F474956

General Info

Members Datasets Scaffolds Average Seq Length
683 213 1366 88

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100044761|Ga0070683_1000447613
Length 100
Sequence MRSWPASEAEDPPVLREPDYFEDRELSLIYVAKKLKEALALEKLLTDSGLDYLVEPDRYSGGIIFRSERIGAFFYVAPEDEEKARTTMRSGGYKPYQASM

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 0.44
Rhizosphere 99.41
Stem 0
Stem Tuber 0
Unclassified 42.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100044761 3300005329 Unclassified 4083
2 Ga0070658_10504122 3300005327 Unclassified 1046
3 Ga0070658_10507206 3300005327 Unclassified 1042
4 Ga0070683_100003332 3300005329 Bacteria 12995
5 Ga0070683_100008730 3300005329 Bacteria 8617
6 Ga0070683_100083652 3300005329 Bacteria 2989
7 Ga0070683_100205020 3300005329 Bacteria 1873
8 Ga0070683_101256958 3300005329 Unclassified 712
9 Ga0070683_101390237 3300005329 Bacteria 675
10 Ga0070683_101558656 3300005329 Unclassified 635
11 Ga0070690_100055311 3300005330 Unclassified 2542
12 Ga0070690_100088554 3300005330 Bacteria 2035
13 Ga0070690_101257727 3300005330 Unclassified 592
14 Ga0068869_100261326 3300005334 Unclassified 1386
15 Ga0068869_101678241 3300005334 Unclassified 567
16 Ga0070666_10005151 3300005335 Bacteria 8001
17 Ga0070666_10150217 3300005335 Bacteria 1625
18 Ga0070666_10714610 3300005335 Bacteria 735
19 Ga0070680_100307720 3300005336 Bacteria 1344
20 Ga0070682_100793833 3300005337 Bacteria 768
21 Ga0068868_100066589 3300005338 Unclassified 2864
22 Ga0068868_101735919 3300005338 Bacteria 589
23 Ga0068868_101985779 3300005338 Unclassified 552
24 Ga0068868_102017304 3300005338 Unclassified 548
25 Ga0070660_100044150 3300005339 Bacteria 3408
26 Ga0070660_100075040 3300005339 Bacteria 2647
27 Ga0070660_100268720 3300005339 Bacteria 1393
28 Ga0070660_100439155 3300005339 Unclassified 1082
29 Ga0070689_100464250 3300005340 Bacteria 1079
30 Ga0070691_10003894 3300005341 Bacteria 6751
31 Ga0070687_100433053 3300005343 Unclassified 870
32 Ga0070661_100054684 3300005344 Bacteria 2923
33 Ga0070661_100159037 3300005344 Bacteria 1710
34 Ga0070668_100735314 3300005347 Unclassified 872
35 Ga0070671_100050798 3300005355 Bacteria 3449
36 Ga0070671_100280924 3300005355 Bacteria 1416
37 Ga0070674_100499941 3300005356 Unclassified 1012
38 Ga0070674_100527383 3300005356 Unclassified 987
39 Ga0070673_100100446 3300005364 Bacteria 2382
40 Ga0070673_101261500 3300005364 Unclassified 693
41 Ga0070659_100514037 3300005366 Bacteria 1022
42 Ga0070659_101084236 3300005366 Bacteria 705
43 Ga0070667_100057276 3300005367 Bacteria 3293
44 Ga0070667_100068445 3300005367 Bacteria 3021
45 Ga0070667_100814696 3300005367 Bacteria 867
46 Ga0070709_10131900 3300005434 Bacteria 1707
47 Ga0070709_10252884 3300005434 Unclassified 1270
48 Ga0070714_100205363 3300005435 Bacteria 1804
49 Ga0070713_100077747 3300005436 Bacteria 2822
50 Ga0070710_10733761 3300005437 Unclassified 700
51 Ga0070711_100092531 3300005439 Bacteria 2182
52 Ga0070711_100133953 3300005439 Bacteria 1849
53 Ga0070711_100361982 3300005439 Bacteria 1168
54 Ga0070711_100393310 3300005439 Unclassified 1123
55 Ga0070711_100423746 3300005439 Bacteria 1085
56 Ga0070711_100470931 3300005439 Unclassified 1031
57 Ga0070708_100432561 3300005445 Bacteria 1241
58 Ga0070678_100303683 3300005456 Bacteria 1357
59 Ga0070678_100410974 3300005456 Unclassified 1178
60 Ga0070662_100251377 3300005457 Bacteria 1421
61 Ga0070681_10010982 3300005458 Bacteria 8952
62 Ga0070681_10016327 3300005458 Bacteria 7411
63 Ga0070681_10084888 3300005458 Unclassified 3119
64 Ga0070681_10098972 3300005458 Bacteria 2862
65 Ga0070681_10212122 3300005458 Bacteria 1852
66 Ga0070681_10506056 3300005458 Unclassified 1121
67 Ga0070681_11137552 3300005458 Unclassified 702
68 Ga0068867_100016005 3300005459 Bacteria 5325
69 Ga0068867_100064553 3300005459 Unclassified 2723
70 Ga0068867_100430562 3300005459 Bacteria 1120
71 Ga0070698_101864810 3300005471 Unclassified 554
72 Ga0070679_100001481 3300005530 Bacteria 20822
73 Ga0070679_100088268 3300005530 Bacteria 3088
74 Ga0070679_100606803 3300005530 Unclassified 1037
75 Ga0070679_100671305 3300005530 Unclassified 979
76 Ga0070679_102125879 3300005530 Unclassified 511
77 Ga0070684_100022083 3300005535 Bacteria 5303
78 Ga0070684_100024943 3300005535 Bacteria 5020
79 Ga0070684_100044644 3300005535 Bacteria 3834
80 Ga0070684_100051027 3300005535 Bacteria 3594
81 Ga0070684_100469666 3300005535 Bacteria 1164
82 Ga0070684_100550345 3300005535 Unclassified 1071
83 Ga0070684_100664249 3300005535 Unclassified 971
84 Ga0070684_101134571 3300005535 Bacteria 735
85 Ga0070697_100948128 3300005536 Unclassified 764
86 Ga0068853_100096705 3300005539 Bacteria 2606
87 Ga0068853_100136080 3300005539 Unclassified 2203
88 Ga0068853_100320989 3300005539 Bacteria 1436
89 Ga0068853_100551170 3300005539 Bacteria 1092
90 Ga0068853_100551403 3300005539 Unclassified 1092
91 Ga0070672_100507894 3300005543 Unclassified 1043
92 Ga0070686_100588194 3300005544 Unclassified 875
93 Ga0070686_101304841 3300005544 Unclassified 606
94 Ga0070695_100686055 3300005545 Unclassified 812
95 Ga0070696_101467751 3300005546 Bacteria 583
96 Ga0070693_100038139 3300005547 Unclassified 2684
97 Ga0070665_100308259 3300005548 Unclassified 1586
98 Ga0070665_100561934 3300005548 Bacteria 1153
99 Ga0068855_100001548 3300005563 Bacteria 28938
100 Ga0068855_100004931 3300005563 Bacteria 16277
101 Ga0068855_100031062 3300005563 Bacteria 6382
102 Ga0068855_100051767 3300005563 Unclassified 4836
103 Ga0068855_100103694 3300005563 Bacteria 3272
104 Ga0068855_100176865 3300005563 Bacteria 2414
105 Ga0068855_100835672 3300005563 Unclassified 977
106 Ga0070664_100138057 3300005564 Bacteria 2145
107 Ga0070664_100427195 3300005564 Bacteria 1214
108 Ga0070664_101065372 3300005564 Unclassified 761
109 Ga0070664_101701431 3300005564 Unclassified 598
110 Ga0068857_100001166 3300005577 Bacteria 20488
111 Ga0068857_100011546 3300005577 Bacteria 7685
112 Ga0068857_100016136 3300005577 Bacteria 6542
113 Ga0068857_100016150 3300005577 Bacteria 6539
114 Ga0068857_100024100 3300005577 Bacteria 5357
115 Ga0068857_100925308 3300005577 Unclassified 837
116 Ga0068854_100311330 3300005578 Bacteria 1277
117 Ga0068854_100527431 3300005578 Bacteria 998
118 Ga0068856_100000805 3300005614 Bacteria 33867
119 Ga0068856_100010939 3300005614 Bacteria 8804
120 Ga0068856_100049260 3300005614 Bacteria 4152
121 Ga0068856_100055744 3300005614 Bacteria 3900
122 Ga0068856_100079583 3300005614 Bacteria 3250
