F474956
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 213 | 1366 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100044761|Ga0070683_1000447613 |
| Length | 100 |
| Sequence | MRSWPASEAEDPPVLREPDYFEDRELSLIYVAKKLKEALALEKLLTDSGLDYLVEPDRYSGGIIFRSERIGAFFYVAPEDEEKARTTMRSGGYKPYQASM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 165 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 174 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 205 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 0.44 |
| Rhizosphere | 99.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 42.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100044761 | 3300005329 | Unclassified | 4083 |
| 2 | Ga0070658_10504122 | 3300005327 | Unclassified | 1046 |
| 3 | Ga0070658_10507206 | 3300005327 | Unclassified | 1042 |
| 4 | Ga0070683_100003332 | 3300005329 | Bacteria | 12995 |
| 5 | Ga0070683_100008730 | 3300005329 | Bacteria | 8617 |
| 6 | Ga0070683_100083652 | 3300005329 | Bacteria | 2989 |
| 7 | Ga0070683_100205020 | 3300005329 | Bacteria | 1873 |
| 8 | Ga0070683_101256958 | 3300005329 | Unclassified | 712 |
| 9 | Ga0070683_101390237 | 3300005329 | Bacteria | 675 |
| 10 | Ga0070683_101558656 | 3300005329 | Unclassified | 635 |
| 11 | Ga0070690_100055311 | 3300005330 | Unclassified | 2542 |
| 12 | Ga0070690_100088554 | 3300005330 | Bacteria | 2035 |
| 13 | Ga0070690_101257727 | 3300005330 | Unclassified | 592 |
| 14 | Ga0068869_100261326 | 3300005334 | Unclassified | 1386 |
| 15 | Ga0068869_101678241 | 3300005334 | Unclassified | 567 |
| 16 | Ga0070666_10005151 | 3300005335 | Bacteria | 8001 |
| 17 | Ga0070666_10150217 | 3300005335 | Bacteria | 1625 |
| 18 | Ga0070666_10714610 | 3300005335 | Bacteria | 735 |
| 19 | Ga0070680_100307720 | 3300005336 | Bacteria | 1344 |
| 20 | Ga0070682_100793833 | 3300005337 | Bacteria | 768 |
| 21 | Ga0068868_100066589 | 3300005338 | Unclassified | 2864 |
| 22 | Ga0068868_101735919 | 3300005338 | Bacteria | 589 |
| 23 | Ga0068868_101985779 | 3300005338 | Unclassified | 552 |
| 24 | Ga0068868_102017304 | 3300005338 | Unclassified | 548 |
| 25 | Ga0070660_100044150 | 3300005339 | Bacteria | 3408 |
| 26 | Ga0070660_100075040 | 3300005339 | Bacteria | 2647 |
| 27 | Ga0070660_100268720 | 3300005339 | Bacteria | 1393 |
| 28 | Ga0070660_100439155 | 3300005339 | Unclassified | 1082 |
| 29 | Ga0070689_100464250 | 3300005340 | Bacteria | 1079 |
| 30 | Ga0070691_10003894 | 3300005341 | Bacteria | 6751 |
| 31 | Ga0070687_100433053 | 3300005343 | Unclassified | 870 |
| 32 | Ga0070661_100054684 | 3300005344 | Bacteria | 2923 |
| 33 | Ga0070661_100159037 | 3300005344 | Bacteria | 1710 |
| 34 | Ga0070668_100735314 | 3300005347 | Unclassified | 872 |
| 35 | Ga0070671_100050798 | 3300005355 | Bacteria | 3449 |
| 36 | Ga0070671_100280924 | 3300005355 | Bacteria | 1416 |
| 37 | Ga0070674_100499941 | 3300005356 | Unclassified | 1012 |
| 38 | Ga0070674_100527383 | 3300005356 | Unclassified | 987 |
| 39 | Ga0070673_100100446 | 3300005364 | Bacteria | 2382 |
| 40 | Ga0070673_101261500 | 3300005364 | Unclassified | 693 |
| 41 | Ga0070659_100514037 | 3300005366 | Bacteria | 1022 |
| 42 | Ga0070659_101084236 | 3300005366 | Bacteria | 705 |
| 43 | Ga0070667_100057276 | 3300005367 | Bacteria | 3293 |
| 44 | Ga0070667_100068445 | 3300005367 | Bacteria | 3021 |
| 45 | Ga0070667_100814696 | 3300005367 | Bacteria | 867 |
| 46 | Ga0070709_10131900 | 3300005434 | Bacteria | 1707 |
| 47 | Ga0070709_10252884 | 3300005434 | Unclassified | 1270 |
| 48 | Ga0070714_100205363 | 3300005435 | Bacteria | 1804 |
| 49 | Ga0070713_100077747 | 3300005436 | Bacteria | 2822 |
| 50 | Ga0070710_10733761 | 3300005437 | Unclassified | 700 |
| 51 | Ga0070711_100092531 | 3300005439 | Bacteria | 2182 |
| 52 | Ga0070711_100133953 | 3300005439 | Bacteria | 1849 |
| 53 | Ga0070711_100361982 | 3300005439 | Bacteria | 1168 |
| 54 | Ga0070711_100393310 | 3300005439 | Unclassified | 1123 |
| 55 | Ga0070711_100423746 | 3300005439 | Bacteria | 1085 |
| 56 | Ga0070711_100470931 | 3300005439 | Unclassified | 1031 |
| 57 | Ga0070708_100432561 | 3300005445 | Bacteria | 1241 |
| 58 | Ga0070678_100303683 | 3300005456 | Bacteria | 1357 |
| 59 | Ga0070678_100410974 | 3300005456 | Unclassified | 1178 |
| 60 | Ga0070662_100251377 | 3300005457 | Bacteria | 1421 |
| 61 | Ga0070681_10010982 | 3300005458 | Bacteria | 8952 |
| 62 | Ga0070681_10016327 | 3300005458 | Bacteria | 7411 |
| 63 | Ga0070681_10084888 | 3300005458 | Unclassified | 3119 |
| 64 | Ga0070681_10098972 | 3300005458 | Bacteria | 2862 |
| 65 | Ga0070681_10212122 | 3300005458 | Bacteria | 1852 |
| 66 | Ga0070681_10506056 | 3300005458 | Unclassified | 1121 |
| 67 | Ga0070681_11137552 | 3300005458 | Unclassified | 702 |
| 68 | Ga0068867_100016005 | 3300005459 | Bacteria | 5325 |
| 69 | Ga0068867_100064553 | 3300005459 | Unclassified | 2723 |
| 70 | Ga0068867_100430562 | 3300005459 | Bacteria | 1120 |
| 71 | Ga0070698_101864810 | 3300005471 | Unclassified | 554 |
| 72 | Ga0070679_100001481 | 3300005530 | Bacteria | 20822 |
| 73 | Ga0070679_100088268 | 3300005530 | Bacteria | 3088 |
| 74 | Ga0070679_100606803 | 3300005530 | Unclassified | 1037 |
| 75 | Ga0070679_100671305 | 3300005530 | Unclassified | 979 |
| 76 | Ga0070679_102125879 | 3300005530 | Unclassified | 511 |
| 77 | Ga0070684_100022083 | 3300005535 | Bacteria | 5303 |
| 78 | Ga0070684_100024943 | 3300005535 | Bacteria | 5020 |
| 79 | Ga0070684_100044644 | 3300005535 | Bacteria | 3834 |
| 80 | Ga0070684_100051027 | 3300005535 | Bacteria | 3594 |
| 81 | Ga0070684_100469666 | 3300005535 | Bacteria | 1164 |
| 82 | Ga0070684_100550345 | 3300005535 | Unclassified | 1071 |
| 83 | Ga0070684_100664249 | 3300005535 | Unclassified | 971 |
| 84 | Ga0070684_101134571 | 3300005535 | Bacteria | 735 |
| 85 | Ga0070697_100948128 | 3300005536 | Unclassified | 764 |
| 86 | Ga0068853_100096705 | 3300005539 | Bacteria | 2606 |
| 87 | Ga0068853_100136080 | 3300005539 | Unclassified | 2203 |
| 88 | Ga0068853_100320989 | 3300005539 | Bacteria | 1436 |
| 89 | Ga0068853_100551170 | 3300005539 | Bacteria | 1092 |
| 90 | Ga0068853_100551403 | 3300005539 | Unclassified | 1092 |
| 91 | Ga0070672_100507894 | 3300005543 | Unclassified | 1043 |
| 92 | Ga0070686_100588194 | 3300005544 | Unclassified | 875 |
| 93 | Ga0070686_101304841 | 3300005544 | Unclassified | 606 |
| 94 | Ga0070695_100686055 | 3300005545 | Unclassified | 812 |
| 95 | Ga0070696_101467751 | 3300005546 | Bacteria | 583 |
| 96 | Ga0070693_100038139 | 3300005547 | Unclassified | 2684 |
| 97 | Ga0070665_100308259 | 3300005548 | Unclassified | 1586 |
| 98 | Ga0070665_100561934 | 3300005548 | Bacteria | 1153 |
| 99 | Ga0068855_100001548 | 3300005563 | Bacteria | 28938 |
| 100 | Ga0068855_100004931 | 3300005563 | Bacteria | 16277 |
| 101 | Ga0068855_100031062 | 3300005563 | Bacteria | 6382 |
| 102 | Ga0068855_100051767 | 3300005563 | Unclassified | 4836 |
| 103 | Ga0068855_100103694 | 3300005563 | Bacteria | 3272 |
| 104 | Ga0068855_100176865 | 3300005563 | Bacteria | 2414 |
| 105 | Ga0068855_100835672 | 3300005563 | Unclassified | 977 |
| 106 | Ga0070664_100138057 | 3300005564 | Bacteria | 2145 |
| 107 | Ga0070664_100427195 | 3300005564 | Bacteria | 1214 |
| 108 | Ga0070664_101065372 | 3300005564 | Unclassified | 761 |
| 109 | Ga0070664_101701431 | 3300005564 | Unclassified | 598 |
| 110 | Ga0068857_100001166 | 3300005577 | Bacteria | 20488 |
| 111 | Ga0068857_100011546 | 3300005577 | Bacteria | 7685 |
| 112 | Ga0068857_100016136 | 3300005577 | Bacteria | 6542 |
| 113 | Ga0068857_100016150 | 3300005577 | Bacteria | 6539 |
| 114 | Ga0068857_100024100 | 3300005577 | Bacteria | 5357 |
| 115 | Ga0068857_100925308 | 3300005577 | Unclassified | 837 |
| 116 | Ga0068854_100311330 | 3300005578 | Bacteria | 1277 |
| 117 | Ga0068854_100527431 | 3300005578 | Bacteria | 998 |
| 118 | Ga0068856_100000805 | 3300005614 | Bacteria | 33867 |
| 119 | Ga0068856_100010939 | 3300005614 | Bacteria | 8804 |
| 120 | Ga0068856_100049260 | 3300005614 | Bacteria | 4152 |
