495591_019297_1380_1892 169
433 3300046458 Ga0495591_032289 Ga0495591_032289_298_813 169
434 3300046491 Ga0495584_0047382 Ga0495584_0047382_1220_1735 169
435 3300046507 Ga0495606_0097694 Ga0495606_0097694_853_1368 169
436 3300046512 Ga0495610_0228230 Ga0495610_0228230_165_680 169
437 3300046513 Ga0495616_0089816 Ga0495616_0089816_176_691 169
438 3300046515 Ga0495620_0033044 Ga0495620_0033044_1400_1915 169
439 3300046519 Ga0495632_0133045 Ga0495632_0133045_157_672 169
440 3300046519 Ga0495632_0211410 Ga0495632_0211410_194_709 169
441 3300046520 Ga0495637_0045026 Ga0495637_0045026_428_943 169
442 3300046530 Ga0495654_0047838 Ga0495654_0047838_832_1347 169
443 3300046538 Ga0495609_0035436 Ga0495609_0035436_437_952 169
444 3300046542 Ga0495597_0121658 Ga0495597_0121658_236_751 169
445 3300046674 Ga0495588_0286199 Ga0495588_0286199_175_687 169
446 3300046692 Ga0495671_0044032 Ga0495671_0044032_983_1498 169
447 3300046692 Ga0495671_0124928 Ga0495671_0124928_219_734 169
448 3300046694 Ga0495649_0068406 Ga0495649_0068406_436_951 169
449 3300046794 Ga0495589_0039772 Ga0495589_0039772_1400_1915 169
450 3300046810 Ga0495660_0081715 Ga0495660_0081715_779_1294 169
451 3300047320 Ga0495672_0051761 Ga0495672_0051761_776_1291 169
452 3300047470 Ga0495681_0039449 Ga0495681_0039449_1325_1840 169
453 3300049459 Ga0495678_041820 Ga0495678_041820_902_1417 169
454 3300005288 Ga0065714_10030293 Ga0065714_100302931 170
455 3300006051 Ga0075364_10080064 Ga0075364_100800642 170
456 3300006051 Ga0075364_10099936 Ga0075364_100999361 170
457 3300006051 Ga0075364_10132500 Ga0075364_101325002 170
458 3300006051 Ga0075364_10359726 Ga0075364_103597261 170
459 3300006058 Ga0075432_10062569 Ga0075432_100625692 170
460 3300006058 Ga0075432_10079315 Ga0075432_100793152 170
461 3300006058 Ga0075432_10132682 Ga0075432_101326822 170
462 3300006177 Ga0075362_10190322 Ga0075362_101903221 170
463 3300006186 Ga0075369_10079354 Ga0075369_100793542 170
464 3300006186 Ga0075369_10237824 Ga0075369_102378242 170
465 3300006914 Ga0075436_100249979 Ga0075436_1002499791 170
466 3300009011 Ga0105251_10018282 Ga0105251_100182823 170
467 3300009011 Ga0105251_10199069 Ga0105251_101990692 170
468 3300009036 Ga0105244_10021820 Ga0105244_100218202 170
469 3300009036 Ga0105244_10072997 Ga0105244_100729971 170
470 3300009036 Ga0105244_10099788 Ga0105244_100997881 170
471 3300009036 Ga0105244_10227233 Ga0105244_102272332 170
472 3300009092 Ga0105250_10096081 Ga0105250_100960812 170
473 3300009148 Ga0105243_10494171 Ga0105243_104941711 170
474 3300013100 Ga0157373_10280478 Ga0157373_102804782 170
475 3300014497 Ga0182008_10041918 Ga0182008_100419182 170
476 3300025711 Ga0207696_1000020 Ga0207696_1000020125 170
477 3300025728 Ga0207655_1000014 Ga0207655_1000014323 170
478 3300025728 Ga0207655_1039791 Ga0207655_10397914 170
479 3300025728 Ga0207655_1069776 Ga0207655_10697762 170