123 Ga0068856_100116638 3300005614 Bacteria 2670
124 Ga0068856_100289794 3300005614 Bacteria 1654
125 Ga0068856_100343510 3300005614 Unclassified 1511
126 Ga0068856_100572318 3300005614 Unclassified 1151
127 Ga0070702_101532725 3300005615 Unclassified 549
128 Ga0068852_100006181 3300005616 Bacteria 8637
129 Ga0068852_100116044 3300005616 Bacteria 2442
130 Ga0068852_100154112 3300005616 Unclassified 2139
131 Ga0068852_100632300 3300005616 Unclassified 1077
132 Ga0068852_101707675 3300005616 Unclassified 652
133 Ga0068852_101791909 3300005616 Bacteria 636
134 Ga0068859_100073744 3300005617 Bacteria 3451
135 Ga0068859_100354731 3300005617 Bacteria 1561
136 Ga0068859_100608132 3300005617 Bacteria 1186
137 Ga0068859_100758204 3300005617 Unclassified 1059
138 Ga0068864_100011494 3300005618 Bacteria 7312
139 Ga0068864_100118007 3300005618 Bacteria 2369
140 Ga0068864_100300382 3300005618 Bacteria 1503
141 Ga0068864_100612961 3300005618 Bacteria 1057
142 Ga0068864_100768206 3300005618 Unclassified 945
143 Ga0068866_10380429 3300005718 Unclassified 905
144 Ga0068861_100559576 3300005719 Unclassified 1043
145 Ga0068863_100016712 3300005841 Bacteria 7040
146 Ga0068863_100027929 3300005841 Bacteria 5385
147 Ga0068863_100120438 3300005841 Bacteria 2502
148 Ga0068863_100176905 3300005841 Unclassified 2048
149 Ga0068863_100593242 3300005841 Unclassified 1096
150 Ga0068863_100806616 3300005841 Bacteria 936
151 Ga0068863_101064035 3300005841 Unclassified 813
152 Ga0068863_102500150 3300005841 Unclassified 526
153 Ga0068858_100001679 3300005842 Bacteria 22639
154 Ga0068858_100005315 3300005842 Bacteria 12622
155 Ga0068858_100296067 3300005842 Bacteria 1543
156 Ga0068858_100577746 3300005842 Bacteria 1089
157 Ga0068858_101193513 3300005842 Unclassified 748
158 Ga0068858_101200597 3300005842 Unclassified 746
159 Ga0068860_100004901 3300005843 Bacteria 13641
160 Ga0068860_100033609 3300005843 Bacteria 4920
161 Ga0068860_100125702 3300005843 Unclassified 2458
162 Ga0068860_101321294 3300005843 Bacteria 742
163 Ga0068860_102081528 3300005843 Unclassified 589
164 Ga0068862_100997936 3300005844 Bacteria 828
165 Ga0068862_102461146 3300005844 Unclassified 532
166 Ga0070717_11595202 3300006028 Unclassified 591
167 Ga0070715_10335926 3300006163 Bacteria 820
168 Ga0070716_101056617 3300006173 Unclassified 645
169 Ga0070716_101792409 3300006173 Unclassified 508
170 Ga0097621_100035350 3300006237 Bacteria 3992
171 Ga0097621_100053093 3300006237 Bacteria 3303
172 Ga0097621_100101870 3300006237 Bacteria 2417
173 Ga0097621_100157928 3300006237 Bacteria 1948
174 Ga0097621_100162116 3300006237 Unclassified 1923
175 Ga0097621_100165539 3300006237 Unclassified 1903
176 Ga0097621_100818088 3300006237 Unclassified 864
177 Ga0097621_102055714 3300006237 Unclassified 546
178 Ga0097621_102056408 3300006237 Unclassified 546
179 Ga0068871_100002393 3300006358 Bacteria 12791
180 Ga0068871_100007348 3300006358 Bacteria 7861
181 Ga0068871_100015684 3300006358 Bacteria 5682
182 Ga0068871_100033878 3300006358 Bacteria 4047
183 Ga0068871_100038403 3300006358 Bacteria 3824
184 Ga0068871_100294552 3300006358 Bacteria 1423
185 Ga0068871_100461607 3300006358 Bacteria 1140
186 Ga0075430_100159444 3300006846 Unclassified 1878
187 Ga0068865_100011315 3300006881 Bacteria 5579
188 Ga0068865_100036403 3300006881 Bacteria 3318
189 Ga0068865_100095379 3300006881 Unclassified 2167
190 Ga0075436_100291022 3300006914 Unclassified 1169
191 Ga0097620_100073744 3300006931 Bacteria 3451
192 Ga0097620_100354752 3300006931 Bacteria 1561
193 Ga0097620_100608199 3300006931 Bacteria 1186
194 Ga0097620_100758213 3300006931 Unclassified 1059
195 Ga0099794_10259935 3300007265 Unclassified 896
196 Ga0105240_10000902 3300009093 Bacteria 53015
197 Ga0105240_10003336 3300009093 Bacteria 24993
198 Ga0105240_10097279 3300009093 Unclassified 3587
199 Ga0105240_10294936 3300009093 Bacteria 1857
200 Ga0105240_10426906 3300009093 Unclassified 1488
201 Ga0105240_10477589 3300009093 Bacteria 1390
202 Ga0105240_10611507 3300009093 Unclassified 1199
203 Ga0105240_10737970 3300009093 Bacteria 1072
204 Ga0105240_11637171 3300009093 Unclassified 673
205 Ga0105245_10004892 3300009098 Bacteria 11784
206 Ga0105245_10006604 3300009098 Bacteria 10184
207 Ga0105245_10012603 3300009098 Bacteria 7360
208 Ga0105245_10012889 3300009098 Bacteria 7288
209 Ga0105245_10014159 3300009098 Bacteria 6952
210 Ga0105245_10025780 3300009098 Bacteria 5170
211 Ga0105245_10107741 3300009098 Bacteria 2587
212 Ga0105245_10118107 3300009098 Bacteria 2474
213 Ga0105245_10174792 3300009098 Bacteria 2047
214 Ga0105245_10252113 3300009098 Bacteria 1715
215 Ga0105245_10295679 3300009098 Bacteria 1587
216 Ga0105245_10546834 3300009098 Unclassified 1179
217 Ga0105245_11737575 3300009098 Unclassified 676
218 Ga0105245_11742760 3300009098 Unclassified 675
219 Ga0105245_12038143 3300009098 Bacteria 627
220 Ga0105247_10041721 3300009101 Bacteria 2808
221 Ga0105247_10217408 3300009101 Unclassified 1292
222 Ga0105247_10693778 3300009101 Bacteria 765
223 Ga0105243_10055986 3300009148 Bacteria 3134
224 Ga0105243_10077523 3300009148 Unclassified 2703
225 Ga0105243_10203412 3300009148 Bacteria 1738
226 Ga0105243_10875395 3300009148 Unclassified 891
227 Ga0105243_11073378 3300009148 Unclassified 812
228 Ga0105243_11779670 3300009148 Bacteria 647
229 Ga0105243_12702808 3300009148 Unclassified 537
230 Ga0105241_10026406 3300009174 Unclassified 4320
231 Ga0105241_10087456 3300009174 Bacteria 2453
232 Ga0105241_10089009 3300009174 Bacteria 2432
233 Ga0105241_10109637 3300009174 Bacteria 2208
234 Ga0105241_10117801 3300009174 Bacteria 2135
235 Ga0105241_10266909 3300009174 Unclassified 1456
236 Ga0105241_10268079 3300009174 Unclassified 1454
237 Ga0105241_10353698 3300009174 Unclassified 1276
238 Ga0105241_10848087 3300009174 Unclassified 845
239 Ga0105241_10892132 3300009174 Unclassified 825
240 Ga0105241_10954598 3300009174 Unclassified 799
241 Ga0105241_11384739 3300009174 Unclassified 673
242 Ga0105242_10005358 3300009176 Bacteria 9919
243 Ga0105242_10007591 3300009176 Bacteria 8347
244 Ga0105242_10010444 3300009176 Bacteria 7125
245 Ga0105242_10037585 3300009176 Unclassified 3889
246 Ga0105242_10054985 3300009176 Bacteria 3256
247 Ga0105242_10145417 3300009176 Bacteria 2062
248 Ga0105242_10199854 3300009176 Bacteria 1775
249 Ga0105242_10422704 3300009176 Bacteria 1249
250 Ga0105242_10865536 3300009176 Unclassified 901
251 Ga0105242_10963474 3300009176 Bacteria 858
252 Ga0105248_10013594 3300009177 Bacteria 8960