| 121 | Ga0068856_100055744 | 3300005614 | Bacteria | 3900 |
| 122 | Ga0068856_100079583 | 3300005614 | Bacteria | 3250 |
| 123 | Ga0068856_100116638 | 3300005614 | Bacteria | 2670 |
| 124 | Ga0068856_100289794 | 3300005614 | Bacteria | 1654 |
| 125 | Ga0068856_100343510 | 3300005614 | Unclassified | 1511 |
| 126 | Ga0068856_100572318 | 3300005614 | Unclassified | 1151 |
| 127 | Ga0070702_101532725 | 3300005615 | Unclassified | 549 |
| 128 | Ga0068852_100006181 | 3300005616 | Bacteria | 8637 |
| 129 | Ga0068852_100116044 | 3300005616 | Bacteria | 2442 |
| 130 | Ga0068852_100154112 | 3300005616 | Unclassified | 2139 |
| 131 | Ga0068852_100632300 | 3300005616 | Unclassified | 1077 |
| 132 | Ga0068852_101707675 | 3300005616 | Unclassified | 652 |
| 133 | Ga0068852_101791909 | 3300005616 | Bacteria | 636 |
| 134 | Ga0068859_100073744 | 3300005617 | Bacteria | 3451 |
| 135 | Ga0068859_100354731 | 3300005617 | Bacteria | 1561 |
| 136 | Ga0068859_100608132 | 3300005617 | Bacteria | 1186 |
| 137 | Ga0068859_100758204 | 3300005617 | Unclassified | 1059 |
| 138 | Ga0068864_100011494 | 3300005618 | Bacteria | 7312 |
| 139 | Ga0068864_100118007 | 3300005618 | Bacteria | 2369 |
| 140 | Ga0068864_100300382 | 3300005618 | Bacteria | 1503 |
| 141 | Ga0068864_100612961 | 3300005618 | Bacteria | 1057 |
| 142 | Ga0068864_100768206 | 3300005618 | Unclassified | 945 |
| 143 | Ga0068866_10380429 | 3300005718 | Unclassified | 905 |
| 144 | Ga0068861_100559576 | 3300005719 | Unclassified | 1043 |
| 145 | Ga0068863_100016712 | 3300005841 | Bacteria | 7040 |
| 146 | Ga0068863_100027929 | 3300005841 | Bacteria | 5385 |
| 147 | Ga0068863_100120438 | 3300005841 | Bacteria | 2502 |
| 148 | Ga0068863_100176905 | 3300005841 | Unclassified | 2048 |
| 149 | Ga0068863_100593242 | 3300005841 | Unclassified | 1096 |
| 150 | Ga0068863_100806616 | 3300005841 | Bacteria | 936 |
| 151 | Ga0068863_101064035 | 3300005841 | Unclassified | 813 |
| 152 | Ga0068863_102500150 | 3300005841 | Unclassified | 526 |
| 153 | Ga0068858_100001679 | 3300005842 | Bacteria | 22639 |
| 154 | Ga0068858_100005315 | 3300005842 | Bacteria | 12622 |
| 155 | Ga0068858_100296067 | 3300005842 | Bacteria | 1543 |
| 156 | Ga0068858_100577746 | 3300005842 | Bacteria | 1089 |
| 157 | Ga0068858_101193513 | 3300005842 | Unclassified | 748 |
| 158 | Ga0068858_101200597 | 3300005842 | Unclassified | 746 |
| 159 | Ga0068860_100004901 | 3300005843 | Bacteria | 13641 |
| 160 | Ga0068860_100033609 | 3300005843 | Bacteria | 4920 |
| 161 | Ga0068860_100125702 | 3300005843 | Unclassified | 2458 |
| 162 | Ga0068860_101321294 | 3300005843 | Bacteria | 742 |
| 163 | Ga0068860_102081528 | 3300005843 | Unclassified | 589 |
| 164 | Ga0068862_100997936 | 3300005844 | Bacteria | 828 |
| 165 | Ga0068862_102461146 | 3300005844 | Unclassified | 532 |
| 166 | Ga0070717_11595202 | 3300006028 | Unclassified | 591 |
| 167 | Ga0070715_10335926 | 3300006163 | Bacteria | 820 |
| 168 | Ga0070716_101056617 | 3300006173 | Unclassified | 645 |
| 169 | Ga0070716_101792409 | 3300006173 | Unclassified | 508 |
| 170 | Ga0097621_100035350 | 3300006237 | Bacteria | 3992 |
| 171 | Ga0097621_100053093 | 3300006237 | Bacteria | 3303 |
| 172 | Ga0097621_100101870 | 3300006237 | Bacteria | 2417 |
| 173 | Ga0097621_100157928 | 3300006237 | Bacteria | 1948 |
| 174 | Ga0097621_100162116 | 3300006237 | Unclassified | 1923 |
| 175 | Ga0097621_100165539 | 3300006237 | Unclassified | 1903 |
| 176 | Ga0097621_100818088 | 3300006237 | Unclassified | 864 |
| 177 | Ga0097621_102055714 | 3300006237 | Unclassified | 546 |
| 178 | Ga0097621_102056408 | 3300006237 | Unclassified | 546 |
| 179 | Ga0068871_100002393 | 3300006358 | Bacteria | 12791 |
| 180 | Ga0068871_100007348 | 3300006358 | Bacteria | 7861 |
| 181 | Ga0068871_100015684 | 3300006358 | Bacteria | 5682 |
| 182 | Ga0068871_100033878 | 3300006358 | Bacteria | 4047 |
| 183 | Ga0068871_100038403 | 3300006358 | Bacteria | 3824 |
| 184 | Ga0068871_100294552 | 3300006358 | Bacteria | 1423 |
| 185 | Ga0068871_100461607 | 3300006358 | Bacteria | 1140 |
| 186 | Ga0075430_100159444 | 3300006846 | Unclassified | 1878 |
| 187 | Ga0068865_100011315 | 3300006881 | Bacteria | 5579 |
| 188 | Ga0068865_100036403 | 3300006881 | Bacteria | 3318 |
| 189 | Ga0068865_100095379 | 3300006881 | Unclassified | 2167 |
| 190 | Ga0075436_100291022 | 3300006914 | Unclassified | 1169 |
| 191 | Ga0097620_100073744 | 3300006931 | Bacteria | 3451 |
| 192 | Ga0097620_100354752 | 3300006931 | Bacteria | 1561 |
| 193 | Ga0097620_100608199 | 3300006931 | Bacteria | 1186 |
| 194 | Ga0097620_100758213 | 3300006931 | Unclassified | 1059 |
| 195 | Ga0099794_10259935 | 3300007265 | Unclassified | 896 |
| 196 | Ga0105240_10000902 | 3300009093 | Bacteria | 53015 |
| 197 | Ga0105240_10003336 | 3300009093 | Bacteria | 24993 |
| 198 | Ga0105240_10097279 | 3300009093 | Unclassified | 3587 |
| 199 | Ga0105240_10294936 | 3300009093 | Bacteria | 1857 |
| 200 | Ga0105240_10426906 | 3300009093 | Unclassified | 1488 |
| 201 | Ga0105240_10477589 | 3300009093 | Bacteria | 1390 |
| 202 | Ga0105240_10611507 | 3300009093 | Unclassified | 1199 |
| 203 | Ga0105240_10737970 | 3300009093 | Bacteria | 1072 |
| 204 | Ga0105240_11637171 | 3300009093 | Unclassified | 673 |
| 205 | Ga0105245_10004892 | 3300009098 | Bacteria | 11784 |
| 206 | Ga0105245_10006604 | 3300009098 | Bacteria | 10184 |
| 207 | Ga0105245_10012603 | 3300009098 | Bacteria | 7360 |
| 208 | Ga0105245_10012889 | 3300009098 | Bacteria | 7288 |
| 209 | Ga0105245_10014159 | 3300009098 | Bacteria | 6952 |
| 210 | Ga0105245_10025780 | 3300009098 | Bacteria | 5170 |
| 211 | Ga0105245_10107741 | 3300009098 | Bacteria | 2587 |
| 212 | Ga0105245_10118107 | 3300009098 | Bacteria | 2474 |
| 213 | Ga0105245_10174792 | 3300009098 | Bacteria | 2047 |
| 214 | Ga0105245_10252113 | 3300009098 | Bacteria | 1715 |
| 215 | Ga0105245_10295679 | 3300009098 | Bacteria | 1587 |
| 216 | Ga0105245_10546834 | 3300009098 | Unclassified | 1179 |
| 217 | Ga0105245_11737575 | 3300009098 | Unclassified | 676 |
| 218 | Ga0105245_11742760 | 3300009098 | Unclassified | 675 |
| 219 | Ga0105245_12038143 | 3300009098 | Bacteria | 627 |
| 220 | Ga0105247_10041721 | 3300009101 | Bacteria | 2808 |
| 221 | Ga0105247_10217408 | 3300009101 | Unclassified | 1292 |
| 222 | Ga0105247_10693778 | 3300009101 | Bacteria | 765 |
| 223 | Ga0105243_10055986 | 3300009148 | Bacteria | 3134 |
| 224 | Ga0105243_10077523 | 3300009148 | Unclassified | 2703 |
| 225 | Ga0105243_10203412 | 3300009148 | Bacteria | 1738 |
| 226 | Ga0105243_10875395 | 3300009148 | Unclassified | 891 |
| 227 | Ga0105243_11073378 | 3300009148 | Unclassified | 812 |
| 228 | Ga0105243_11779670 | 3300009148 | Bacteria | 647 |
| 229 | Ga0105243_12702808 | 3300009148 | Unclassified | 537 |
| 230 | Ga0105241_10026406 | 3300009174 | Unclassified | 4320 |
| 231 | Ga0105241_10087456 | 3300009174 | Bacteria | 2453 |
| 232 | Ga0105241_10089009 | 3300009174 | Bacteria | 2432 |
| 233 | Ga0105241_10109637 | 3300009174 | Bacteria | 2208 |
| 234 | Ga0105241_10117801 | 3300009174 | Bacteria | 2135 |
| 235 | Ga0105241_10266909 | 3300009174 | Unclassified | 1456 |
| 236 | Ga0105241_10268079 | 3300009174 | Unclassified | 1454 |
| 237 | Ga0105241_10353698 | 3300009174 | Unclassified | 1276 |
| 238 | Ga0105241_10848087 | 3300009174 | Unclassified | 845 |
| 239 | Ga0105241_10892132 | 3300009174 | Unclassified | 825 |
| 240 | Ga0105241_10954598 | 3300009174 | Unclassified | 799 |
| 241 | Ga0105241_11384739 | 3300009174 | Unclassified | 673 |
| 242 | Ga0105242_10005358 | 3300009176 | Bacteria | 9919 |
| 243 | Ga0105242_10007591 | 3300009176 | Bacteria | 8347 |
| 244 | Ga0105242_10010444 | 3300009176 | Bacteria | 7125 |
| 245 | Ga0105242_10037585 | 3300009176 | Unclassified | 3889 |
| 246 | Ga0105242_10054985 | 3300009176 | Bacteria | 3256 |
| 247 | Ga0105242_10145417 | 3300009176 | Bacteria | 2062 |
| 248 | Ga0105242_10199854 | 3300009176 | Bacteria | 1775 |
| 249 | Ga0105242_10422704 | 3300009176 | Bacteria | 1249 |