480 3300025728 Ga0207655_1082848 Ga0207655_10828482 170
481 3300025728 Ga0207655_1115786 Ga0207655_11157861 170
482 3300025735 Ga0207713_1000032 Ga0207713_1000032257 170
483 3300025735 Ga0207713_1014205 Ga0207713_10142054 170
484 3300025735 Ga0207713_1016086 Ga0207713_10160862 170
485 3300027907 Ga0207428_10100560 Ga0207428_101005603 170
486 3300027907 Ga0207428_10151856 Ga0207428_101518562 170
487 3300027907 Ga0207428_10163079 Ga0207428_101630792 170
488 3300027907 Ga0207428_10273328 Ga0207428_102733282 170
489 3300041405 Ga0439438_011152 Ga0439438_011152_424_939 170
490 3300041405 Ga0439438_037669 Ga0439438_037669_367_882 170
491 3300041405 Ga0439438_074975 Ga0439438_074975_199_714 170
492 3300041411 Ga0439466_0056701 Ga0439466_0056701_361_876 170
493 3300041411 Ga0439466_0068400 Ga0439466_0068400_194_709 170
494 3300041413 Ga0439465_0187931 Ga0439465_0187931_186_701 170
495 3300042006 Ga0439432_042341 Ga0439432_042341_777_1292 170
496 3300042006 Ga0439432_042897 Ga0439432_042897_461_976 170
497 3300042009 Ga0439451_030983 Ga0439451_030983_412_927 170
498 3300042010 Ga0439452_037621 Ga0439452_037621_376_891 170
499 3300042122 Ga0450920_026865 Ga0450920_026865_303_830 170
500 3300042137 Ga0450902_016712 Ga0450902_016712_422_937 170
501 3300042138 Ga0450903_006466 Ga0450903_006466_202_717 170
502 3300042139 Ga0450904_030267 Ga0450904_030267_33_548 170
503 3300042145 Ga0450906_018855 Ga0450906_018855_378_905 170
504 3300042146 Ga0450907_024258 Ga0450907_024258_132_659 170
505 3300042147 Ga0450910_009454 Ga0450910_009454_356_883 170
506 3300042184 Ga0450908_015742 Ga0450908_015742_705_1232 170
507 3300042185 Ga0450909_021995 Ga0450909_021995_291_806 170
508 3300046452 Ga0495617_039660 Ga0495617_039660_157_672 170
509 3300046452 Ga0495617_075611 Ga0495617_075611_459_974 170
510 3300046457 Ga0495590_0014560 Ga0495590_0014560_523_1062 170
511 3300046458 Ga0495591_035983 Ga0495591_035983_769_1284 170
512 3300046458 Ga0495591_107314 Ga0495591_107314_82_597 170
513 3300046460 Ga0495638_0082984 Ga0495638_0082984_1004_1519 170
514 3300046460 Ga0495638_0199775 Ga0495638_0199775_254_769 170
515 3300046460 Ga0495638_0208337 Ga0495638_0208337_232_747 170
516 3300046474 Ga0495605_0028837 Ga0495605_0028837_1917_2456 170
517 3300046474 Ga0495605_0265256 Ga0495605_0265256_80_595 170
518 3300046491 Ga0495584_0082386 Ga0495584_0082386_347_862 170
519 3300046491 Ga0495584_0091542 Ga0495584_0091542_660_1175 170
520 3300046492 Ga0495585_0120904 Ga0495585_0120904_445_960 170
521 3300046506 Ga0495583_0043180 Ga0495583_0043180_1341_1856 170
522 3300046507 Ga0495606_0063549 Ga0495606_0063549_623_1138 170
523 3300046512 Ga0495610_0034606 Ga0495610_0034606_936_1451 170
524 3300046512 Ga0495610_0053667 Ga0495610_0053667_406_945 170
525 3300046512 Ga0495610_0063234 Ga0495610_0063234_383_898 170