253 Ga0105248_10028125 3300009177 Bacteria 6262
254 Ga0105248_10043727 3300009177 Bacteria 5024
255 Ga0105248_10050640 3300009177 Unclassified 4659
256 Ga0105248_10057566 3300009177 Bacteria 4363
257 Ga0105248_10240442 3300009177 Unclassified 2038
258 Ga0105248_10444410 3300009177 Bacteria 1461
259 Ga0105248_10445791 3300009177 Unclassified 1458
260 Ga0105248_10959812 3300009177 Bacteria 965
261 Ga0105248_10995698 3300009177 Unclassified 947
262 Ga0105248_11365609 3300009177 Unclassified 802
263 Ga0105248_11384375 3300009177 Unclassified 796
264 Ga0105237_10002574 3300009545 Bacteria 22356
265 Ga0105237_10010399 3300009545 Bacteria 9904
266 Ga0105237_10078645 3300009545 Bacteria 3287
267 Ga0105237_10106453 3300009545 Bacteria 2796
268 Ga0105237_10539953 3300009545 Unclassified 1173
269 Ga0105237_10967871 3300009545 Unclassified 858
270 Ga0105237_11014069 3300009545 Unclassified 837
271 Ga0105238_10002330 3300009551 Bacteria 19101
272 Ga0105238_10005599 3300009551 Bacteria 12411
273 Ga0105238_10007323 3300009551 Bacteria 11049
274 Ga0105238_10045201 3300009551 Bacteria 4449
275 Ga0105238_10079332 3300009551 Bacteria 3273
276 Ga0105238_10081446 3300009551 Bacteria 3226
277 Ga0105238_10103063 3300009551 Bacteria 2835
278 Ga0105238_10142322 3300009551 Unclassified 2375
279 Ga0105238_10191073 3300009551 Unclassified 2024
280 Ga0105238_10220047 3300009551 Unclassified 1875
281 Ga0105238_10257952 3300009551 Unclassified 1722
282 Ga0105238_10702016 3300009551 Unclassified 1024
283 Ga0105249_10047300 3300009553 Bacteria 3919
284 Ga0105249_10092764 3300009553 Unclassified 2827
285 Ga0105249_10166426 3300009553 Unclassified 2135
286 Ga0105249_10922264 3300009553 Unclassified 941
287 Ga0105249_11207625 3300009553 Unclassified 827
288 Ga0105249_11936705 3300009553 Bacteria 662
289 Ga0105239_10002707 3300010375 Bacteria 22284
290 Ga0105239_10010040 3300010375 Bacteria 10614
291 Ga0105239_10014444 3300010375 Bacteria 8762
292 Ga0105239_10148463 3300010375 Unclassified 2616
293 Ga0105239_10572945 3300010375 Bacteria 1287
294 Ga0105239_10876768 3300010375 Unclassified 1030
295 Ga0105246_10035862 3300011119 Bacteria 3318
296 Ga0105246_10048356 3300011119 Unclassified 2907
297 Ga0105246_10311615 3300011119 Bacteria 1275
298 Ga0105246_11419368 3300011119 Bacteria 648
299 Ga0105246_11969421 3300011119 Bacteria 563
300 Ga0157371_10741259 3300013102 Bacteria 737
301 Ga0157370_10003445 3300013104 Bacteria 18570
302 Ga0157370_10007799 3300013104 Bacteria 11602
303 Ga0157370_10037406 3300013104 Unclassified 4705
304 Ga0157370_10042165 3300013104 Unclassified 4400
305 Ga0157370_10210846 3300013104 Bacteria 1800
306 Ga0157369_10018664 3300013105 Bacteria 7775
307 Ga0157369_10020006 3300013105 Bacteria 7485
308 Ga0157369_10034141 3300013105 Bacteria 5584
309 Ga0157369_10114163 3300013105 Unclassified 2869
310 Ga0157369_10170631 3300013105 Bacteria 2292
311 Ga0157369_10824633 3300013105 Unclassified 952
312 Ga0157369_11104501 3300013105 Bacteria 810
313 Ga0157374_10021267 3300013296 Bacteria 5770
314 Ga0157374_10065363 3300013296 Bacteria 3416
315 Ga0157374_10076271 3300013296 Bacteria 3170
316 Ga0157374_10170185 3300013296 Unclassified 2125
317 Ga0157374_10306692 3300013296 Bacteria 1571
318 Ga0157374_10467433 3300013296 Bacteria 1264
319 Ga0157374_10878503 3300013296 Unclassified 914
320 Ga0157374_12586730 3300013296 Unclassified 535
321 Ga0157378_10009401 3300013297 Bacteria 8517
322 Ga0157378_10009797 3300013297 Bacteria 8352
323 Ga0157378_10439128 3300013297 Unclassified 1293
324 Ga0157378_10476488 3300013297 Bacteria 1243
325 Ga0157378_10564519 3300013297 Unclassified 1145
326 Ga0157378_11244303 3300013297 Bacteria 784
327 Ga0157378_12812948 3300013297 Unclassified 539
328 Ga0163162_10079147 3300013306 Bacteria 3353
329 Ga0163162_10100848 3300013306 Bacteria 2979
330 Ga0163162_10574467 3300013306 Bacteria 1255
331 Ga0163162_10747241 3300013306 Unclassified 1098
332 Ga0163162_10776139 3300013306 Bacteria 1077
333 Ga0157372_10011100 3300013307 Bacteria 9581
334 Ga0157372_10033562 3300013307 Bacteria 5638
335 Ga0157372_10139669 3300013307 Bacteria 2790
336 Ga0157372_10640085 3300013307 Unclassified 1238
337 Ga0157372_12543205 3300013307 Unclassified 588
338 Ga0157375_10013161 3300013308 Bacteria 7354
339 Ga0157375_10013936 3300013308 Bacteria 7169
340 Ga0157375_10032649 3300013308 Unclassified 4939
341 Ga0157375_10252761 3300013308 Unclassified 1923
342 Ga0157375_10321639 3300013308 Bacteria 1712
343 Ga0163163_10004862 3300014325 Bacteria 11544
344 Ga0163163_10020608 3300014325 Bacteria 6214
345 Ga0163163_10025231 3300014325 Bacteria 5666
346 Ga0163163_10142584 3300014325 Unclassified 2438
347 Ga0163163_10221650 3300014325 Unclassified 1940
348 Ga0163163_10314698 3300014325 Unclassified 1619
349 Ga0163163_10662449 3300014325 Bacteria 1107
350 Ga0163163_11288034 3300014325 Bacteria 793
351 Ga0157380_11250760 3300014326 Unclassified 788
352 Ga0157377_10510043 3300014745 Bacteria 842
353 Ga0157377_11131466 3300014745 Unclassified 602
354 Ga0157379_10017491 3300014968 Bacteria 6312
355 Ga0157379_10105485 3300014968 Bacteria 2529
356 Ga0157379_10768123 3300014968 Unclassified 908
357 Ga0157376_10058885 3300014969 Bacteria 3219
358 Ga0157376_10357485 3300014969 Unclassified 1400
359 Ga0157376_10602797 3300014969 Bacteria 1093
360 Ga0157376_10986358 3300014969 Bacteria 864
361 Ga0157376_12998586 3300014969 Unclassified 511
362 Ga0182007_10253188 3300015262 Bacteria 632
363 Ga0163161_11317434 3300017792 Bacteria 628
364 Ga0207697_10123622 3300025315 Unclassified 1115
365 Ga0207692_10257467 3300025898 Unclassified 1048
366 Ga0207642_10333976 3300025899 Unclassified 889
367 Ga0207642_10645969 3300025899 Unclassified 662
368 Ga0207710_10373404 3300025900 Bacteria 729
369 Ga0207680_10510924 3300025903 Unclassified 856
370 Ga0207685_10774129 3300025905 Unclassified 527
371 Ga0207705_10106917 3300025909 Bacteria 2064
372 Ga0207705_10412777 3300025909 Unclassified 1045
373 Ga0207654_10012234 3300025911 Unclassified 4393
374 Ga0207654_10074589 3300025911 Bacteria 2025
375 Ga0207654_10152255 3300025911 Unclassified 1485
376 Ga0207654_10172515 3300025911 Unclassified 1405
377 Ga0207654_10586279 3300025911 Bacteria 795
378 Ga0207654_10750961 3300025911 Unclassified 703
379 Ga0207707_10000744 3300025912 Bacteria 32131
380 Ga0207707_10007810 3300025912 Bacteria 9308
381 Ga0207707_10016349 3300025912 Bacteria 6472
382 Ga0207707_10087233 3300025912 Bacteria 2727