| 250 | Ga0105242_10865536 | 3300009176 | Unclassified | 901 |
| 251 | Ga0105242_10963474 | 3300009176 | Bacteria | 858 |
| 252 | Ga0105248_10013594 | 3300009177 | Bacteria | 8960 |
| 253 | Ga0105248_10028125 | 3300009177 | Bacteria | 6262 |
| 254 | Ga0105248_10043727 | 3300009177 | Bacteria | 5024 |
| 255 | Ga0105248_10050640 | 3300009177 | Unclassified | 4659 |
| 256 | Ga0105248_10057566 | 3300009177 | Bacteria | 4363 |
| 257 | Ga0105248_10240442 | 3300009177 | Unclassified | 2038 |
| 258 | Ga0105248_10444410 | 3300009177 | Bacteria | 1461 |
| 259 | Ga0105248_10445791 | 3300009177 | Unclassified | 1458 |
| 260 | Ga0105248_10959812 | 3300009177 | Bacteria | 965 |
| 261 | Ga0105248_10995698 | 3300009177 | Unclassified | 947 |
| 262 | Ga0105248_11365609 | 3300009177 | Unclassified | 802 |
| 263 | Ga0105248_11384375 | 3300009177 | Unclassified | 796 |
| 264 | Ga0105237_10002574 | 3300009545 | Bacteria | 22356 |
| 265 | Ga0105237_10010399 | 3300009545 | Bacteria | 9904 |
| 266 | Ga0105237_10078645 | 3300009545 | Bacteria | 3287 |
| 267 | Ga0105237_10106453 | 3300009545 | Bacteria | 2796 |
| 268 | Ga0105237_10539953 | 3300009545 | Unclassified | 1173 |
| 269 | Ga0105237_10967871 | 3300009545 | Unclassified | 858 |
| 270 | Ga0105237_11014069 | 3300009545 | Unclassified | 837 |
| 271 | Ga0105238_10002330 | 3300009551 | Bacteria | 19101 |
| 272 | Ga0105238_10005599 | 3300009551 | Bacteria | 12411 |
| 273 | Ga0105238_10007323 | 3300009551 | Bacteria | 11049 |
| 274 | Ga0105238_10045201 | 3300009551 | Bacteria | 4449 |
| 275 | Ga0105238_10079332 | 3300009551 | Bacteria | 3273 |
| 276 | Ga0105238_10081446 | 3300009551 | Bacteria | 3226 |
| 277 | Ga0105238_10103063 | 3300009551 | Bacteria | 2835 |
| 278 | Ga0105238_10142322 | 3300009551 | Unclassified | 2375 |
| 279 | Ga0105238_10191073 | 3300009551 | Unclassified | 2024 |
| 280 | Ga0105238_10220047 | 3300009551 | Unclassified | 1875 |
| 281 | Ga0105238_10257952 | 3300009551 | Unclassified | 1722 |
| 282 | Ga0105238_10702016 | 3300009551 | Unclassified | 1024 |
| 283 | Ga0105249_10047300 | 3300009553 | Bacteria | 3919 |
| 284 | Ga0105249_10092764 | 3300009553 | Unclassified | 2827 |
| 285 | Ga0105249_10166426 | 3300009553 | Unclassified | 2135 |
| 286 | Ga0105249_10922264 | 3300009553 | Unclassified | 941 |
| 287 | Ga0105249_11207625 | 3300009553 | Unclassified | 827 |
| 288 | Ga0105249_11936705 | 3300009553 | Bacteria | 662 |
| 289 | Ga0105239_10002707 | 3300010375 | Bacteria | 22284 |
| 290 | Ga0105239_10010040 | 3300010375 | Bacteria | 10614 |
| 291 | Ga0105239_10014444 | 3300010375 | Bacteria | 8762 |
| 292 | Ga0105239_10148463 | 3300010375 | Unclassified | 2616 |
| 293 | Ga0105239_10572945 | 3300010375 | Bacteria | 1287 |
| 294 | Ga0105239_10876768 | 3300010375 | Unclassified | 1030 |
| 295 | Ga0105246_10035862 | 3300011119 | Bacteria | 3318 |
| 296 | Ga0105246_10048356 | 3300011119 | Unclassified | 2907 |
| 297 | Ga0105246_10311615 | 3300011119 | Bacteria | 1275 |
| 298 | Ga0105246_11419368 | 3300011119 | Bacteria | 648 |
| 299 | Ga0105246_11969421 | 3300011119 | Bacteria | 563 |
| 300 | Ga0157371_10741259 | 3300013102 | Bacteria | 737 |
| 301 | Ga0157370_10003445 | 3300013104 | Bacteria | 18570 |
| 302 | Ga0157370_10007799 | 3300013104 | Bacteria | 11602 |
| 303 | Ga0157370_10037406 | 3300013104 | Unclassified | 4705 |
| 304 | Ga0157370_10042165 | 3300013104 | Unclassified | 4400 |
| 305 | Ga0157370_10210846 | 3300013104 | Bacteria | 1800 |
| 306 | Ga0157369_10018664 | 3300013105 | Bacteria | 7775 |
| 307 | Ga0157369_10020006 | 3300013105 | Bacteria | 7485 |
| 308 | Ga0157369_10034141 | 3300013105 | Bacteria | 5584 |
| 309 | Ga0157369_10114163 | 3300013105 | Unclassified | 2869 |
| 310 | Ga0157369_10170631 | 3300013105 | Bacteria | 2292 |
| 311 | Ga0157369_10824633 | 3300013105 | Unclassified | 952 |
| 312 | Ga0157369_11104501 | 3300013105 | Bacteria | 810 |
| 313 | Ga0157374_10021267 | 3300013296 | Bacteria | 5770 |
| 314 | Ga0157374_10065363 | 3300013296 | Bacteria | 3416 |
| 315 | Ga0157374_10076271 | 3300013296 | Bacteria | 3170 |
| 316 | Ga0157374_10170185 | 3300013296 | Unclassified | 2125 |
| 317 | Ga0157374_10306692 | 3300013296 | Bacteria | 1571 |
| 318 | Ga0157374_10467433 | 3300013296 | Bacteria | 1264 |
| 319 | Ga0157374_10878503 | 3300013296 | Unclassified | 914 |
| 320 | Ga0157374_12586730 | 3300013296 | Unclassified | 535 |
| 321 | Ga0157378_10009401 | 3300013297 | Bacteria | 8517 |
| 322 | Ga0157378_10009797 | 3300013297 | Bacteria | 8352 |
| 323 | Ga0157378_10439128 | 3300013297 | Unclassified | 1293 |
| 324 | Ga0157378_10476488 | 3300013297 | Bacteria | 1243 |
| 325 | Ga0157378_10564519 | 3300013297 | Unclassified | 1145 |
| 326 | Ga0157378_11244303 | 3300013297 | Bacteria | 784 |
| 327 | Ga0157378_12812948 | 3300013297 | Unclassified | 539 |
| 328 | Ga0163162_10079147 | 3300013306 | Bacteria | 3353 |
| 329 | Ga0163162_10100848 | 3300013306 | Bacteria | 2979 |
| 330 | Ga0163162_10574467 | 3300013306 | Bacteria | 1255 |
| 331 | Ga0163162_10747241 | 3300013306 | Unclassified | 1098 |
| 332 | Ga0163162_10776139 | 3300013306 | Bacteria | 1077 |
| 333 | Ga0157372_10011100 | 3300013307 | Bacteria | 9581 |
| 334 | Ga0157372_10033562 | 3300013307 | Bacteria | 5638 |
| 335 | Ga0157372_10139669 | 3300013307 | Bacteria | 2790 |
| 336 | Ga0157372_10640085 | 3300013307 | Unclassified | 1238 |
| 337 | Ga0157372_12543205 | 3300013307 | Unclassified | 588 |
| 338 | Ga0157375_10013161 | 3300013308 | Bacteria | 7354 |
| 339 | Ga0157375_10013936 | 3300013308 | Bacteria | 7169 |
| 340 | Ga0157375_10032649 | 3300013308 | Unclassified | 4939 |
| 341 | Ga0157375_10252761 | 3300013308 | Unclassified | 1923 |
| 342 | Ga0157375_10321639 | 3300013308 | Bacteria | 1712 |
| 343 | Ga0163163_10004862 | 3300014325 | Bacteria | 11544 |
| 344 | Ga0163163_10020608 | 3300014325 | Bacteria | 6214 |
| 345 | Ga0163163_10025231 | 3300014325 | Bacteria | 5666 |
| 346 | Ga0163163_10142584 | 3300014325 | Unclassified | 2438 |
| 347 | Ga0163163_10221650 | 3300014325 | Unclassified | 1940 |
| 348 | Ga0163163_10314698 | 3300014325 | Unclassified | 1619 |
| 349 | Ga0163163_10662449 | 3300014325 | Bacteria | 1107 |
| 350 | Ga0163163_11288034 | 3300014325 | Bacteria | 793 |
| 351 | Ga0157380_11250760 | 3300014326 | Unclassified | 788 |
| 352 | Ga0157377_10510043 | 3300014745 | Bacteria | 842 |
| 353 | Ga0157377_11131466 | 3300014745 | Unclassified | 602 |
| 354 | Ga0157379_10017491 | 3300014968 | Bacteria | 6312 |
| 355 | Ga0157379_10105485 | 3300014968 | Bacteria | 2529 |
| 356 | Ga0157379_10768123 | 3300014968 | Unclassified | 908 |
| 357 | Ga0157376_10058885 | 3300014969 | Bacteria | 3219 |
| 358 | Ga0157376_10357485 | 3300014969 | Unclassified | 1400 |
| 359 | Ga0157376_10602797 | 3300014969 | Bacteria | 1093 |
| 360 | Ga0157376_10986358 | 3300014969 | Bacteria | 864 |
| 361 | Ga0157376_12998586 | 3300014969 | Unclassified | 511 |
| 362 | Ga0182007_10253188 | 3300015262 | Bacteria | 632 |
| 363 | Ga0163161_11317434 | 3300017792 | Bacteria | 628 |
| 364 | Ga0207697_10123622 | 3300025315 | Unclassified | 1115 |
| 365 | Ga0207692_10257467 | 3300025898 | Unclassified | 1048 |
| 366 | Ga0207642_10333976 | 3300025899 | Unclassified | 889 |
| 367 | Ga0207642_10645969 | 3300025899 | Unclassified | 662 |
| 368 | Ga0207710_10373404 | 3300025900 | Bacteria | 729 |
| 369 | Ga0207680_10510924 | 3300025903 | Unclassified | 856 |
| 370 | Ga0207685_10774129 | 3300025905 | Unclassified | 527 |
| 371 | Ga0207705_10106917 | 3300025909 | Bacteria | 2064 |
| 372 | Ga0207705_10412777 | 3300025909 | Unclassified | 1045 |
| 373 | Ga0207654_10012234 | 3300025911 | Unclassified | 4393 |
| 374 | Ga0207654_10074589 | 3300025911 | Bacteria | 2025 |
| 375 | Ga0207654_10152255 | 3300025911 | Unclassified | 1485 |
| 376 | Ga0207654_10172515 | 3300025911 | Unclassified | 1405 |
| 377 | Ga0207654_10586279 | 3300025911 | Bacteria | 795 |
| 378 | Ga0207654_10750961 | 3300025911 | Unclassified | 703 |
| 379 | Ga0207707_10000744 | 3300025912 | Bacteria | 32131 |