526 3300046513 Ga0495616_0397101 Ga0495616_0397101_11_526 170
527 3300046515 Ga0495620_0054876 Ga0495620_0054876_247_762 170
528 3300046515 Ga0495620_0057617 Ga0495620_0057617_414_929 170
529 3300046517 Ga0495630_0134661 Ga0495630_0134661_625_1140 170
530 3300046518 Ga0495631_0100270 Ga0495631_0100270_349_864 170
531 3300046520 Ga0495637_0094536 Ga0495637_0094536_313_828 170
532 3300046524 Ga0495648_0017811 Ga0495648_0017811_3195_3710 170
533 3300046524 Ga0495648_0089699 Ga0495648_0089699_416_931 170
534 3300046524 Ga0495648_0203044 Ga0495648_0203044_286_801 170
535 3300046524 Ga0495648_0209189 Ga0495648_0209189_406_945 170
536 3300046526 Ga0495666_0040456 Ga0495666_0040456_754_1269 170
537 3300046528 Ga0495642_0030779 Ga0495642_0030779_623_1162 170
538 3300046530 Ga0495654_0036978 Ga0495654_0036978_1556_2095 170
539 3300046530 Ga0495654_0044064 Ga0495654_0044064_820_1335 170
540 3300046530 Ga0495654_0090192 Ga0495654_0090192_673_1188 170
541 3300046530 Ga0495654_0167959 Ga0495654_0167959_360_875 170
542 3300046530 Ga0495654_0174058 Ga0495654_0174058_78_617 170
543 3300046536 Ga0495587_0384027 Ga0495587_0384027_104_682 170
544 3300046538 Ga0495609_0121331 Ga0495609_0121331_162_677 170
545 3300046538 Ga0495609_0172301 Ga0495609_0172301_263_778 170
546 3300046542 Ga0495597_0096527 Ga0495597_0096527_150_665 170
547 3300046616 Ga0495668_0042269 Ga0495668_0042269_1884_2423 170
548 3300046660 Ga0495625_0066657 Ga0495625_0066657_874_1389 170
549 3300046660 Ga0495625_0204067 Ga0495625_0204067_749_1264 170
550 3300046660 Ga0495625_0319355 Ga0495625_0319355_343_858 170
551 3300046660 Ga0495625_0444170 Ga0495625_0444170_32_571 170
552 3300046665 Ga0495661_0198436 Ga0495661_0198436_96_611 170
553 3300046665 Ga0495661_0272087 Ga0495661_0272087_112_627 170
554 3300046679 Ga0495623_0079283 Ga0495623_0079283_775_1290 170
555 3300046691 Ga0495670_0060597 Ga0495670_0060597_1042_1557 170
556 3300046691 Ga0495670_0126708 Ga0495670_0126708_492_1007 170
557 3300046692 Ga0495671_0086233 Ga0495671_0086233_416_931 170
558 3300046692 Ga0495671_0105467 Ga0495671_0105467_87_602 170
559 3300046694 Ga0495649_0073567 Ga0495649_0073567_936_1451 170
560 3300046694 Ga0495649_0096334 Ga0495649_0096334_677_1192 170
561 3300046694 Ga0495649_0215875 Ga0495649_0215875_23_538 170
562 3300046694 Ga0495649_0289972 Ga0495649_0289972_10_549 170
563 3300046794 Ga0495589_0039364 Ga0495589_0039364_1219_1734 170
564 3300046794 Ga0495589_0041936 Ga0495589_0041936_696_1235 170
565 3300046809 Ga0495600_0195638 Ga0495600_0195638_757_1272 170
566 3300046810 Ga0495660_0136947 Ga0495660_0136947_354_869 170
567 3300047317 Ga0495604_0141537 Ga0495604_0141537_906_1421 170
568 3300047320 Ga0495672_0064657 Ga0495672_0064657_775_1314 170
569 3300047320 Ga0495672_0093129 Ga0495672_0093129_116_706 170
570 3300047320 Ga0495672_0132825 Ga0495672_0132825_381_896 170