383 Ga0207707_10109190 3300025912 Unclassified 2418
384 Ga0207707_10371090 3300025912 Bacteria 1231
385 Ga0207695_10003011 3300025913 Bacteria 24220
386 Ga0207695_10010314 3300025913 Bacteria 11440
387 Ga0207695_10015585 3300025913 Bacteria 8941
388 Ga0207695_10027113 3300025913 Bacteria 6381
389 Ga0207695_10033326 3300025913 Bacteria 5620
390 Ga0207695_10188447 3300025913 Unclassified 1981
391 Ga0207695_10392741 3300025913 Bacteria 1272
392 Ga0207671_10011172 3300025914 Bacteria 7332
393 Ga0207671_10187048 3300025914 Unclassified 1614
394 Ga0207663_10151276 3300025916 Bacteria 1628
395 Ga0207663_10168720 3300025916 Bacteria 1552
396 Ga0207663_10170687 3300025916 Bacteria 1545
397 Ga0207663_10385294 3300025916 Unclassified 1069
398 Ga0207663_11516890 3300025916 Unclassified 540
399 Ga0207662_10267186 3300025918 Unclassified 1128
400 Ga0207657_10007491 3300025919 Bacteria 11186
401 Ga0207657_10077384 3300025919 Bacteria 2804
402 Ga0207657_10216333 3300025919 Unclassified 1536
403 Ga0207649_10062779 3300025920 Bacteria 2343
404 Ga0207649_11327918 3300025920 Unclassified 569
405 Ga0207652_10004664 3300025921 Bacteria 11113
406 Ga0207652_10034897 3300025921 Bacteria 4242
407 Ga0207652_10070113 3300025921 Bacteria 3044
408 Ga0207652_10548652 3300025921 Bacteria 1039
409 Ga0207652_10661857 3300025921 Unclassified 933
410 Ga0207652_10959707 3300025921 Unclassified 753
411 Ga0207681_11641345 3300025923 Unclassified 538
412 Ga0207694_10001024 3300025924 Bacteria 24374
413 Ga0207694_10003038 3300025924 Bacteria 13457
414 Ga0207694_10007367 3300025924 Bacteria 8346
415 Ga0207694_10009550 3300025924 Bacteria 7318
416 Ga0207694_10029999 3300025924 Bacteria 4152
417 Ga0207694_10068475 3300025924 Bacteria 2772
418 Ga0207694_10144600 3300025924 Unclassified 1914
419 Ga0207694_10168173 3300025924 Unclassified 1774
420 Ga0207694_10178218 3300025924 Bacteria 1722
421 Ga0207687_10001024 3300025927 Bacteria 18980
422 Ga0207687_10005986 3300025927 Bacteria 8045
423 Ga0207687_10011261 3300025927 Bacteria 5843
424 Ga0207687_10022491 3300025927 Bacteria 4196
425 Ga0207687_10054401 3300025927 Bacteria 2800
426 Ga0207687_10117439 3300025927 Bacteria 1984
427 Ga0207687_10245208 3300025927 Bacteria 1422
428 Ga0207687_10807211 3300025927 Unclassified 800
429 Ga0207687_10936890 3300025927 Unclassified 742
430 Ga0207700_10003830 3300025928 Bacteria 8788
431 Ga0207700_10010156 3300025928 Bacteria 5923
432 Ga0207700_10505501 3300025928 Unclassified 1070
433 Ga0207664_10290875 3300025929 Bacteria 1436
434 Ga0207644_10009905 3300025931 Bacteria 6270
435 Ga0207644_10213421 3300025931 Bacteria 1527
436 Ga0207690_10010120 3300025932 Bacteria 5600
437 Ga0207690_10046758 3300025932 Unclassified 2868
438 Ga0207706_10099144 3300025933 Bacteria 2563
439 Ga0207686_10019609 3300025934 Unclassified 3850
440 Ga0207686_10034991 3300025934 Bacteria 3011
441 Ga0207686_10136398 3300025934 Bacteria 1690
442 Ga0207686_10337426 3300025934 Unclassified 1131
443 Ga0207686_10340961 3300025934 Unclassified 1125
444 Ga0207686_10501919 3300025934 Unclassified 941
445 Ga0207686_11658898 3300025934 Unclassified 528
446 Ga0207686_11662571 3300025934 Unclassified 528
447 Ga0207709_10137437 3300025935 Unclassified 1675
448 Ga0207709_10253883 3300025935 Unclassified 1286
449 Ga0207709_11185487 3300025935 Bacteria 629
450 Ga0207709_11226989 3300025935 Unclassified 618
451 Ga0207709_11491900 3300025935 Unclassified 561
452 Ga0207670_10336593 3300025936 Bacteria 1191
453 Ga0207669_10508778 3300025937 Unclassified 965
454 Ga0207669_11582515 3300025937 Unclassified 559
455 Ga0207704_10004284 3300025938 Bacteria 6520
456 Ga0207704_10017892 3300025938 Unclassified 3686
457 Ga0207704_10037431 3300025938 Bacteria 2803
458 Ga0207704_11387581 3300025938 Bacteria 602
459 Ga0207665_10961895 3300025939 Unclassified 679
460 Ga0207691_10236200 3300025940 Bacteria 1581
461 Ga0207711_10006913 3300025941 Bacteria 9529
462 Ga0207711_10026639 3300025941 Unclassified 4852
463 Ga0207711_10027844 3300025941 Bacteria 4750
464 Ga0207711_10109520 3300025941 Bacteria 2454
465 Ga0207711_10362776 3300025941 Bacteria 1342
466 Ga0207711_10391406 3300025941 Unclassified 1291
467 Ga0207711_10758456 3300025941 Unclassified 904
468 Ga0207711_11041816 3300025941 Bacteria 758
469 Ga0207711_11907060 3300025941 Bacteria 537
470 Ga0207689_10123497 3300025942 Bacteria 2129
471 Ga0207689_10141712 3300025942 Unclassified 1980
472 Ga0207689_10585674 3300025942 Unclassified 938
473 Ga0207689_10660010 3300025942 Bacteria 881
474 Ga0207689_11402602 3300025942 Unclassified 585
475 Ga0207661_10001824 3300025944 Bacteria 14562
476 Ga0207661_10003946 3300025944 Bacteria 10363
477 Ga0207661_10185413 3300025944 Bacteria 1821
478 Ga0207661_10195352 3300025944 Bacteria 1776
479 Ga0207661_10317671 3300025944 Unclassified 1399
480 Ga0207661_10429209 3300025944 Bacteria 1201
481 Ga0207661_10644603 3300025944 Unclassified 973
482 Ga0207679_10076373 3300025945 Bacteria 2545
483 Ga0207679_10272296 3300025945 Unclassified 1449
484 Ga0207679_10442901 3300025945 Bacteria 1151
485 Ga0207667_10001895 3300025949 Bacteria 26257
486 Ga0207667_10002299 3300025949 Bacteria 24006
487 Ga0207667_10004489 3300025949 Bacteria 17092
488 Ga0207667_10049522 3300025949 Bacteria 4436
489 Ga0207667_10187056 3300025949 Unclassified 2126
490 Ga0207667_10329498 3300025949 Unclassified 1559
491 Ga0207667_10763835 3300025949 Bacteria 965
492 Ga0207667_11130214 3300025949 Unclassified 765
493 Ga0207651_10021247 3300025960 Bacteria 3940
494 Ga0207712_10075582 3300025961 Bacteria 2436
495 Ga0207712_10772098 3300025961 Unclassified 843
496 Ga0207712_11133342 3300025961 Bacteria 697
497 Ga0207668_10319320 3300025972 Unclassified 1288
498 Ga0207640_10030039 3300025981 Bacteria 3343
499 Ga0207658_10164453 3300025986 Bacteria 1821
500 Ga0207658_10375712 3300025986 Unclassified 1244
501 Ga0207658_11443910 3300025986 Unclassified 629
502 Ga0207677_10151705 3300026023 Bacteria 1789
503 Ga0207677_10259606 3300026023 Unclassified 1415
504 Ga0207677_11306909 3300026023 Bacteria 666
505 Ga0207677_11383434 3300026023 Unclassified 648
506 Ga0207677_11433528 3300026023 Bacteria 637
507 Ga0207703_10003146 3300026035 Bacteria 13927
508 Ga0207703_10020197 3300026035 Bacteria 5209
509 Ga0207703_10096999 3300026035 Bacteria 2490
510 Ga0207703_10826758 3300026035 Bacteria 885
511 Ga0207703_10918348 3300026035 Unclassified 838
512 Ga0207703_12408995 3300026035 Unclassified 502
513 Ga0207639_10070001 3300026041 Unclassified 2739