| 380 | Ga0207707_10007810 | 3300025912 | Bacteria | 9308 |
| 381 | Ga0207707_10016349 | 3300025912 | Bacteria | 6472 |
| 382 | Ga0207707_10087233 | 3300025912 | Bacteria | 2727 |
| 383 | Ga0207707_10109190 | 3300025912 | Unclassified | 2418 |
| 384 | Ga0207707_10371090 | 3300025912 | Bacteria | 1231 |
| 385 | Ga0207695_10003011 | 3300025913 | Bacteria | 24220 |
| 386 | Ga0207695_10010314 | 3300025913 | Bacteria | 11440 |
| 387 | Ga0207695_10015585 | 3300025913 | Bacteria | 8941 |
| 388 | Ga0207695_10027113 | 3300025913 | Bacteria | 6381 |
| 389 | Ga0207695_10033326 | 3300025913 | Bacteria | 5620 |
| 390 | Ga0207695_10188447 | 3300025913 | Unclassified | 1981 |
| 391 | Ga0207695_10392741 | 3300025913 | Bacteria | 1272 |
| 392 | Ga0207671_10011172 | 3300025914 | Bacteria | 7332 |
| 393 | Ga0207671_10187048 | 3300025914 | Unclassified | 1614 |
| 394 | Ga0207663_10151276 | 3300025916 | Bacteria | 1628 |
| 395 | Ga0207663_10168720 | 3300025916 | Bacteria | 1552 |
| 396 | Ga0207663_10170687 | 3300025916 | Bacteria | 1545 |
| 397 | Ga0207663_10385294 | 3300025916 | Unclassified | 1069 |
| 398 | Ga0207663_11516890 | 3300025916 | Unclassified | 540 |
| 399 | Ga0207662_10267186 | 3300025918 | Unclassified | 1128 |
| 400 | Ga0207657_10007491 | 3300025919 | Bacteria | 11186 |
| 401 | Ga0207657_10077384 | 3300025919 | Bacteria | 2804 |
| 402 | Ga0207657_10216333 | 3300025919 | Unclassified | 1536 |
| 403 | Ga0207649_10062779 | 3300025920 | Bacteria | 2343 |
| 404 | Ga0207649_11327918 | 3300025920 | Unclassified | 569 |
| 405 | Ga0207652_10004664 | 3300025921 | Bacteria | 11113 |
| 406 | Ga0207652_10034897 | 3300025921 | Bacteria | 4242 |
| 407 | Ga0207652_10070113 | 3300025921 | Bacteria | 3044 |
| 408 | Ga0207652_10548652 | 3300025921 | Bacteria | 1039 |
| 409 | Ga0207652_10661857 | 3300025921 | Unclassified | 933 |
| 410 | Ga0207652_10959707 | 3300025921 | Unclassified | 753 |
| 411 | Ga0207681_11641345 | 3300025923 | Unclassified | 538 |
| 412 | Ga0207694_10001024 | 3300025924 | Bacteria | 24374 |
| 413 | Ga0207694_10003038 | 3300025924 | Bacteria | 13457 |
| 414 | Ga0207694_10007367 | 3300025924 | Bacteria | 8346 |
| 415 | Ga0207694_10009550 | 3300025924 | Bacteria | 7318 |
| 416 | Ga0207694_10029999 | 3300025924 | Bacteria | 4152 |
| 417 | Ga0207694_10068475 | 3300025924 | Bacteria | 2772 |
| 418 | Ga0207694_10144600 | 3300025924 | Unclassified | 1914 |
| 419 | Ga0207694_10168173 | 3300025924 | Unclassified | 1774 |
| 420 | Ga0207694_10178218 | 3300025924 | Bacteria | 1722 |
| 421 | Ga0207687_10001024 | 3300025927 | Bacteria | 18980 |
| 422 | Ga0207687_10005986 | 3300025927 | Bacteria | 8045 |
| 423 | Ga0207687_10011261 | 3300025927 | Bacteria | 5843 |
| 424 | Ga0207687_10022491 | 3300025927 | Bacteria | 4196 |
| 425 | Ga0207687_10054401 | 3300025927 | Bacteria | 2800 |
| 426 | Ga0207687_10117439 | 3300025927 | Bacteria | 1984 |
| 427 | Ga0207687_10245208 | 3300025927 | Bacteria | 1422 |
| 428 | Ga0207687_10807211 | 3300025927 | Unclassified | 800 |
| 429 | Ga0207687_10936890 | 3300025927 | Unclassified | 742 |
| 430 | Ga0207700_10003830 | 3300025928 | Bacteria | 8788 |
| 431 | Ga0207700_10010156 | 3300025928 | Bacteria | 5923 |
| 432 | Ga0207700_10505501 | 3300025928 | Unclassified | 1070 |
| 433 | Ga0207664_10290875 | 3300025929 | Bacteria | 1436 |
| 434 | Ga0207644_10009905 | 3300025931 | Bacteria | 6270 |
| 435 | Ga0207644_10213421 | 3300025931 | Bacteria | 1527 |
| 436 | Ga0207690_10010120 | 3300025932 | Bacteria | 5600 |
| 437 | Ga0207690_10046758 | 3300025932 | Unclassified | 2868 |
| 438 | Ga0207706_10099144 | 3300025933 | Bacteria | 2563 |
| 439 | Ga0207686_10019609 | 3300025934 | Unclassified | 3850 |
| 440 | Ga0207686_10034991 | 3300025934 | Bacteria | 3011 |
| 441 | Ga0207686_10136398 | 3300025934 | Bacteria | 1690 |
| 442 | Ga0207686_10337426 | 3300025934 | Unclassified | 1131 |
| 443 | Ga0207686_10340961 | 3300025934 | Unclassified | 1125 |
| 444 | Ga0207686_10501919 | 3300025934 | Unclassified | 941 |
| 445 | Ga0207686_11658898 | 3300025934 | Unclassified | 528 |
| 446 | Ga0207686_11662571 | 3300025934 | Unclassified | 528 |
| 447 | Ga0207709_10137437 | 3300025935 | Unclassified | 1675 |
| 448 | Ga0207709_10253883 | 3300025935 | Unclassified | 1286 |
| 449 | Ga0207709_11185487 | 3300025935 | Bacteria | 629 |
| 450 | Ga0207709_11226989 | 3300025935 | Unclassified | 618 |
| 451 | Ga0207709_11491900 | 3300025935 | Unclassified | 561 |
| 452 | Ga0207670_10336593 | 3300025936 | Bacteria | 1191 |
| 453 | Ga0207669_10508778 | 3300025937 | Unclassified | 965 |
| 454 | Ga0207669_11582515 | 3300025937 | Unclassified | 559 |
| 455 | Ga0207704_10004284 | 3300025938 | Bacteria | 6520 |
| 456 | Ga0207704_10017892 | 3300025938 | Unclassified | 3686 |
| 457 | Ga0207704_10037431 | 3300025938 | Bacteria | 2803 |
| 458 | Ga0207704_11387581 | 3300025938 | Bacteria | 602 |
| 459 | Ga0207665_10961895 | 3300025939 | Unclassified | 679 |
| 460 | Ga0207691_10236200 | 3300025940 | Bacteria | 1581 |
| 461 | Ga0207711_10006913 | 3300025941 | Bacteria | 9529 |
| 462 | Ga0207711_10026639 | 3300025941 | Unclassified | 4852 |
| 463 | Ga0207711_10027844 | 3300025941 | Bacteria | 4750 |
| 464 | Ga0207711_10109520 | 3300025941 | Bacteria | 2454 |
| 465 | Ga0207711_10362776 | 3300025941 | Bacteria | 1342 |
| 466 | Ga0207711_10391406 | 3300025941 | Unclassified | 1291 |
| 467 | Ga0207711_10758456 | 3300025941 | Unclassified | 904 |
| 468 | Ga0207711_11041816 | 3300025941 | Bacteria | 758 |
| 469 | Ga0207711_11907060 | 3300025941 | Bacteria | 537 |
| 470 | Ga0207689_10123497 | 3300025942 | Bacteria | 2129 |
| 471 | Ga0207689_10141712 | 3300025942 | Unclassified | 1980 |
| 472 | Ga0207689_10585674 | 3300025942 | Unclassified | 938 |
| 473 | Ga0207689_10660010 | 3300025942 | Bacteria | 881 |
| 474 | Ga0207689_11402602 | 3300025942 | Unclassified | 585 |
| 475 | Ga0207661_10001824 | 3300025944 | Bacteria | 14562 |
| 476 | Ga0207661_10003946 | 3300025944 | Bacteria | 10363 |
| 477 | Ga0207661_10185413 | 3300025944 | Bacteria | 1821 |
| 478 | Ga0207661_10195352 | 3300025944 | Bacteria | 1776 |
| 479 | Ga0207661_10317671 | 3300025944 | Unclassified | 1399 |
| 480 | Ga0207661_10429209 | 3300025944 | Bacteria | 1201 |
| 481 | Ga0207661_10644603 | 3300025944 | Unclassified | 973 |
| 482 | Ga0207679_10076373 | 3300025945 | Bacteria | 2545 |
| 483 | Ga0207679_10272296 | 3300025945 | Unclassified | 1449 |
| 484 | Ga0207679_10442901 | 3300025945 | Bacteria | 1151 |
| 485 | Ga0207667_10001895 | 3300025949 | Bacteria | 26257 |
| 486 | Ga0207667_10002299 | 3300025949 | Bacteria | 24006 |
| 487 | Ga0207667_10004489 | 3300025949 | Bacteria | 17092 |
| 488 | Ga0207667_10049522 | 3300025949 | Bacteria | 4436 |
| 489 | Ga0207667_10187056 | 3300025949 | Unclassified | 2126 |
| 490 | Ga0207667_10329498 | 3300025949 | Unclassified | 1559 |
| 491 | Ga0207667_10763835 | 3300025949 | Bacteria | 965 |
| 492 | Ga0207667_11130214 | 3300025949 | Unclassified | 765 |
| 493 | Ga0207651_10021247 | 3300025960 | Bacteria | 3940 |
| 494 | Ga0207712_10075582 | 3300025961 | Bacteria | 2436 |
| 495 | Ga0207712_10772098 | 3300025961 | Unclassified | 843 |
| 496 | Ga0207712_11133342 | 3300025961 | Bacteria | 697 |
| 497 | Ga0207668_10319320 | 3300025972 | Unclassified | 1288 |
| 498 | Ga0207640_10030039 | 3300025981 | Bacteria | 3343 |
| 499 | Ga0207658_10164453 | 3300025986 | Bacteria | 1821 |
| 500 | Ga0207658_10375712 | 3300025986 | Unclassified | 1244 |
| 501 | Ga0207658_11443910 | 3300025986 | Unclassified | 629 |
| 502 | Ga0207677_10151705 | 3300026023 | Bacteria | 1789 |
| 503 | Ga0207677_10259606 | 3300026023 | Unclassified | 1415 |
| 504 | Ga0207677_11306909 | 3300026023 | Bacteria | 666 |
| 505 | Ga0207677_11383434 | 3300026023 | Unclassified | 648 |
| 506 | Ga0207677_11433528 | 3300026023 | Bacteria | 637 |
| 507 | Ga0207703_10003146 | 3300026035 | Bacteria | 13927 |
| 508 | Ga0207703_10020197 | 3300026035 | Bacteria | 5209 |
| 509 | Ga0207703_10096999 | 3300026035 | Bacteria | 2490 |