571 3300047320 Ga0495672_0160491 Ga0495672_0160491_396_911 170
572 3300047320 Ga0495672_0189740 Ga0495672_0189740_352_867 170
573 3300047322 Ga0495680_0088734 Ga0495680_0088734_777_1292 170
574 3300047322 Ga0495680_0146597 Ga0495680_0146597_742_1257 170
575 3300047323 Ga0495683_0046815 Ga0495683_0046815_580_1095 170
576 3300047443 Ga0495687_025205 Ga0495687_025205_1662_2177 170
577 3300047446 Ga0495679_133672 Ga0495679_133672_130_645 170
578 3300047469 Ga0495673_0053153 Ga0495673_0053153_360_875 170
579 3300047469 Ga0495673_0053658 Ga0495673_0053658_345_860 170
580 3300047469 Ga0495673_0065683 Ga0495673_0065683_624_1163 170
581 3300047470 Ga0495681_0045411 Ga0495681_0045411_307_822 170
582 3300047470 Ga0495681_0066396 Ga0495681_0066396_785_1300 170
583 3300047471 Ga0495684_0108225 Ga0495684_0108225_570_1085 170
584 3300047472 Ga0495686_0081703 Ga0495686_0081703_360_875 170
585 3300047673 Ga0495593_0087182 Ga0495593_0087182_766_1281 170
586 3300048091 Ga0495626_0026086 Ga0495626_0026086_433_948 170
587 3300048091 Ga0495626_0157079 Ga0495626_0157079_136_651 170
588 3300048905 Ga0496102_1395604 Ga0496102_1395604_24_539 170
589 3300048919 Ga0496116_0100073 Ga0496116_0100073_809_1324 170
590 3300048920 Ga0496117_0193849 Ga0496117_0193849_348_863 170
591 3300048921 Ga0496118_0193049 Ga0496118_0193049_382_897 170
592 3300048927 Ga0496124_0190783 Ga0496124_0190783_816_1331 170
593 3300049460 Ga0495682_0001177 Ga0495682_0001177_13133_13720 170
594 3300049460 Ga0495682_0127090 Ga0495682_0127090_219_734 170
595 3300050489 nmdc:mga03683_247202_c1 nmdc:mga03683_247202_c1_108_623 170
596 3300050489 nmdc:mga03683_336380_c1 nmdc:mga03683_336380_c1_25_540 170
597 3300050489 nmdc:mga03683_50443_c1 nmdc:mga03683_50443_c1_1027_1542 170
598 3300050491 nmdc:mga00v17_161906_c1 nmdc:mga00v17_161906_c1_534_1073 170
599 3300050491 nmdc:mga00v17_449406_c1 nmdc:mga00v17_449406_c1_102_617 170
600 3300050491 nmdc:mga00v17_97716_c1 nmdc:mga00v17_97716_c1_623_1138 170
601 3300050514 nmdc:mga08x19_142583_c1 nmdc:mga08x19_142583_c1_262_777 170
602 3300050516 nmdc:mga0sz30_195038_c1 nmdc:mga0sz30_195038_c1_271_786 170
603 3300050516 nmdc:mga0sz30_212972_c1 nmdc:mga0sz30_212972_c1_273_788 170
604 iso_pu_bacteria 2904550169 2904552337 170
605 2124908027 MRS2a_Contig_9855 MRS2a_00703950 171
606 3300005288 Ga0065714_10005435 Ga0065714_100054355 171
607 3300006058 Ga0075432_10007328 Ga0075432_100073283 171
608 3300009036 Ga0105244_10060611 Ga0105244_100606112 171
609 3300009092 Ga0105250_10226613 Ga0105250_102266132 171
610 3300011119 Ga0105246_10076269 Ga0105246_100762693 171
611 3300014497 Ga0182008_10052948 Ga0182008_100529482 171
612 3300015261 Ga0182006_1026144 Ga0182006_10261443 171
613 3300015262 Ga0182007_10020101 Ga0182007_100201013 171
614 3300015265 Ga0182005_1012176 Ga0182005_10121763 171