514 Ga0207639_10105016 3300026041 Unclassified 2291
515 Ga0207639_10453922 3300026041 Unclassified 1164
516 Ga0207639_10479625 3300026041 Bacteria 1133
517 Ga0207639_10625185 3300026041 Bacteria 995
518 Ga0207639_10767445 3300026041 Bacteria 897
519 Ga0207708_10453736 3300026075 Unclassified 1068
520 Ga0207702_10002419 3300026078 Bacteria 17748
521 Ga0207702_10026940 3300026078 Bacteria 4774
522 Ga0207702_10038047 3300026078 Bacteria 4030
523 Ga0207702_10061524 3300026078 Bacteria 3203
524 Ga0207702_10191507 3300026078 Unclassified 1890
525 Ga0207702_10243145 3300026078 Bacteria 1687
526 Ga0207702_10351809 3300026078 Unclassified 1410
527 Ga0207702_10660568 3300026078 Unclassified 1028
528 Ga0207641_10003019 3300026088 Bacteria 15172
529 Ga0207641_10399007 3300026088 Unclassified 1320
530 Ga0207641_10555725 3300026088 Unclassified 1120
531 Ga0207641_10584533 3300026088 Unclassified 1092
532 Ga0207641_10634655 3300026088 Unclassified 1048
533 Ga0207641_11715421 3300026088 Bacteria 630
534 Ga0207648_10003227 3300026089 Bacteria 17174
535 Ga0207648_10295784 3300026089 Bacteria 1451
536 Ga0207648_11373084 3300026089 Unclassified 664
537 Ga0207676_10090402 3300026095 Unclassified 2512
538 Ga0207676_10148459 3300026095 Bacteria 2016
539 Ga0207676_10267341 3300026095 Bacteria 1547
540 Ga0207676_10497763 3300026095 Bacteria 1157
541 Ga0207676_11327412 3300026095 Bacteria 714
542 Ga0207674_10002011 3300026116 Bacteria 25818
543 Ga0207674_10005710 3300026116 Bacteria 14747
544 Ga0207674_10016193 3300026116 Bacteria 8166
545 Ga0207674_10018723 3300026116 Bacteria 7516
546 Ga0207674_10024250 3300026116 Bacteria 6485
547 Ga0207674_10180316 3300026116 Bacteria 2063
548 Ga0207675_100421629 3300026118 Bacteria 1318
549 Ga0207683_10348513 3300026121 Bacteria 1359
550 Ga0207683_10444193 3300026121 Unclassified 1195
551 Ga0207698_10015556 3300026142 Bacteria 5097
552 Ga0207698_10019341 3300026142 Bacteria 4660
553 Ga0207698_10177944 3300026142 Bacteria 1880
554 Ga0207698_10780053 3300026142 Unclassified 957
555 Ga0207698_12069339 3300026142 Unclassified 583
556 Ga0207698_12569735 3300026142 Unclassified 519
557 Ga0268266_10027306 3300028379 Bacteria 4854
558 Ga0268266_10252324 3300028379 Bacteria 1632
559 Ga0268265_10994980 3300028380 Bacteria 828
560 Ga0268264_10019626 3300028381 Bacteria 5522
561 Ga0268264_10038788 3300028381 Bacteria 3933
562 Ga0268264_10165130 3300028381 Unclassified 1998
563 Ga0268264_10193659 3300028381 Bacteria 1855
564 Ga0268264_10360690 3300028381 Bacteria 1386
565 Ga0268264_11560097 3300028381 Unclassified 671
566 Ga0265338_10102948 3300028800 Unclassified 2321
567 Ga0265338_10525315 3300028800 Bacteria 831
568 Ga0265329_10242115 3300031242 Bacteria 600
569 Ga0265340_10131748 3300031247 Bacteria 1146
570 Ga0265339_10461288 3300031249 Bacteria 589
571 Ga0265331_10356683 3300031250 Unclassified 655
572 Ga0265331_10501522 3300031250 Unclassified 546
573 Ga0265327_10443110 3300031251 Bacteria 562
574 Ga0265313_10104209 3300031595 Bacteria 1255
575 Ga0265314_10001081 3300031711 Bacteria 31584
576 Ga0265314_10003587 3300031711 Bacteria 14944
577 Ga0265342_10428248 3300031712 Bacteria 681
578 Ga0373934_0011468 3300035086 Unclassified 3333
579 Ga0373934_0066008 3300035086 Bacteria 1445
580 Ga0373934_0186372 3300035086 Bacteria 853
581 Ga0373944_0049324 3300035089 Bacteria 1323
582 Ga0373944_0364272 3300035089 Unclassified 552
583 Ga0373923_0314289 3300035111 Unclassified 743
584 Ga0373953_0018971 3300035117 Bacteria 2553
585 Ga0373953_0113752 3300035117 Bacteria 1146
586 Ga0373954_0013640 3300035118 Unclassified 3622
587 Ga0373954_0290062 3300035118 Unclassified 807
588 Ga0373956_0152447 3300035119 Bacteria 1088
589 Ga0373957_0031118 3300035120 Unclassified 1959
590 Ga0373957_0243233 3300035120 Unclassified 756
591 Ga0373955_0091603 3300035172 Unclassified 1733
592 Ga0373955_0174238 3300035172 Bacteria 1274
593 Ga0373924_0171221 3300035410 Unclassified 954
594 Ga0373924_0214838 3300035410 Unclassified 849
595 Ga0373935_0355573 3300035692 Bacteria 1045
596 Ga0373935_0584320 3300035692 Unclassified 816
597 Ga0373935_0662844 3300035692 Bacteria 766
598 Ga0373935_0787286 3300035692 Unclassified 702
599 Ga0373935_1160679 3300035692 Unclassified 575
600 Ga0373927_0006060 3300035695 Bacteria 8282
601 Ga0373927_0688799 3300035695 Unclassified 675
602 Ga0373933_0004065 3300035724 Bacteria 8058
603 Ga0373933_0057639 3300035724 Unclassified 2335
604 Ga0373933_0057903 3300035724 Bacteria 2330
605 Ga0373947_0605110 3300035725 Unclassified 747
606 Ga0373937_0009613 3300036401 Bacteria 8418
607 Ga0373937_0009984 3300036401 Bacteria 8277
608 Ga0373937_0037646 3300036401 Bacteria 4408
609 Ga0373937_0082697 3300036401 Unclassified 2971
610 Ga0373937_1109425 3300036401 Bacteria 740
611 Ga0373937_1421619 3300036401 Bacteria 641
612 Ga0373937_2013225 3300036401 Unclassified 524
613 Ga0373925_0024539 3300037068 Unclassified 4402
614 Ga0373925_0228248 3300037068 Bacteria 1488
615 Ga0373925_0381365 3300037068 Bacteria 1148
616 Ga0373925_0557302 3300037068 Bacteria 943
617 Ga0373925_0669582 3300037068 Unclassified 855
618 Ga0373925_0871908 3300037068 Unclassified 742
619 Ga0439448_0073438 3300042005 Unclassified 1141
620 Ga0466963_0900400 3300044694 Unclassified 623
621 Ga0451576_0632343 3300045051 Bacteria 1125
622 Ga0451576_1801825 3300045051 Bacteria 633
623 Ga0495592_0424862 3300046454 Bacteria 837
624 Ga0495603_0626003 3300046455 Unclassified 616
625 Ga0495629_0703775 3300046459 Unclassified 671
626 Ga0495580_0035641 3300046472 Bacteria 3577
627 Ga0495580_0072306 3300046472 Unclassified 2409
628 Ga0495580_0077318 3300046472 Bacteria 2321
629 Ga0495580_0098392 3300046472 Bacteria 2035
630 Ga0495580_0098823 3300046472 Unclassified 2030
631 Ga0495580_0720863 3300046472 Unclassified 651
632 Ga0495580_0813053 3300046472 Unclassified 605
633 Ga0495582_0049985 3300046473 Bacteria 2303
634 Ga0495582_0498249 3300046473 Unclassified 704
635 Ga0495639_0087558 3300046475 Unclassified 1458
636 Ga0495652_0118088 3300046529 Bacteria 2120
637 Ga0495652_0174695 3300046529 Unclassified 1655
638 Ga0495652_0396689 3300046529 Unclassified 978
639 Ga0495652_0694819 3300046529 Bacteria 685
640 Ga0495665_0074155 3300046531 Bacteria 1792
641 Ga0495665_0088050 3300046531 Bacteria 1632
642 Ga0495665_0368704 3300046531 Unclassified 730
643 Ga0495586_0577893 3300046535 Unclassified 649
644 Ga0495587_0016659 3300046536 Bacteria 4572
645 Ga0495587_0019030 3300046536 Bacteria 4255