| 510 | Ga0207703_10826758 | 3300026035 | Bacteria | 885 |
| 511 | Ga0207703_10918348 | 3300026035 | Unclassified | 838 |
| 512 | Ga0207703_12408995 | 3300026035 | Unclassified | 502 |
| 513 | Ga0207639_10070001 | 3300026041 | Unclassified | 2739 |
| 514 | Ga0207639_10105016 | 3300026041 | Unclassified | 2291 |
| 515 | Ga0207639_10453922 | 3300026041 | Unclassified | 1164 |
| 516 | Ga0207639_10479625 | 3300026041 | Bacteria | 1133 |
| 517 | Ga0207639_10625185 | 3300026041 | Bacteria | 995 |
| 518 | Ga0207639_10767445 | 3300026041 | Bacteria | 897 |
| 519 | Ga0207708_10453736 | 3300026075 | Unclassified | 1068 |
| 520 | Ga0207702_10002419 | 3300026078 | Bacteria | 17748 |
| 521 | Ga0207702_10026940 | 3300026078 | Bacteria | 4774 |
| 522 | Ga0207702_10038047 | 3300026078 | Bacteria | 4030 |
| 523 | Ga0207702_10061524 | 3300026078 | Bacteria | 3203 |
| 524 | Ga0207702_10191507 | 3300026078 | Unclassified | 1890 |
| 525 | Ga0207702_10243145 | 3300026078 | Bacteria | 1687 |
| 526 | Ga0207702_10351809 | 3300026078 | Unclassified | 1410 |
| 527 | Ga0207702_10660568 | 3300026078 | Unclassified | 1028 |
| 528 | Ga0207641_10003019 | 3300026088 | Bacteria | 15172 |
| 529 | Ga0207641_10399007 | 3300026088 | Unclassified | 1320 |
| 530 | Ga0207641_10555725 | 3300026088 | Unclassified | 1120 |
| 531 | Ga0207641_10584533 | 3300026088 | Unclassified | 1092 |
| 532 | Ga0207641_10634655 | 3300026088 | Unclassified | 1048 |
| 533 | Ga0207641_11715421 | 3300026088 | Bacteria | 630 |
| 534 | Ga0207648_10003227 | 3300026089 | Bacteria | 17174 |
| 535 | Ga0207648_10295784 | 3300026089 | Bacteria | 1451 |
| 536 | Ga0207648_11373084 | 3300026089 | Unclassified | 664 |
| 537 | Ga0207676_10090402 | 3300026095 | Unclassified | 2512 |
| 538 | Ga0207676_10148459 | 3300026095 | Bacteria | 2016 |
| 539 | Ga0207676_10267341 | 3300026095 | Bacteria | 1547 |
| 540 | Ga0207676_10497763 | 3300026095 | Bacteria | 1157 |
| 541 | Ga0207676_11327412 | 3300026095 | Bacteria | 714 |
| 542 | Ga0207674_10002011 | 3300026116 | Bacteria | 25818 |
| 543 | Ga0207674_10005710 | 3300026116 | Bacteria | 14747 |
| 544 | Ga0207674_10016193 | 3300026116 | Bacteria | 8166 |
| 545 | Ga0207674_10018723 | 3300026116 | Bacteria | 7516 |
| 546 | Ga0207674_10024250 | 3300026116 | Bacteria | 6485 |
| 547 | Ga0207674_10180316 | 3300026116 | Bacteria | 2063 |
| 548 | Ga0207675_100421629 | 3300026118 | Bacteria | 1318 |
| 549 | Ga0207683_10348513 | 3300026121 | Bacteria | 1359 |
| 550 | Ga0207683_10444193 | 3300026121 | Unclassified | 1195 |
| 551 | Ga0207698_10015556 | 3300026142 | Bacteria | 5097 |
| 552 | Ga0207698_10019341 | 3300026142 | Bacteria | 4660 |
| 553 | Ga0207698_10177944 | 3300026142 | Bacteria | 1880 |
| 554 | Ga0207698_10780053 | 3300026142 | Unclassified | 957 |
| 555 | Ga0207698_12069339 | 3300026142 | Unclassified | 583 |
| 556 | Ga0207698_12569735 | 3300026142 | Unclassified | 519 |
| 557 | Ga0268266_10027306 | 3300028379 | Bacteria | 4854 |
| 558 | Ga0268266_10252324 | 3300028379 | Bacteria | 1632 |
| 559 | Ga0268265_10994980 | 3300028380 | Bacteria | 828 |
| 560 | Ga0268264_10019626 | 3300028381 | Bacteria | 5522 |
| 561 | Ga0268264_10038788 | 3300028381 | Bacteria | 3933 |
| 562 | Ga0268264_10165130 | 3300028381 | Unclassified | 1998 |
| 563 | Ga0268264_10193659 | 3300028381 | Bacteria | 1855 |
| 564 | Ga0268264_10360690 | 3300028381 | Bacteria | 1386 |
| 565 | Ga0268264_11560097 | 3300028381 | Unclassified | 671 |
| 566 | Ga0265338_10102948 | 3300028800 | Unclassified | 2321 |
| 567 | Ga0265338_10525315 | 3300028800 | Bacteria | 831 |
| 568 | Ga0265329_10242115 | 3300031242 | Bacteria | 600 |
| 569 | Ga0265340_10131748 | 3300031247 | Bacteria | 1146 |
| 570 | Ga0265339_10461288 | 3300031249 | Bacteria | 589 |
| 571 | Ga0265331_10356683 | 3300031250 | Unclassified | 655 |
| 572 | Ga0265331_10501522 | 3300031250 | Unclassified | 546 |
| 573 | Ga0265327_10443110 | 3300031251 | Bacteria | 562 |
| 574 | Ga0265313_10104209 | 3300031595 | Bacteria | 1255 |
| 575 | Ga0265314_10001081 | 3300031711 | Bacteria | 31584 |
| 576 | Ga0265314_10003587 | 3300031711 | Bacteria | 14944 |
| 577 | Ga0265342_10428248 | 3300031712 | Bacteria | 681 |
| 578 | Ga0373934_0011468 | 3300035086 | Unclassified | 3333 |
| 579 | Ga0373934_0066008 | 3300035086 | Bacteria | 1445 |
| 580 | Ga0373934_0186372 | 3300035086 | Bacteria | 853 |
| 581 | Ga0373944_0049324 | 3300035089 | Bacteria | 1323 |
| 582 | Ga0373944_0364272 | 3300035089 | Unclassified | 552 |
| 583 | Ga0373923_0314289 | 3300035111 | Unclassified | 743 |
| 584 | Ga0373953_0018971 | 3300035117 | Bacteria | 2553 |
| 585 | Ga0373953_0113752 | 3300035117 | Bacteria | 1146 |
| 586 | Ga0373954_0013640 | 3300035118 | Unclassified | 3622 |
| 587 | Ga0373954_0290062 | 3300035118 | Unclassified | 807 |
| 588 | Ga0373956_0152447 | 3300035119 | Bacteria | 1088 |
| 589 | Ga0373957_0031118 | 3300035120 | Unclassified | 1959 |
| 590 | Ga0373957_0243233 | 3300035120 | Unclassified | 756 |
| 591 | Ga0373955_0091603 | 3300035172 | Unclassified | 1733 |
| 592 | Ga0373955_0174238 | 3300035172 | Bacteria | 1274 |
| 593 | Ga0373924_0171221 | 3300035410 | Unclassified | 954 |
| 594 | Ga0373924_0214838 | 3300035410 | Unclassified | 849 |
| 595 | Ga0373935_0355573 | 3300035692 | Bacteria | 1045 |
| 596 | Ga0373935_0584320 | 3300035692 | Unclassified | 816 |
| 597 | Ga0373935_0662844 | 3300035692 | Bacteria | 766 |
| 598 | Ga0373935_0787286 | 3300035692 | Unclassified | 702 |
| 599 | Ga0373935_1160679 | 3300035692 | Unclassified | 575 |
| 600 | Ga0373927_0006060 | 3300035695 | Bacteria | 8282 |
| 601 | Ga0373927_0688799 | 3300035695 | Unclassified | 675 |
| 602 | Ga0373933_0004065 | 3300035724 | Bacteria | 8058 |
| 603 | Ga0373933_0057639 | 3300035724 | Unclassified | 2335 |
| 604 | Ga0373933_0057903 | 3300035724 | Bacteria | 2330 |
| 605 | Ga0373947_0605110 | 3300035725 | Unclassified | 747 |
| 606 | Ga0373937_0009613 | 3300036401 | Bacteria | 8418 |
| 607 | Ga0373937_0009984 | 3300036401 | Bacteria | 8277 |
| 608 | Ga0373937_0037646 | 3300036401 | Bacteria | 4408 |
| 609 | Ga0373937_0082697 | 3300036401 | Unclassified | 2971 |
| 610 | Ga0373937_1109425 | 3300036401 | Bacteria | 740 |
| 611 | Ga0373937_1421619 | 3300036401 | Bacteria | 641 |
| 612 | Ga0373937_2013225 | 3300036401 | Unclassified | 524 |
| 613 | Ga0373925_0024539 | 3300037068 | Unclassified | 4402 |
| 614 | Ga0373925_0228248 | 3300037068 | Bacteria | 1488 |
| 615 | Ga0373925_0381365 | 3300037068 | Bacteria | 1148 |
| 616 | Ga0373925_0557302 | 3300037068 | Bacteria | 943 |
| 617 | Ga0373925_0669582 | 3300037068 | Unclassified | 855 |
| 618 | Ga0373925_0871908 | 3300037068 | Unclassified | 742 |
| 619 | Ga0439448_0073438 | 3300042005 | Unclassified | 1141 |
| 620 | Ga0466963_0900400 | 3300044694 | Unclassified | 623 |
| 621 | Ga0451576_0632343 | 3300045051 | Bacteria | 1125 |
| 622 | Ga0451576_1801825 | 3300045051 | Bacteria | 633 |
| 623 | Ga0495592_0424862 | 3300046454 | Bacteria | 837 |
| 624 | Ga0495603_0626003 | 3300046455 | Unclassified | 616 |
| 625 | Ga0495629_0703775 | 3300046459 | Unclassified | 671 |
| 626 | Ga0495580_0035641 | 3300046472 | Bacteria | 3577 |
| 627 | Ga0495580_0072306 | 3300046472 | Unclassified | 2409 |
| 628 | Ga0495580_0077318 | 3300046472 | Bacteria | 2321 |
| 629 | Ga0495580_0098392 | 3300046472 | Bacteria | 2035 |
| 630 | Ga0495580_0098823 | 3300046472 | Unclassified | 2030 |
| 631 | Ga0495580_0720863 | 3300046472 | Unclassified | 651 |
| 632 | Ga0495580_0813053 | 3300046472 | Unclassified | 605 |
| 633 | Ga0495582_0049985 | 3300046473 | Bacteria | 2303 |
| 634 | Ga0495582_0498249 | 3300046473 | Unclassified | 704 |
| 635 | Ga0495639_0087558 | 3300046475 | Unclassified | 1458 |
| 636 | Ga0495652_0118088 | 3300046529 | Bacteria | 2120 |
| 637 | Ga0495652_0174695 | 3300046529 | Unclassified | 1655 |
| 638 | Ga0495652_0396689 | 3300046529 | Unclassified | 978 |
| 639 | Ga0495652_0694819 | 3300046529 | Bacteria | 685 |
| 640 | Ga0495665_0074155 | 3300046531 | Bacteria | 1792 |