615 3300025728 Ga0207655_1008336 Ga0207655_10083363 171
616 3300027907 Ga0207428_10070949 Ga0207428_100709493 171
617 3300041410 Ga0439461_0008853 Ga0439461_0008853_606_1121 171
618 3300041411 Ga0439466_0017035 Ga0439466_0017035_1273_1788 171
619 3300041413 Ga0439465_0042087 Ga0439465_0042087_667_1182 171
620 3300042002 Ga0439442_020198 Ga0439442_020198_595_1110 171
621 3300042006 Ga0439432_021925 Ga0439432_021925_914_1429 171
622 3300042009 Ga0439451_004476 Ga0439451_004476_1415_1930 171
623 3300042013 Ga0439456_005716 Ga0439456_005716_1468_1983 171
624 3300042016 Ga0439463_004715 Ga0439463_004715_832_1347 171
625 3300042115 Ga0450911_006770 Ga0450911_006770_280_795 171
626 3300042121 Ga0450919_002459 Ga0450919_002459_695_1210 171
627 3300042124 Ga0450922_001792 Ga0450922_001792_861_1376 171
628 3300042127 Ga0450890_001350 Ga0450890_001350_1788_2303 171
629 3300042138 Ga0450903_010440 Ga0450903_010440_851_1366 171
630 3300042142 Ga0450905_013462 Ga0450905_013462_30_545 171
631 3300042145 Ga0450906_040661 Ga0450906_040661_165_680 171
632 3300042146 Ga0450907_014196 Ga0450907_014196_629_1144 171
633 3300042147 Ga0450910_006816 Ga0450910_006816_660_1175 171
634 3300042156 Ga0439446_0024126 Ga0439446_0024126_750_1265 171
635 3300042184 Ga0450908_001017 Ga0450908_001017_710_1225 171
636 3300042185 Ga0450909_006648 Ga0450909_006648_319_834 171
637 3300042435 Ga0439434_0021220 Ga0439434_0021220_764_1279 171
638 3300042439 Ga0439464_0014921 Ga0439464_0014921_702_1217 171
639 3300042461 Ga0439460_0005613 Ga0439460_0005613_679_1194 171
640 3300042531 Ga0450918_002698 Ga0450918_002698_1011_1526 171
641 3300042532 Ga0450893_0037499 Ga0450893_0037499_159_674 171
642 3300042993 Ga0439440_0006000 Ga0439440_0006000_700_1215 171
643 3300046452 Ga0495617_008812 Ga0495617_008812_1239_1754 171
644 3300046455 Ga0495603_0076012 Ga0495603_0076012_689_1204 171
645 3300046457 Ga0495590_0016295 Ga0495590_0016295_679_1194 171
646 3300046460 Ga0495638_0043662 Ga0495638_0043662_413_928 171
647 3300046460 Ga0495638_0081225 Ga0495638_0081225_938_1453 171
648 3300046471 Ga0495650_0028050 Ga0495650_0028050_936_1451 171
649 3300046474 Ga0495605_0040929 Ga0495605_0040929_894_1409 171
650 3300046474 Ga0495605_0054274 Ga0495605_0054274_523_1038 171
651 3300046474 Ga0495605_0120156 Ga0495605_0120156_82_597 171
652 3300046474 Ga0495605_0120163 Ga0495605_0120163_82_597 171
653 3300046475 Ga0495639_0009061 Ga0495639_0009061_2086_2601 171
654 3300046491 Ga0495584_0021275 Ga0495584_0021275_926_1441 171
655 3300046491 Ga0495584_0029117 Ga0495584_0029117_984_1499 171
656 3300046492 Ga0495585_0158686 Ga0495585_0158686_389_904 171
657 3300046499 Ga0495594_0022302 Ga0495594_0022302_1263_1778 171
658 3300046501 Ga0495607_0018722 Ga0495607_0018722_1937_2452 171
659 3300046518 Ga0495631_0052976 Ga0495631_0052976_380_895 171
660 3300046519 Ga0495632_0019920 Ga0495632_0019920_1856_2371 171