646 Ga0495645_0263375 3300046543 Bacteria 1140
647 Ga0495645_0308725 3300046543 Unclassified 1031
648 Ga0495667_0081508 3300046559 Unclassified 2103
649 Ga0495667_0659922 3300046559 Unclassified 649
650 Ga0495634_0285539 3300046642 Unclassified 1001
651 Ga0495635_0460815 3300046663 Bacteria 840
652 Ga0495599_0013497 3300046678 Bacteria 5047
653 Ga0495646_0672169 3300046680 Unclassified 522
654 Ga0495658_0703085 3300046683 Unclassified 647
655 Ga0495613_0160780 3300046689 Unclassified 1598
656 Ga0495624_0570708 3300046690 Unclassified 675
657 Ga0495600_0448890 3300046809 Unclassified 798
658 Ga0495581_0789698 3300047315 Unclassified 545
659 Ga0495674_0804274 3300047319 Unclassified 731
660 Ga0495676_0312735 3300047321 Unclassified 1057
661 Ga0495680_0086942 3300047322 Bacteria 2352
662 Ga0495680_1066815 3300047322 Unclassified 512
663 Ga0495675_0513321 3300047444 Unclassified 687
664 Ga0495675_0641388 3300047444 Unclassified 599
665 Ga0495684_0218717 3300047471 Bacteria 1397
666 Ga0495684_0239159 3300047471 Bacteria 1325
667 Ga0495684_0380968 3300047471 Unclassified 995
668 Ga0495684_1063816 3300047471 Unclassified 510
669 Ga0495602_0182725 3300048088 Bacteria 1615
670 Ga0496112_0588996 3300048915 Bacteria 1044
671 Ga0496115_0213731 3300048918 Unclassified 1592
672 Ga0496115_0381539 3300048918 Bacteria 1146
673 Ga0501040_0776356 3300049576 Unclassified 693
674 Ga0501045_0443615 3300049824 Bacteria 965
675 nmdc:mga0qj67_253037_c1 3300050509 Bacteria 1429
676 nmdc:mga0n895_826430_c1 3300050512 Unclassified 915
677 nmdc:mga08x19_569754_c1 3300050514 Unclassified 802
678 Ga0495601_0382222 3300053077 Unclassified 914
679 Ga0495601_0633622 3300053077 Bacteria 685
680 Ga0495612_0253959 3300053078 Unclassified 782
681 Ga0495619_0630432 3300053085 Unclassified 732
682 Ga0495619_1060824 3300053085 Unclassified 540
683 Ga0500568_0002530 3300053139 Bacteria 10681
684 Ga0070683_100044761
685 Ga0070658_10504122
686 Ga0070658_10507206
687 Ga0070683_100003332
688 Ga0070683_100008730
689 Ga0070683_100083652
690 Ga0070683_100205020
691 Ga0070683_101256958
692 Ga0070683_101390237
693 Ga0070683_101558656
694 Ga0070690_100055311
695 Ga0070690_100088554
696 Ga0070690_101257727
697 Ga0068869_100261326
698 Ga0068869_101678241
699 Ga0070666_10005151
700 Ga0070666_10150217
701 Ga0070666_10714610
702 Ga0070680_100307720
703 Ga0070682_100793833
704 Ga0068868_100066589
705 Ga0068868_101735919
706 Ga0068868_101985779
707 Ga0068868_102017304
708 Ga0070660_100044150
709 Ga0070660_100075040
710 Ga0070660_100268720
711 Ga0070660_100439155
712 Ga0070689_100464250
713 Ga0070691_10003894
714 Ga0070687_100433053
715 Ga0070661_100054684
716 Ga0070661_100159037
717 Ga0070668_100735314
718 Ga0070671_100050798
719 Ga0070671_100280924
720 Ga0070674_100499941
721 Ga0070674_100527383
722 Ga0070673_100100446
723 Ga0070673_101261500
724 Ga0070659_100514037
725 Ga0070659_101084236
726 Ga0070667_100057276
727 Ga0070667_100068445
728 Ga0070667_100814696
729 Ga0070709_10131900
730 Ga0070709_10252884
731 Ga0070714_100205363
732 Ga0070713_100077747
733 Ga0070710_10733761
734 Ga0070711_100092531
735 Ga0070711_100133953
736 Ga0070711_100361982
737 Ga0070711_100393310
738 Ga0070711_100423746
739 Ga0070711_100470931
740 Ga0070708_100432561
741 Ga0070678_100303683
742 Ga0070678_100410974
743 Ga0070662_100251377
744 Ga0070681_10010982
745 Ga0070681_10016327
746 Ga0070681_10084888
747 Ga0070681_10098972
748 Ga0070681_10212122
749 Ga0070681_10506056
750 Ga0070681_11137552
751 Ga0068867_100016005
752 Ga0068867_100064553
753 Ga0068867_100430562
754 Ga0070698_101864810
755 Ga0070679_100001481
756 Ga0070679_100088268
757 Ga0070679_100606803
758 Ga0070679_100671305
759 Ga0070679_102125879
760 Ga0070684_100022083
761 Ga0070684_100024943
762 Ga0070684_100044644
763 Ga0070684_100051027
764 Ga0070684_100469666
765 Ga0070684_100550345
766 Ga0070684_100664249
767 Ga0070684_101134571
768 Ga0070697_100948128
769 Ga0068853_100096705
770 Ga0068853_100136080
771 Ga0068853_100320989
772 Ga0068853_100551170
773 Ga0068853_100551403
774 Ga0070672_100507894
775 Ga0070686_100588194
776 Ga0070686_101304841
777 Ga0070695_100686055
778 Ga0070696_101467751
779 Ga0070693_100038139
780 Ga0070665_100308259
781 Ga0070665_100561934
782 Ga0068855_100001548
783 Ga0068855_100004931
784 Ga0068855_100031062
785 Ga0068855_100051767
786 Ga0068855_100103694
787 Ga0068855_100176865
788 Ga0068855_100835672
789 Ga0070664_100138057
790 Ga0070664_100427195
791 Ga0070664_101065372
792 Ga0070664_101701431
793 Ga0068857_100001166
794 Ga0068857_100011546
795 Ga0068857_100016136
796 Ga0068857_100016150
797 Ga0068857_100024100
798 Ga0068857_100925308
799 Ga0068854_100311330
800 Ga0068854_100527431
801 Ga0068856_100000805
802 Ga0068856_100010939
803 Ga0068856_100049260
804 Ga0068856_100055744
805 Ga0068856_100079583
806 Ga0068856_100116638
807 Ga0068856_100289794
808 Ga0068856_100343510
809 Ga0068856_100572318
810 Ga0070702_101532725
811 Ga0068852_100006181
812 Ga0068852_100116044
813 Ga0068852_100154112
814 Ga0068852_100632300
815 Ga0068852_101707675
816 Ga0068852_101791909
817 Ga0068859_100073744
818 Ga0068859_100354731
819 Ga0068859_100608132
820 Ga0068859_100758204
821 Ga0068864_100011494
822 Ga0068864_100118007
823 Ga0068864_100300382
824 Ga0068864_100612961
825 Ga0068864_100768206
826 Ga0068866_10380429
827 Ga0068861_100559576
828 Ga0068863_100016712
829 Ga0068863_100027929
830 Ga0068863_100120438
831 Ga0068863_100176905
832 Ga0068863_100593242
833 Ga0068863_100806616
834 Ga0068863_101064035
835 Ga0068863_102500150
836 Ga0068858_100001679
837 Ga0068858_100005315
838 Ga0068858_100296067
839 Ga0068858_100577746
840 Ga0068858_101193513
841 Ga0068858_101200597
842 Ga0068860_100004901
843 Ga0068860_100033609
844 Ga0068860_100125702
845 Ga0068860_101321294
846 Ga0068860_102081528
847 Ga0068862_100997936
848 Ga0068862_102461146
849 Ga0070717_11595202
850 Ga0070715_10335926
851 Ga0070716_101056617
852 Ga0070716_101792409
853 Ga0097621_100035350
854 Ga0097621_100053093
855 Ga0097621_100101870
856 Ga0097621_100157928
857 Ga0097621_100162116
858 Ga0097621_100165539
859 Ga0097621_100818088
860 Ga0097621_102055714
861 Ga0097621_102056408
862 Ga0068871_100002393
863 Ga0068871_100007348
864 Ga0068871_100015684
865 Ga0068871_100033878
866 Ga0068871_100038403
867 Ga0068871_100294552
868 Ga0068871_100461607
869 Ga0075430_100159444
870 Ga0068865_100011315
871 Ga0068865_100036403
872 Ga0068865_100095379
873 Ga0075436_100291022
874 Ga0097620_100073744
875 Ga0097620_100354752