| 641 | Ga0495665_0088050 | 3300046531 | Bacteria | 1632 |
| 642 | Ga0495665_0368704 | 3300046531 | Unclassified | 730 |
| 643 | Ga0495586_0577893 | 3300046535 | Unclassified | 649 |
| 644 | Ga0495587_0016659 | 3300046536 | Bacteria | 4572 |
| 645 | Ga0495587_0019030 | 3300046536 | Bacteria | 4255 |
| 646 | Ga0495645_0263375 | 3300046543 | Bacteria | 1140 |
| 647 | Ga0495645_0308725 | 3300046543 | Unclassified | 1031 |
| 648 | Ga0495667_0081508 | 3300046559 | Unclassified | 2103 |
| 649 | Ga0495667_0659922 | 3300046559 | Unclassified | 649 |
| 650 | Ga0495634_0285539 | 3300046642 | Unclassified | 1001 |
| 651 | Ga0495635_0460815 | 3300046663 | Bacteria | 840 |
| 652 | Ga0495599_0013497 | 3300046678 | Bacteria | 5047 |
| 653 | Ga0495646_0672169 | 3300046680 | Unclassified | 522 |
| 654 | Ga0495658_0703085 | 3300046683 | Unclassified | 647 |
| 655 | Ga0495613_0160780 | 3300046689 | Unclassified | 1598 |
| 656 | Ga0495624_0570708 | 3300046690 | Unclassified | 675 |
| 657 | Ga0495600_0448890 | 3300046809 | Unclassified | 798 |
| 658 | Ga0495581_0789698 | 3300047315 | Unclassified | 545 |
| 659 | Ga0495674_0804274 | 3300047319 | Unclassified | 731 |
| 660 | Ga0495676_0312735 | 3300047321 | Unclassified | 1057 |
| 661 | Ga0495680_0086942 | 3300047322 | Bacteria | 2352 |
| 662 | Ga0495680_1066815 | 3300047322 | Unclassified | 512 |
| 663 | Ga0495675_0513321 | 3300047444 | Unclassified | 687 |
| 664 | Ga0495675_0641388 | 3300047444 | Unclassified | 599 |
| 665 | Ga0495684_0218717 | 3300047471 | Bacteria | 1397 |
| 666 | Ga0495684_0239159 | 3300047471 | Bacteria | 1325 |
| 667 | Ga0495684_0380968 | 3300047471 | Unclassified | 995 |
| 668 | Ga0495684_1063816 | 3300047471 | Unclassified | 510 |
| 669 | Ga0495602_0182725 | 3300048088 | Bacteria | 1615 |
| 670 | Ga0496112_0588996 | 3300048915 | Bacteria | 1044 |
| 671 | Ga0496115_0213731 | 3300048918 | Unclassified | 1592 |
| 672 | Ga0496115_0381539 | 3300048918 | Bacteria | 1146 |
| 673 | Ga0501040_0776356 | 3300049576 | Unclassified | 693 |
| 674 | Ga0501045_0443615 | 3300049824 | Bacteria | 965 |
| 675 | nmdc:mga0qj67_253037_c1 | 3300050509 | Bacteria | 1429 |
| 676 | nmdc:mga0n895_826430_c1 | 3300050512 | Unclassified | 915 |
| 677 | nmdc:mga08x19_569754_c1 | 3300050514 | Unclassified | 802 |
| 678 | Ga0495601_0382222 | 3300053077 | Unclassified | 914 |
| 679 | Ga0495601_0633622 | 3300053077 | Bacteria | 685 |
| 680 | Ga0495612_0253959 | 3300053078 | Unclassified | 782 |
| 681 | Ga0495619_0630432 | 3300053085 | Unclassified | 732 |
| 682 | Ga0495619_1060824 | 3300053085 | Unclassified | 540 |
| 683 | Ga0500568_0002530 | 3300053139 | Bacteria | 10681 |
| 684 | Ga0070683_100044761 | |||
| 685 | Ga0070658_10504122 | |||
| 686 | Ga0070658_10507206 | |||
| 687 | Ga0070683_100003332 | |||
| 688 | Ga0070683_100008730 | |||
| 689 | Ga0070683_100083652 | |||
| 690 | Ga0070683_100205020 | |||
| 691 | Ga0070683_101256958 | |||
| 692 | Ga0070683_101390237 | |||
| 693 | Ga0070683_101558656 | |||
| 694 | Ga0070690_100055311 | |||
| 695 | Ga0070690_100088554 | |||
| 696 | Ga0070690_101257727 | |||
| 697 | Ga0068869_100261326 | |||
| 698 | Ga0068869_101678241 | |||
| 699 | Ga0070666_10005151 | |||
| 700 | Ga0070666_10150217 | |||
| 701 | Ga0070666_10714610 | |||
| 702 | Ga0070680_100307720 | |||
| 703 | Ga0070682_100793833 | |||
| 704 | Ga0068868_100066589 | |||
| 705 | Ga0068868_101735919 | |||
| 706 | Ga0068868_101985779 | |||
| 707 | Ga0068868_102017304 | |||
| 708 | Ga0070660_100044150 | |||
| 709 | Ga0070660_100075040 | |||
| 710 | Ga0070660_100268720 | |||
| 711 | Ga0070660_100439155 | |||
| 712 | Ga0070689_100464250 | |||
| 713 | Ga0070691_10003894 | |||
| 714 | Ga0070687_100433053 | |||
| 715 | Ga0070661_100054684 | |||
| 716 | Ga0070661_100159037 | |||
| 717 | Ga0070668_100735314 | |||
| 718 | Ga0070671_100050798 | |||
| 719 | Ga0070671_100280924 | |||
| 720 | Ga0070674_100499941 | |||
| 721 | Ga0070674_100527383 | |||
| 722 | Ga0070673_100100446 | |||
| 723 | Ga0070673_101261500 | |||
| 724 | Ga0070659_100514037 | |||
| 725 | Ga0070659_101084236 | |||
| 726 | Ga0070667_100057276 | |||
| 727 | Ga0070667_100068445 | |||
| 728 | Ga0070667_100814696 | |||
| 729 | Ga0070709_10131900 | |||
| 730 | Ga0070709_10252884 | |||
| 731 | Ga0070714_100205363 | |||
| 732 | Ga0070713_100077747 | |||
| 733 | Ga0070710_10733761 | |||
| 734 | Ga0070711_100092531 | |||
| 735 | Ga0070711_100133953 | |||
| 736 | Ga0070711_100361982 | |||
| 737 | Ga0070711_100393310 | |||
| 738 | Ga0070711_100423746 | |||
| 739 | Ga0070711_100470931 | |||
| 740 | Ga0070708_100432561 | |||
| 741 | Ga0070678_100303683 | |||
| 742 | Ga0070678_100410974 | |||
| 743 | Ga0070662_100251377 | |||
| 744 | Ga0070681_10010982 | |||
| 745 | Ga0070681_10016327 | |||
| 746 | Ga0070681_10084888 | |||
| 747 | Ga0070681_10098972 | |||
| 748 | Ga0070681_10212122 | |||
| 749 | Ga0070681_10506056 | |||
| 750 | Ga0070681_11137552 | |||
| 751 | Ga0068867_100016005 | |||
| 752 | Ga0068867_100064553 | |||
| 753 | Ga0068867_100430562 | |||
| 754 | Ga0070698_101864810 | |||
| 755 | Ga0070679_100001481 | |||
| 756 | Ga0070679_100088268 | |||
| 757 | Ga0070679_100606803 | |||
| 758 | Ga0070679_100671305 | |||
| 759 | Ga0070679_102125879 | |||
| 760 | Ga0070684_100022083 | |||
| 761 | Ga0070684_100024943 | |||
| 762 | Ga0070684_100044644 | |||
| 763 | Ga0070684_100051027 | |||
| 764 | Ga0070684_100469666 | |||
| 765 | Ga0070684_100550345 | |||
| 766 | Ga0070684_100664249 | |||
| 767 | Ga0070684_101134571 | |||
| 768 | Ga0070697_100948128 | |||
| 769 | Ga0068853_100096705 | |||
| 770 | Ga0068853_100136080 | |||
| 771 | Ga0068853_100320989 | |||
| 772 | Ga0068853_100551170 | |||
| 773 | Ga0068853_100551403 | |||
| 774 | Ga0070672_100507894 | |||
| 775 | Ga0070686_100588194 | |||
| 776 | Ga0070686_101304841 | |||
| 777 | Ga0070695_100686055 | |||
| 778 | Ga0070696_101467751 | |||
| 779 | Ga0070693_100038139 | |||
| 780 | Ga0070665_100308259 | |||
| 781 | Ga0070665_100561934 | |||
| 782 | Ga0068855_100001548 | |||
| 783 | Ga0068855_100004931 | |||
| 784 | Ga0068855_100031062 | |||
| 785 | Ga0068855_100051767 | |||
| 786 | Ga0068855_100103694 | |||
| 787 | Ga0068855_100176865 | |||
| 788 | Ga0068855_100835672 | |||
| 789 | Ga0070664_100138057 | |||
| 790 | Ga0070664_100427195 | |||
| 791 | Ga0070664_101065372 | |||
| 792 | Ga0070664_101701431 | |||
| 793 | Ga0068857_100001166 | |||
| 794 | Ga0068857_100011546 | |||
| 795 | Ga0068857_100016136 | |||
| 796 | Ga0068857_100016150 | |||
| 797 | Ga0068857_100024100 | |||
| 798 | Ga0068857_100925308 | |||
| 799 | Ga0068854_100311330 | |||
| 800 | Ga0068854_100527431 | |||
| 801 | Ga0068856_100000805 | |||
| 802 | Ga0068856_100010939 | |||
| 803 | Ga0068856_100049260 | |||
| 804 | Ga0068856_100055744 | |||
| 805 | Ga0068856_100079583 | |||
| 806 | Ga0068856_100116638 | |||
| 807 | Ga0068856_100289794 | |||
| 808 | Ga0068856_100343510 | |||
| 809 | Ga0068856_100572318 | |||
| 810 | Ga0070702_101532725 | |||
| 811 | Ga0068852_100006181 | |||
| 812 | Ga0068852_100116044 | |||
| 813 | Ga0068852_100154112 | |||
| 814 | Ga0068852_100632300 | |||
| 815 | Ga0068852_101707675 | |||
| 816 | Ga0068852_101791909 | |||
| 817 | Ga0068859_100073744 | |||
| 818 | Ga0068859_100354731 | |||
| 819 | Ga0068859_100608132 | |||
| 820 | Ga0068859_100758204 | |||
| 821 | Ga0068864_100011494 | |||
| 822 | Ga0068864_100118007 | |||
| 823 | Ga0068864_100300382 | |||
| 824 | Ga0068864_100612961 | |||
| 825 | Ga0068864_100768206 | |||
| 826 | Ga0068866_10380429 | |||
| 827 | Ga0068861_100559576 | |||
| 828 | Ga0068863_100016712 | |||
| 829 | Ga0068863_100027929 | |||
| 830 | Ga0068863_100120438 | |||
| 831 | Ga0068863_100176905 | |||
| 832 | Ga0068863_100593242 | |||
| 833 | Ga0068863_100806616 | |||
| 834 | Ga0068863_101064035 | |||
| 835 | Ga0068863_102500150 | |||
| 836 | Ga0068858_100001679 | |||
| 837 | Ga0068858_100005315 | |||
| 838 | Ga0068858_100296067 | |||
| 839 | Ga0068858_100577746 | |||
| 840 | Ga0068858_101193513 | |||
| 841 | Ga0068858_101200597 | |||