661 3300046520 Ga0495637_0017667 Ga0495637_0017667_1578_2093 171
662 3300046520 Ga0495637_0039219 Ga0495637_0039219_1020_1535 171
663 3300046522 Ga0495643_0030917 Ga0495643_0030917_523_1038 171
664 3300046523 Ga0495644_0030970 Ga0495644_0030970_842_1357 171
665 3300046524 Ga0495648_0055476 Ga0495648_0055476_972_1487 171
666 3300046524 Ga0495648_0078452 Ga0495648_0078452_890_1405 171
667 3300046526 Ga0495666_0049736 Ga0495666_0049736_684_1199 171
668 3300046528 Ga0495642_0017001 Ga0495642_0017001_990_1505 171
669 3300046530 Ga0495654_0015958 Ga0495654_0015958_1320_1835 171
670 3300046530 Ga0495654_0065255 Ga0495654_0065255_582_1097 171
671 3300046530 Ga0495654_0089787 Ga0495654_0089787_14_529 171
672 3300046538 Ga0495609_0029615 Ga0495609_0029615_1001_1516 171
673 3300046542 Ga0495597_0045606 Ga0495597_0045606_907_1422 171
674 3300046557 Ga0495622_0020444 Ga0495622_0020444_1623_2138 171
675 3300046648 Ga0495611_0026324 Ga0495611_0026324_879_1394 171
676 3300046660 Ga0495625_0061490 Ga0495625_0061490_1130_1645 171
677 3300046660 Ga0495625_0105988 Ga0495625_0105988_783_1298 171
678 3300046664 Ga0495659_0005866 Ga0495659_0005866_2059_2574 171
679 3300046664 Ga0495659_0043848 Ga0495659_0043848_384_899 171
680 3300046664 Ga0495659_0053173 Ga0495659_0053173_775_1290 171
681 3300046665 Ga0495661_0051020 Ga0495661_0051020_705_1220 171
682 3300046665 Ga0495661_0301244 Ga0495661_0301244_251_766 171
683 3300046691 Ga0495670_0031870 Ga0495670_0031870_1055_1570 171
684 3300046691 Ga0495670_0217948 Ga0495670_0217948_211_726 171
685 3300046692 Ga0495671_0018600 Ga0495671_0018600_2271_2786 171
686 3300046694 Ga0495649_0023264 Ga0495649_0023264_1021_1536 171
687 3300046694 Ga0495649_0048550 Ga0495649_0048550_908_1423 171
688 3300046794 Ga0495589_0011789 Ga0495589_0011789_2074_2589 171
689 3300046794 Ga0495589_0022704 Ga0495589_0022704_1592_2107 171
690 3300046810 Ga0495660_0043601 Ga0495660_0043601_944_1459 171
691 3300046810 Ga0495660_0059432 Ga0495660_0059432_846_1361 171
692 3300047315 Ga0495581_0026026 Ga0495581_0026026_1845_2360 171
693 3300047318 Ga0495636_0006978 Ga0495636_0006978_1855_2370 171
694 3300047320 Ga0495672_0025014 Ga0495672_0025014_2168_2683 171
695 3300047320 Ga0495672_0027788 Ga0495672_0027788_1149_1664 171
696 3300047323 Ga0495683_0056761 Ga0495683_0056761_424_939 171
697 3300047323 Ga0495683_0067640 Ga0495683_0067640_549_1064 171
698 3300047443 Ga0495687_010316 Ga0495687_010316_676_1191 171
699 3300047443 Ga0495687_017014 Ga0495687_017014_1273_1788 171
700 3300047445 Ga0495677_0043564 Ga0495677_0043564_759_1325 171
701 3300047447 Ga0495685_021251 Ga0495685_021251_908_1423 171
702 3300047469 Ga0495673_0021477 Ga0495673_0021477_1155_1670 171
703 3300047469 Ga0495673_0060265 Ga0495673_0060265_243_758 171
704 3300047673 Ga0495593_0041237 Ga0495593_0041237_928_1443 171