876 Ga0097620_100608199
877 Ga0097620_100758213
878 Ga0099794_10259935
879 Ga0105240_10000902
880 Ga0105240_10003336
881 Ga0105240_10097279
882 Ga0105240_10294936
883 Ga0105240_10426906
884 Ga0105240_10477589
885 Ga0105240_10611507
886 Ga0105240_10737970
887 Ga0105240_11637171
888 Ga0105245_10004892
889 Ga0105245_10006604
890 Ga0105245_10012603
891 Ga0105245_10012889
892 Ga0105245_10014159
893 Ga0105245_10025780
894 Ga0105245_10107741
895 Ga0105245_10118107
896 Ga0105245_10174792
897 Ga0105245_10252113
898 Ga0105245_10295679
899 Ga0105245_10546834
900 Ga0105245_11737575
901 Ga0105245_11742760
902 Ga0105245_12038143
903 Ga0105247_10041721
904 Ga0105247_10217408
905 Ga0105247_10693778
906 Ga0105243_10055986
907 Ga0105243_10077523
908 Ga0105243_10203412
909 Ga0105243_10875395
910 Ga0105243_11073378
911 Ga0105243_11779670
912 Ga0105243_12702808
913 Ga0105241_10026406
914 Ga0105241_10087456
915 Ga0105241_10089009
916 Ga0105241_10109637
917 Ga0105241_10117801
918 Ga0105241_10266909
919 Ga0105241_10268079
920 Ga0105241_10353698
921 Ga0105241_10848087
922 Ga0105241_10892132
923 Ga0105241_10954598
924 Ga0105241_11384739
925 Ga0105242_10005358
926 Ga0105242_10007591
927 Ga0105242_10010444
928 Ga0105242_10037585
929 Ga0105242_10054985
930 Ga0105242_10145417
931 Ga0105242_10199854
932 Ga0105242_10422704
933 Ga0105242_10865536
934 Ga0105242_10963474
935 Ga0105248_10013594
936 Ga0105248_10028125
937 Ga0105248_10043727
938 Ga0105248_10050640
939 Ga0105248_10057566
940 Ga0105248_10240442
941 Ga0105248_10444410
942 Ga0105248_10445791
943 Ga0105248_10959812
944 Ga0105248_10995698
945 Ga0105248_11365609
946 Ga0105248_11384375
947 Ga0105237_10002574
948 Ga0105237_10010399
949 Ga0105237_10078645
950 Ga0105237_10106453
951 Ga0105237_10539953
952 Ga0105237_10967871
953 Ga0105237_11014069
954 Ga0105238_10002330
955 Ga0105238_10005599
956 Ga0105238_10007323
957 Ga0105238_10045201
958 Ga0105238_10079332
959 Ga0105238_10081446
960 Ga0105238_10103063
961 Ga0105238_10142322
962 Ga0105238_10191073
963 Ga0105238_10220047
964 Ga0105238_10257952
965 Ga0105238_10702016
966 Ga0105249_10047300
967 Ga0105249_10092764
968 Ga0105249_10166426
969 Ga0105249_10922264
970 Ga0105249_11207625
971 Ga0105249_11936705
972 Ga0105239_10002707
973 Ga0105239_10010040
974 Ga0105239_10014444
975 Ga0105239_10148463
976 Ga0105239_10572945
977 Ga0105239_10876768
978 Ga0105246_10035862
979 Ga0105246_10048356
980 Ga0105246_10311615
981 Ga0105246_11419368
982 Ga0105246_11969421
983 Ga0157371_10741259
984 Ga0157370_10003445
985 Ga0157370_10007799
986 Ga0157370_10037406
987 Ga0157370_10042165
988 Ga0157370_10210846
989 Ga0157369_10018664
990 Ga0157369_10020006
991 Ga0157369_10034141
992 Ga0157369_10114163
993 Ga0157369_10170631
994 Ga0157369_10824633
995 Ga0157369_11104501
996 Ga0157374_10021267
997 Ga0157374_10065363
998 Ga0157374_10076271
999 Ga0157374_10170185
1000 Ga0157374_10306692
1001 Ga0157374_10467433
1002 Ga0157374_10878503
1003 Ga0157374_12586730
1004 Ga0157378_10009401
1005 Ga0157378_10009797
1006 Ga0157378_10439128
1007 Ga0157378_10476488
1008 Ga0157378_10564519
1009 Ga0157378_11244303
1010 Ga0157378_12812948
1011 Ga0163162_10079147
1012 Ga0163162_10100848
1013 Ga0163162_10574467
1014 Ga0163162_10747241
1015 Ga0163162_10776139
1016 Ga0157372_10011100
1017 Ga0157372_10033562
1018 Ga0157372_10139669
1019 Ga0157372_10640085
1020 Ga0157372_12543205
1021 Ga0157375_10013161
1022 Ga0157375_10013936
1023 Ga0157375_10032649
1024 Ga0157375_10252761
1025 Ga0157375_10321639
1026 Ga0163163_10004862
1027 Ga0163163_10020608
1028 Ga0163163_10025231
1029 Ga0163163_10142584
1030 Ga0163163_10221650
1031 Ga0163163_10314698
1032 Ga0163163_10662449
1033 Ga0163163_11288034
1034 Ga0157380_11250760
1035 Ga0157377_10510043
1036 Ga0157377_11131466
1037 Ga0157379_10017491
1038 Ga0157379_10105485
1039 Ga0157379_10768123
1040 Ga0157376_10058885
1041 Ga0157376_10357485
1042 Ga0157376_10602797
1043 Ga0157376_10986358
1044 Ga0157376_12998586
1045 Ga0182007_10253188
1046 Ga0163161_11317434
1047 Ga0207697_10123622
1048 Ga0207692_10257467
1049 Ga0207642_10333976
1050 Ga0207642_10645969
1051 Ga0207710_10373404
1052 Ga0207680_10510924
1053 Ga0207685_10774129
1054 Ga0207705_10106917
1055 Ga0207705_10412777
1056 Ga0207654_10012234
1057 Ga0207654_10074589
1058 Ga0207654_10152255
1059 Ga0207654_10172515
1060 Ga0207654_10586279
1061 Ga0207654_10750961
1062 Ga0207707_10000744
1063 Ga0207707_10007810
1064 Ga0207707_10016349
1065 Ga0207707_10087233
1066 Ga0207707_10109190
1067 Ga0207707_10371090
1068 Ga0207695_10003011
1069 Ga0207695_10010314
1070 Ga0207695_10015585
1071 Ga0207695_10027113
1072 Ga0207695_10033326
1073 Ga0207695_10188447
1074 Ga0207695_10392741
1075 Ga0207671_10011172
1076 Ga0207671_10187048
1077 Ga0207663_10151276
1078 Ga0207663_10168720
1079 Ga0207663_10170687
1080 Ga0207663_10385294
1081 Ga0207663_11516890
1082 Ga0207662_10267186
1083 Ga0207657_10007491
1084 Ga0207657_10077384
1085 Ga0207657_10216333
1086 Ga0207649_10062779
1087 Ga0207649_11327918
1088 Ga0207652_10004664
1089 Ga0207652_10034897
1090 Ga0207652_10070113
1091 Ga0207652_10548652
1092 Ga0207652_10661857
1093 Ga0207652_10959707
1094 Ga0207681_11641345
1095 Ga0207694_10001024
1096 Ga0207694_10003038
1097 Ga0207694_10007367
1098 Ga0207694_10009550
1099 Ga0207694_10029999
1100 Ga0207694_10068475
1101 Ga0207694_10144600
1102 Ga0207694_10168173
1103 Ga0207694_10178218
1104 Ga0207687_10001024
1105 Ga0207687_10005986
1106 Ga0207687_10011261
1107 Ga0207687_10022491
1108 Ga0207687_10054401
1109 Ga0207687_10117439
1110 Ga0207687_10245208
1111 Ga0207687_10807211
1112 Ga0207687_10936890
1113 Ga0207700_10003830
1114 Ga0207700_10010156
1115 Ga0207700_10505501
1116 Ga0207664_10290875
1117 Ga0207644_10009905
1118 Ga0207644_10213421
1119 Ga0207690_10010120
1120 Ga0207690_10046758
1121 Ga0207706_10099144
1122 Ga0207686_10019609
1123 Ga0207686_10034991
1124 Ga0207686_10136398
1125 Ga0207686_10337426
1126 Ga0207686_10340961
1127 Ga0207686_10501919
1128 Ga0207686_11658898
1129 Ga0207686_11662571
1130 Ga0207709_10137437
1131 Ga0207709_10253883
1132 Ga0207709_11185487
1133 Ga0207709_11226989
1134 Ga0207709_11491900
1135 Ga0207670_10336593
1136 Ga0207669_10508778
1137 Ga0207669_11582515
1138 Ga0207704_10004284
1139 Ga0207704_10017892
1140 Ga0207704_10037431
1141 Ga0207704_11387581
1142 Ga0207665_10961895
1143 Ga0207691_10236200
1144 Ga0207711_10006913
1145 Ga0207711_10026639
1146 Ga0207711_10027844
1147 Ga0207711_10109520
1148 Ga0207711_10362776
1149 Ga0207711_10391406
1150 Ga0207711_10758456