| 842 | Ga0068860_100004901 | |||
| 843 | Ga0068860_100033609 | |||
| 844 | Ga0068860_100125702 | |||
| 845 | Ga0068860_101321294 | |||
| 846 | Ga0068860_102081528 | |||
| 847 | Ga0068862_100997936 | |||
| 848 | Ga0068862_102461146 | |||
| 849 | Ga0070717_11595202 | |||
| 850 | Ga0070715_10335926 | |||
| 851 | Ga0070716_101056617 | |||
| 852 | Ga0070716_101792409 | |||
| 853 | Ga0097621_100035350 | |||
| 854 | Ga0097621_100053093 | |||
| 855 | Ga0097621_100101870 | |||
| 856 | Ga0097621_100157928 | |||
| 857 | Ga0097621_100162116 | |||
| 858 | Ga0097621_100165539 | |||
| 859 | Ga0097621_100818088 | |||
| 860 | Ga0097621_102055714 | |||
| 861 | Ga0097621_102056408 | |||
| 862 | Ga0068871_100002393 | |||
| 863 | Ga0068871_100007348 | |||
| 864 | Ga0068871_100015684 | |||
| 865 | Ga0068871_100033878 | |||
| 866 | Ga0068871_100038403 | |||
| 867 | Ga0068871_100294552 | |||
| 868 | Ga0068871_100461607 | |||
| 869 | Ga0075430_100159444 | |||
| 870 | Ga0068865_100011315 | |||
| 871 | Ga0068865_100036403 | |||
| 872 | Ga0068865_100095379 | |||
| 873 | Ga0075436_100291022 | |||
| 874 | Ga0097620_100073744 | |||
| 875 | Ga0097620_100354752 | |||
| 876 | Ga0097620_100608199 | |||
| 877 | Ga0097620_100758213 | |||
| 878 | Ga0099794_10259935 | |||
| 879 | Ga0105240_10000902 | |||
| 880 | Ga0105240_10003336 | |||
| 881 | Ga0105240_10097279 | |||
| 882 | Ga0105240_10294936 | |||
| 883 | Ga0105240_10426906 | |||
| 884 | Ga0105240_10477589 | |||
| 885 | Ga0105240_10611507 | |||
| 886 | Ga0105240_10737970 | |||
| 887 | Ga0105240_11637171 | |||
| 888 | Ga0105245_10004892 | |||
| 889 | Ga0105245_10006604 | |||
| 890 | Ga0105245_10012603 | |||
| 891 | Ga0105245_10012889 | |||
| 892 | Ga0105245_10014159 | |||
| 893 | Ga0105245_10025780 | |||
| 894 | Ga0105245_10107741 | |||
| 895 | Ga0105245_10118107 | |||
| 896 | Ga0105245_10174792 | |||
| 897 | Ga0105245_10252113 | |||
| 898 | Ga0105245_10295679 | |||
| 899 | Ga0105245_10546834 | |||
| 900 | Ga0105245_11737575 | |||
| 901 | Ga0105245_11742760 | |||
| 902 | Ga0105245_12038143 | |||
| 903 | Ga0105247_10041721 | |||
| 904 | Ga0105247_10217408 | |||
| 905 | Ga0105247_10693778 | |||
| 906 | Ga0105243_10055986 | |||
| 907 | Ga0105243_10077523 | |||
| 908 | Ga0105243_10203412 | |||
| 909 | Ga0105243_10875395 | |||
| 910 | Ga0105243_11073378 | |||
| 911 | Ga0105243_11779670 | |||
| 912 | Ga0105243_12702808 | |||
| 913 | Ga0105241_10026406 | |||
| 914 | Ga0105241_10087456 | |||
| 915 | Ga0105241_10089009 | |||
| 916 | Ga0105241_10109637 | |||
| 917 | Ga0105241_10117801 | |||
| 918 | Ga0105241_10266909 | |||
| 919 | Ga0105241_10268079 | |||
| 920 | Ga0105241_10353698 | |||
| 921 | Ga0105241_10848087 | |||
| 922 | Ga0105241_10892132 | |||
| 923 | Ga0105241_10954598 | |||
| 924 | Ga0105241_11384739 | |||
| 925 | Ga0105242_10005358 | |||
| 926 | Ga0105242_10007591 | |||
| 927 | Ga0105242_10010444 | |||
| 928 | Ga0105242_10037585 | |||
| 929 | Ga0105242_10054985 | |||
| 930 | Ga0105242_10145417 | |||
| 931 | Ga0105242_10199854 | |||
| 932 | Ga0105242_10422704 | |||
| 933 | Ga0105242_10865536 | |||
| 934 | Ga0105242_10963474 | |||
| 935 | Ga0105248_10013594 | |||
| 936 | Ga0105248_10028125 | |||
| 937 | Ga0105248_10043727 | |||
| 938 | Ga0105248_10050640 | |||
| 939 | Ga0105248_10057566 | |||
| 940 | Ga0105248_10240442 | |||
| 941 | Ga0105248_10444410 | |||
| 942 | Ga0105248_10445791 | |||
| 943 | Ga0105248_10959812 | |||
| 944 | Ga0105248_10995698 | |||
| 945 | Ga0105248_11365609 | |||
| 946 | Ga0105248_11384375 | |||
| 947 | Ga0105237_10002574 | |||
| 948 | Ga0105237_10010399 | |||
| 949 | Ga0105237_10078645 | |||
| 950 | Ga0105237_10106453 | |||
| 951 | Ga0105237_10539953 | |||
| 952 | Ga0105237_10967871 | |||
| 953 | Ga0105237_11014069 | |||
| 954 | Ga0105238_10002330 | |||
| 955 | Ga0105238_10005599 | |||
| 956 | Ga0105238_10007323 | |||
| 957 | Ga0105238_10045201 | |||
| 958 | Ga0105238_10079332 | |||
| 959 | Ga0105238_10081446 | |||
| 960 | Ga0105238_10103063 | |||
| 961 | Ga0105238_10142322 | |||
| 962 | Ga0105238_10191073 | |||
| 963 | Ga0105238_10220047 | |||
| 964 | Ga0105238_10257952 | |||
| 965 | Ga0105238_10702016 | |||
| 966 | Ga0105249_10047300 | |||
| 967 | Ga0105249_10092764 | |||
| 968 | Ga0105249_10166426 | |||
| 969 | Ga0105249_10922264 | |||
| 970 | Ga0105249_11207625 | |||
| 971 | Ga0105249_11936705 | |||
| 972 | Ga0105239_10002707 | |||
| 973 | Ga0105239_10010040 | |||
| 974 | Ga0105239_10014444 | |||
| 975 | Ga0105239_10148463 | |||
| 976 | Ga0105239_10572945 | |||
| 977 | Ga0105239_10876768 | |||
| 978 | Ga0105246_10035862 | |||
| 979 | Ga0105246_10048356 | |||
| 980 | Ga0105246_10311615 | |||
| 981 | Ga0105246_11419368 | |||
| 982 | Ga0105246_11969421 | |||
| 983 | Ga0157371_10741259 | |||
| 984 | Ga0157370_10003445 | |||
| 985 | Ga0157370_10007799 | |||
| 986 | Ga0157370_10037406 | |||
| 987 | Ga0157370_10042165 | |||
| 988 | Ga0157370_10210846 | |||
| 989 | Ga0157369_10018664 | |||
| 990 | Ga0157369_10020006 | |||
| 991 | Ga0157369_10034141 | |||
| 992 | Ga0157369_10114163 | |||
| 993 | Ga0157369_10170631 | |||
| 994 | Ga0157369_10824633 | |||
| 995 | Ga0157369_11104501 | |||
| 996 | Ga0157374_10021267 | |||
| 997 | Ga0157374_10065363 | |||
| 998 | Ga0157374_10076271 | |||
| 999 | Ga0157374_10170185 | |||
| 1000 | Ga0157374_10306692 | |||
| 1001 | Ga0157374_10467433 | |||
| 1002 | Ga0157374_10878503 | |||
| 1003 | Ga0157374_12586730 | |||
| 1004 | Ga0157378_10009401 | |||
| 1005 | Ga0157378_10009797 | |||
| 1006 | Ga0157378_10439128 | |||
| 1007 | Ga0157378_10476488 | |||
| 1008 | Ga0157378_10564519 | |||
| 1009 | Ga0157378_11244303 | |||
| 1010 | Ga0157378_12812948 | |||
| 1011 | Ga0163162_10079147 | |||
| 1012 | Ga0163162_10100848 | |||
| 1013 | Ga0163162_10574467 | |||
| 1014 | Ga0163162_10747241 | |||
| 1015 | Ga0163162_10776139 | |||
| 1016 | Ga0157372_10011100 | |||
| 1017 | Ga0157372_10033562 | |||
| 1018 | Ga0157372_10139669 | |||
| 1019 | Ga0157372_10640085 | |||
| 1020 | Ga0157372_12543205 | |||
| 1021 | Ga0157375_10013161 | |||
| 1022 | Ga0157375_10013936 | |||
| 1023 | Ga0157375_10032649 | |||
| 1024 | Ga0157375_10252761 | |||
| 1025 | Ga0157375_10321639 | |||
| 1026 | Ga0163163_10004862 | |||
| 1027 | Ga0163163_10020608 | |||
| 1028 | Ga0163163_10025231 | |||
| 1029 | Ga0163163_10142584 | |||
| 1030 | Ga0163163_10221650 | |||
| 1031 | Ga0163163_10314698 | |||
| 1032 | Ga0163163_10662449 | |||
| 1033 | Ga0163163_11288034 | |||
| 1034 | Ga0157380_11250760 | |||
| 1035 | Ga0157377_10510043 | |||
| 1036 | Ga0157377_11131466 | |||
| 1037 | Ga0157379_10017491 | |||
| 1038 | Ga0157379_10105485 | |||
| 1039 | Ga0157379_10768123 | |||
| 1040 | Ga0157376_10058885 | |||
| 1041 | Ga0157376_10357485 | |||
| 1042 | Ga0157376_10602797 | |||
| 1043 | Ga0157376_10986358 | |||
| 1044 | Ga0157376_12998586 | |||
| 1045 | Ga0182007_10253188 | |||
| 1046 | Ga0163161_11317434 | |||
| 1047 | Ga0207697_10123622 | |||
| 1048 | Ga0207692_10257467 | |||
| 1049 | Ga0207642_10333976 | |||
| 1050 | Ga0207642_10645969 | |||
| 1051 | Ga0207710_10373404 | |||
| 1052 | Ga0207680_10510924 | |||
| 1053 | Ga0207685_10774129 | |||
| 1054 | Ga0207705_10106917 | |||
| 1055 | Ga0207705_10412777 | |||
| 1056 | Ga0207654_10012234 | |||
| 1057 | Ga0207654_10074589 | |||
| 1058 | Ga0207654_10152255 | |||
| 1059 | Ga0207654_10172515 | |||
| 1060 | Ga0207654_10586279 | |||
| 1061 | Ga0207654_10750961 | |||
| 1062 | Ga0207707_10000744 | |||
| 1063 | Ga0207707_10007810 | |||
| 1064 | Ga0207707_10016349 | |||
| 1065 | Ga0207707_10087233 | |||
| 1066 | Ga0207707_10109190 | |||
| 1067 | Ga0207707_10371090 | |||
| 1068 | Ga0207695_10003011 | |||
| 1069 | Ga0207695_10010314 | |||
| 1070 | Ga0207695_10015585 | |||
| 1071 | Ga0207695_10027113 | |||
| 1072 | Ga0207695_10033326 | |||
| 1073 | Ga0207695_10188447 | |||
| 1074 | Ga0207695_10392741 | |||
| 1075 | Ga0207671_10011172 | |||
| 1076 | Ga0207671_10187048 | |||
| 1077 | Ga0207663_10151276 | |||
| 1078 | Ga0207663_10168720 | |||
| 1079 | Ga0207663_10170687 | |||