705 3300048091 Ga0495626_0018006 Ga0495626_0018006_2078_2593 171
706 3300048091 Ga0495626_0028191 Ga0495626_0028191_1230_1745 171
707 3300048091 Ga0495626_0030563 Ga0495626_0030563_899_1414 171
708 3300048091 Ga0495626_0075667 Ga0495626_0075667_661_1176 171
709 3300048905 Ga0496102_0312023 Ga0496102_0312023_814_1329 171
710 3300048907 Ga0496104_0659651 Ga0496104_0659651_94_609 171
711 3300048908 Ga0496105_0249695 Ga0496105_0249695_90_605 171
712 3300048909 Ga0496106_0270911 Ga0496106_0270911_139_654 171
713 3300048910 Ga0496107_0284576 Ga0496107_0284576_702_1217 171
714 3300048919 Ga0496116_0161685 Ga0496116_0161685_18_533 171
715 3300048920 Ga0496117_0065352 Ga0496117_0065352_642_1157 171
716 3300048921 Ga0496118_0081022 Ga0496118_0081022_903_1418 171
717 3300048924 Ga0496121_0069421 Ga0496121_0069421_2071_2586 171
718 3300048925 Ga0496122_0039078 Ga0496122_0039078_2077_2592 171
719 3300048926 Ga0496123_0073984 Ga0496123_0073984_652_1167 171
720 3300048927 Ga0496124_0099295 Ga0496124_0099295_900_1415 171
721 3300049459 Ga0495678_012139 Ga0495678_012139_1718_2233 171
722 3300049459 Ga0495678_026231 Ga0495678_026231_1072_1587 171
723 3300049460 Ga0495682_0068460 Ga0495682_0068460_362_877 171
724 3300049460 Ga0495682_0163945 Ga0495682_0163945_50_565 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13511

DUF4124

Domain of unknown function (DUF4124)

32

95

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y5q-assembly1.cif.gz_B structure of 1:1 papp-a.stc2 complex(half map) 0.7988 112 164
8hgh-assembly1.cif.gz_B structure of 2:2 papp-a.stc2 complex 0.7931 112 164
3pdg-assembly1.cif.gz_A structures of clostridium thermocellum cbha fibronectin(iii)-like modules 0.782 97 168
5df0-assembly1.cif.gz_A crystal structure of acmnpv chitinase a in complex with chitotrio-thiazoline dithioamide 0.7753 97 165
7uwu-assembly2.cif.gz_B starch adherence system protein 6 (sas6) 0.7628 95 165
ID Description Score Start End Superfamily
3pddA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7761 97 168 2.60.40.10
af_A8DZA4_36_129_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7721 92 164 2.60.40.10
2z8rB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7618 99 166 2.60.40.10
3pe9D00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7612 94 167 2.60.40.10
af_A0A096MJG5_540_1085_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7579 112 164 2.60.120.260
ID Description Score Start End GO Terms
AF-A0A455V3M8-F1-model_v4 deleted 0.9553 98 165
AF-A0A3D0K6D8-F1-model_v4 deleted 0.9538 92 168
AF-A0A7Z6XVD9-F1-model_v4 Uncharacterized protein 0.9423 103 171
AF-A0A3C7VX79-F1-model_v4 Penicillin-binding C-terminal domain-containing protein 0.9318 94 167
AF-A0A4Q6G9C7-F1-model_v4 deleted 0.9262 92 168

Feature Viewer

pLDDT pTM Quality
78.57 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map