1151 Ga0207711_11041816
1152 Ga0207711_11907060
1153 Ga0207689_10123497
1154 Ga0207689_10141712
1155 Ga0207689_10585674
1156 Ga0207689_10660010
1157 Ga0207689_11402602
1158 Ga0207661_10001824
1159 Ga0207661_10003946
1160 Ga0207661_10185413
1161 Ga0207661_10195352
1162 Ga0207661_10317671
1163 Ga0207661_10429209
1164 Ga0207661_10644603
1165 Ga0207679_10076373
1166 Ga0207679_10272296
1167 Ga0207679_10442901
1168 Ga0207667_10001895
1169 Ga0207667_10002299
1170 Ga0207667_10004489
1171 Ga0207667_10049522
1172 Ga0207667_10187056
1173 Ga0207667_10329498
1174 Ga0207667_10763835
1175 Ga0207667_11130214
1176 Ga0207651_10021247
1177 Ga0207712_10075582
1178 Ga0207712_10772098
1179 Ga0207712_11133342
1180 Ga0207668_10319320
1181 Ga0207640_10030039
1182 Ga0207658_10164453
1183 Ga0207658_10375712
1184 Ga0207658_11443910
1185 Ga0207677_10151705
1186 Ga0207677_10259606
1187 Ga0207677_11306909
1188 Ga0207677_11383434
1189 Ga0207677_11433528
1190 Ga0207703_10003146
1191 Ga0207703_10020197
1192 Ga0207703_10096999
1193 Ga0207703_10826758
1194 Ga0207703_10918348
1195 Ga0207703_12408995
1196 Ga0207639_10070001
1197 Ga0207639_10105016
1198 Ga0207639_10453922
1199 Ga0207639_10479625
1200 Ga0207639_10625185
1201 Ga0207639_10767445
1202 Ga0207708_10453736
1203 Ga0207702_10002419
1204 Ga0207702_10026940
1205 Ga0207702_10038047
1206 Ga0207702_10061524
1207 Ga0207702_10191507
1208 Ga0207702_10243145
1209 Ga0207702_10351809
1210 Ga0207702_10660568
1211 Ga0207641_10003019
1212 Ga0207641_10399007
1213 Ga0207641_10555725
1214 Ga0207641_10584533
1215 Ga0207641_10634655
1216 Ga0207641_11715421
1217 Ga0207648_10003227
1218 Ga0207648_10295784
1219 Ga0207648_11373084
1220 Ga0207676_10090402
1221 Ga0207676_10148459
1222 Ga0207676_10267341
1223 Ga0207676_10497763
1224 Ga0207676_11327412
1225 Ga0207674_10002011
1226 Ga0207674_10005710
1227 Ga0207674_10016193
1228 Ga0207674_10018723
1229 Ga0207674_10024250
1230 Ga0207674_10180316
1231 Ga0207675_100421629
1232 Ga0207683_10348513
1233 Ga0207683_10444193
1234 Ga0207698_10015556
1235 Ga0207698_10019341
1236 Ga0207698_10177944
1237 Ga0207698_10780053
1238 Ga0207698_12069339
1239 Ga0207698_12569735
1240 Ga0268266_10027306
1241 Ga0268266_10252324
1242 Ga0268265_10994980
1243 Ga0268264_10019626
1244 Ga0268264_10038788
1245 Ga0268264_10165130
1246 Ga0268264_10193659
1247 Ga0268264_10360690
1248 Ga0268264_11560097
1249 Ga0265338_10102948
1250 Ga0265338_10525315
1251 Ga0265329_10242115
1252 Ga0265340_10131748
1253 Ga0265339_10461288
1254 Ga0265331_10356683
1255 Ga0265331_10501522
1256 Ga0265327_10443110
1257 Ga0265313_10104209
1258 Ga0265314_10001081
1259 Ga0265314_10003587
1260 Ga0265342_10428248
1261 Ga0373934_0011468
1262 Ga0373934_0066008
1263 Ga0373934_0186372
1264 Ga0373944_0049324
1265 Ga0373944_0364272
1266 Ga0373923_0314289
1267 Ga0373953_0018971
1268 Ga0373953_0113752
1269 Ga0373954_0013640
1270 Ga0373954_0290062
1271 Ga0373956_0152447
1272 Ga0373957_0031118
1273 Ga0373957_0243233
1274 Ga0373955_0091603
1275 Ga0373955_0174238
1276 Ga0373924_0171221
1277 Ga0373924_0214838
1278 Ga0373935_0355573
1279 Ga0373935_0584320
1280 Ga0373935_0662844
1281 Ga0373935_0787286
1282 Ga0373935_1160679
1283 Ga0373927_0006060
1284 Ga0373927_0688799
1285 Ga0373933_0004065
1286 Ga0373933_0057639
1287 Ga0373933_0057903
1288 Ga0373947_0605110
1289 Ga0373937_0009613
1290 Ga0373937_0009984
1291 Ga0373937_0037646
1292 Ga0373937_0082697
1293 Ga0373937_1109425
1294 Ga0373937_1421619
1295 Ga0373937_2013225
1296 Ga0373925_0024539
1297 Ga0373925_0228248
1298 Ga0373925_0381365
1299 Ga0373925_0557302
1300 Ga0373925_0669582
1301 Ga0373925_0871908
1302 Ga0439448_0073438
1303 Ga0466963_0900400
1304 Ga0451576_0632343
1305 Ga0451576_1801825
1306 Ga0495592_0424862
1307 Ga0495603_0626003
1308 Ga0495629_0703775
1309 Ga0495580_0035641
1310 Ga0495580_0072306
1311 Ga0495580_0077318
1312 Ga0495580_0098392
1313 Ga0495580_0098823
1314 Ga0495580_0720863
1315 Ga0495580_0813053
1316 Ga0495582_0049985
1317 Ga0495582_0498249
1318 Ga0495639_0087558
1319 Ga0495652_0118088
1320 Ga0495652_0174695
1321 Ga0495652_0396689
1322 Ga0495652_0694819
1323 Ga0495665_0074155
1324 Ga0495665_0088050
1325 Ga0495665_0368704
1326 Ga0495586_0577893
1327 Ga0495587_0016659
1328 Ga0495587_0019030
1329 Ga0495645_0263375
1330 Ga0495645_0308725
1331 Ga0495667_0081508
1332 Ga0495667_0659922
1333 Ga0495634_0285539
1334 Ga0495635_0460815
1335 Ga0495599_0013497
1336 Ga0495646_0672169
1337 Ga0495658_0703085
1338 Ga0495613_0160780
1339 Ga0495624_0570708
1340 Ga0495600_0448890
1341 Ga0495581_0789698
1342 Ga0495674_0804274
1343 Ga0495676_0312735
1344 Ga0495680_0086942
1345 Ga0495680_1066815
1346 Ga0495675_0513321
1347 Ga0495675_0641388
1348 Ga0495684_0218717
1349 Ga0495684_0239159
1350 Ga0495684_0380968
1351 Ga0495684_1063816
1352 Ga0495602_0182725
1353 Ga0496112_0588996
1354 Ga0496115_0213731
1355 Ga0496115_0381539
1356 Ga0501040_0776356
1357 Ga0501045_0443615
1358 nmdc:mga0qj67_253037_c1
1359 nmdc:mga0n895_826430_c1
1360 nmdc:mga08x19_569754_c1
1361 Ga0495601_0382222
1362 Ga0495601_0633622
1363 Ga0495612_0253959
1364 Ga0495619_0630432
1365 Ga0495619_1060824
1366 Ga0500568_0002530

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.7705 12 84
2y9j-assembly1.cif.gz_Y three-dimensional model of salmonella's needle complex at subnanometer resolution 0.7547 14 87
3u0o-assembly1.cif.gz_A the crystal structure of selenophosphate synthetase from e. coli 0.7498 55 83
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.7496 12 84
1yj7-assembly1.cif.gz_A crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.7478 12 87
ID Description Score Start End Superfamily
af_P0AD21_4_109_2.60.40.1130 Mainly Beta;Sandwich;Immunoglobulin-like;Rab geranylgeranyltransferase alpha-subunit, insert domain 0.7926 23 81 2.60.40.1130
1yj7B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.7432 14 87 3.30.70.1530
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7294 14 77 3.30.70.2350
2hfvA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.713 13 83 3.30.70.790
1yj7B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.6689 14 87 3.30.70.1530
ID Description Score Start End GO Terms
AF-A0A522BLE3-F1-model_v4 DUF2007 domain-containing protein 0.8842 10 79
AF-A0A3D3XPD8-F1-model_v4 DUF2007 domain-containing protein 0.8737 11 79
AF-Q9WY53-F1-model_v4 DUF2007 domain-containing protein 0.8671 12 79
AF-A0A7C5C5T0-F1-model_v4 DUF2007 domain-containing protein 0.8489 12 79
AF-A0A3D1ATM7-F1-model_v4 DUF2007 domain-containing protein 0.8476 2 86

Map