| 1080 | Ga0207663_10385294 | |||
| 1081 | Ga0207663_11516890 | |||
| 1082 | Ga0207662_10267186 | |||
| 1083 | Ga0207657_10007491 | |||
| 1084 | Ga0207657_10077384 | |||
| 1085 | Ga0207657_10216333 | |||
| 1086 | Ga0207649_10062779 | |||
| 1087 | Ga0207649_11327918 | |||
| 1088 | Ga0207652_10004664 | |||
| 1089 | Ga0207652_10034897 | |||
| 1090 | Ga0207652_10070113 | |||
| 1091 | Ga0207652_10548652 | |||
| 1092 | Ga0207652_10661857 | |||
| 1093 | Ga0207652_10959707 | |||
| 1094 | Ga0207681_11641345 | |||
| 1095 | Ga0207694_10001024 | |||
| 1096 | Ga0207694_10003038 | |||
| 1097 | Ga0207694_10007367 | |||
| 1098 | Ga0207694_10009550 | |||
| 1099 | Ga0207694_10029999 | |||
| 1100 | Ga0207694_10068475 | |||
| 1101 | Ga0207694_10144600 | |||
| 1102 | Ga0207694_10168173 | |||
| 1103 | Ga0207694_10178218 | |||
| 1104 | Ga0207687_10001024 | |||
| 1105 | Ga0207687_10005986 | |||
| 1106 | Ga0207687_10011261 | |||
| 1107 | Ga0207687_10022491 | |||
| 1108 | Ga0207687_10054401 | |||
| 1109 | Ga0207687_10117439 | |||
| 1110 | Ga0207687_10245208 | |||
| 1111 | Ga0207687_10807211 | |||
| 1112 | Ga0207687_10936890 | |||
| 1113 | Ga0207700_10003830 | |||
| 1114 | Ga0207700_10010156 | |||
| 1115 | Ga0207700_10505501 | |||
| 1116 | Ga0207664_10290875 | |||
| 1117 | Ga0207644_10009905 | |||
| 1118 | Ga0207644_10213421 | |||
| 1119 | Ga0207690_10010120 | |||
| 1120 | Ga0207690_10046758 | |||
| 1121 | Ga0207706_10099144 | |||
| 1122 | Ga0207686_10019609 | |||
| 1123 | Ga0207686_10034991 | |||
| 1124 | Ga0207686_10136398 | |||
| 1125 | Ga0207686_10337426 | |||
| 1126 | Ga0207686_10340961 | |||
| 1127 | Ga0207686_10501919 | |||
| 1128 | Ga0207686_11658898 | |||
| 1129 | Ga0207686_11662571 | |||
| 1130 | Ga0207709_10137437 | |||
| 1131 | Ga0207709_10253883 | |||
| 1132 | Ga0207709_11185487 | |||
| 1133 | Ga0207709_11226989 | |||
| 1134 | Ga0207709_11491900 | |||
| 1135 | Ga0207670_10336593 | |||
| 1136 | Ga0207669_10508778 | |||
| 1137 | Ga0207669_11582515 | |||
| 1138 | Ga0207704_10004284 | |||
| 1139 | Ga0207704_10017892 | |||
| 1140 | Ga0207704_10037431 | |||
| 1141 | Ga0207704_11387581 | |||
| 1142 | Ga0207665_10961895 | |||
| 1143 | Ga0207691_10236200 | |||
| 1144 | Ga0207711_10006913 | |||
| 1145 | Ga0207711_10026639 | |||
| 1146 | Ga0207711_10027844 | |||
| 1147 | Ga0207711_10109520 | |||
| 1148 | Ga0207711_10362776 | |||
| 1149 | Ga0207711_10391406 | |||
| 1150 | Ga0207711_10758456 | |||
| 1151 | Ga0207711_11041816 | |||
| 1152 | Ga0207711_11907060 | |||
| 1153 | Ga0207689_10123497 | |||
| 1154 | Ga0207689_10141712 | |||
| 1155 | Ga0207689_10585674 | |||
| 1156 | Ga0207689_10660010 | |||
| 1157 | Ga0207689_11402602 | |||
| 1158 | Ga0207661_10001824 | |||
| 1159 | Ga0207661_10003946 | |||
| 1160 | Ga0207661_10185413 | |||
| 1161 | Ga0207661_10195352 | |||
| 1162 | Ga0207661_10317671 | |||
| 1163 | Ga0207661_10429209 | |||
| 1164 | Ga0207661_10644603 | |||
| 1165 | Ga0207679_10076373 | |||
| 1166 | Ga0207679_10272296 | |||
| 1167 | Ga0207679_10442901 | |||
| 1168 | Ga0207667_10001895 | |||
| 1169 | Ga0207667_10002299 | |||
| 1170 | Ga0207667_10004489 | |||
| 1171 | Ga0207667_10049522 | |||
| 1172 | Ga0207667_10187056 | |||
| 1173 | Ga0207667_10329498 | |||
| 1174 | Ga0207667_10763835 | |||
| 1175 | Ga0207667_11130214 | |||
| 1176 | Ga0207651_10021247 | |||
| 1177 | Ga0207712_10075582 | |||
| 1178 | Ga0207712_10772098 | |||
| 1179 | Ga0207712_11133342 | |||
| 1180 | Ga0207668_10319320 | |||
| 1181 | Ga0207640_10030039 | |||
| 1182 | Ga0207658_10164453 | |||
| 1183 | Ga0207658_10375712 | |||
| 1184 | Ga0207658_11443910 | |||
| 1185 | Ga0207677_10151705 | |||
| 1186 | Ga0207677_10259606 | |||
| 1187 | Ga0207677_11306909 | |||
| 1188 | Ga0207677_11383434 | |||
| 1189 | Ga0207677_11433528 | |||
| 1190 | Ga0207703_10003146 | |||
| 1191 | Ga0207703_10020197 | |||
| 1192 | Ga0207703_10096999 | |||
| 1193 | Ga0207703_10826758 | |||
| 1194 | Ga0207703_10918348 | |||
| 1195 | Ga0207703_12408995 | |||
| 1196 | Ga0207639_10070001 | |||
| 1197 | Ga0207639_10105016 | |||
| 1198 | Ga0207639_10453922 | |||
| 1199 | Ga0207639_10479625 | |||
| 1200 | Ga0207639_10625185 | |||
| 1201 | Ga0207639_10767445 | |||
| 1202 | Ga0207708_10453736 | |||
| 1203 | Ga0207702_10002419 | |||
| 1204 | Ga0207702_10026940 | |||
| 1205 | Ga0207702_10038047 | |||
| 1206 | Ga0207702_10061524 | |||
| 1207 | Ga0207702_10191507 | |||
| 1208 | Ga0207702_10243145 | |||
| 1209 | Ga0207702_10351809 | |||
| 1210 | Ga0207702_10660568 | |||
| 1211 | Ga0207641_10003019 | |||
| 1212 | Ga0207641_10399007 | |||
| 1213 | Ga0207641_10555725 | |||
| 1214 | Ga0207641_10584533 | |||
| 1215 | Ga0207641_10634655 | |||
| 1216 | Ga0207641_11715421 | |||
| 1217 | Ga0207648_10003227 | |||
| 1218 | Ga0207648_10295784 | |||
| 1219 | Ga0207648_11373084 | |||
| 1220 | Ga0207676_10090402 | |||
| 1221 | Ga0207676_10148459 | |||
| 1222 | Ga0207676_10267341 | |||
| 1223 | Ga0207676_10497763 | |||
| 1224 | Ga0207676_11327412 | |||
| 1225 | Ga0207674_10002011 | |||
| 1226 | Ga0207674_10005710 | |||
| 1227 | Ga0207674_10016193 | |||
| 1228 | Ga0207674_10018723 | |||
| 1229 | Ga0207674_10024250 | |||
| 1230 | Ga0207674_10180316 | |||
| 1231 | Ga0207675_100421629 | |||
| 1232 | Ga0207683_10348513 | |||
| 1233 | Ga0207683_10444193 | |||
| 1234 | Ga0207698_10015556 | |||
| 1235 | Ga0207698_10019341 | |||
| 1236 | Ga0207698_10177944 | |||
| 1237 | Ga0207698_10780053 | |||
| 1238 | Ga0207698_12069339 | |||
| 1239 | Ga0207698_12569735 | |||
| 1240 | Ga0268266_10027306 | |||
| 1241 | Ga0268266_10252324 | |||
| 1242 | Ga0268265_10994980 | |||
| 1243 | Ga0268264_10019626 | |||
| 1244 | Ga0268264_10038788 | |||
| 1245 | Ga0268264_10165130 | |||
| 1246 | Ga0268264_10193659 | |||
| 1247 | Ga0268264_10360690 | |||
| 1248 | Ga0268264_11560097 | |||
| 1249 | Ga0265338_10102948 | |||
| 1250 | Ga0265338_10525315 | |||
| 1251 | Ga0265329_10242115 | |||
| 1252 | Ga0265340_10131748 | |||
| 1253 | Ga0265339_10461288 | |||
| 1254 | Ga0265331_10356683 | |||
| 1255 | Ga0265331_10501522 | |||
| 1256 | Ga0265327_10443110 | |||
| 1257 | Ga0265313_10104209 | |||
| 1258 | Ga0265314_10001081 | |||
| 1259 | Ga0265314_10003587 | |||
| 1260 | Ga0265342_10428248 | |||
| 1261 | Ga0373934_0011468 | |||
| 1262 | Ga0373934_0066008 | |||
| 1263 | Ga0373934_0186372 | |||
| 1264 | Ga0373944_0049324 | |||
| 1265 | Ga0373944_0364272 | |||
| 1266 | Ga0373923_0314289 | |||
| 1267 | Ga0373953_0018971 | |||
| 1268 | Ga0373953_0113752 | |||
| 1269 | Ga0373954_0013640 | |||
| 1270 | Ga0373954_0290062 | |||
| 1271 | Ga0373956_0152447 | |||
| 1272 | Ga0373957_0031118 | |||
| 1273 | Ga0373957_0243233 | |||
| 1274 | Ga0373955_0091603 | |||
| 1275 | Ga0373955_0174238 | |||
| 1276 | Ga0373924_0171221 | |||
| 1277 | Ga0373924_0214838 | |||
| 1278 | Ga0373935_0355573 | |||
| 1279 | Ga0373935_0584320 | |||
| 1280 | Ga0373935_0662844 | |||
| 1281 | Ga0373935_0787286 | |||
| 1282 | Ga0373935_1160679 | |||
| 1283 | Ga0373927_0006060 | |||
| 1284 | Ga0373927_0688799 | |||
| 1285 | Ga0373933_0004065 | |||
| 1286 | Ga0373933_0057639 | |||
| 1287 | Ga0373933_0057903 | |||
| 1288 | Ga0373947_0605110 | |||
| 1289 | Ga0373937_0009613 | |||
| 1290 | Ga0373937_0009984 | |||
| 1291 | Ga0373937_0037646 | |||
| 1292 | Ga0373937_0082697 | |||
| 1293 | Ga0373937_1109425 | |||
| 1294 | Ga0373937_1421619 | |||
| 1295 | Ga0373937_2013225 | |||
| 1296 | Ga0373925_0024539 | |||
| 1297 | Ga0373925_0228248 | |||
| 1298 | Ga0373925_0381365 | |||
| 1299 | Ga0373925_0557302 | |||
| 1300 | Ga0373925_0669582 | |||
| 1301 | Ga0373925_0871908 | |||
| 1302 | Ga0439448_0073438 | |||
| 1303 | Ga0466963_0900400 | |||
| 1304 | Ga0451576_0632343 | |||
| 1305 | Ga0451576_1801825 | |||
| 1306 | Ga0495592_0424862 | |||
| 1307 | Ga0495603_0626003 | |||
| 1308 | Ga0495629_0703775 | |||
| 1309 | Ga0495580_0035641 | |||
| 1310 | Ga0495580_0072306 | |||
| 1311 | Ga0495580_0077318 | |||
| 1312 | Ga0495580_0098392 | |||
| 1313 | Ga0495580_0098823 | |||
| 1314 | Ga0495580_0720863 | |||
| 1315 | Ga0495580_0813053 | |||
| 1316 | Ga0495582_0049985 | |||
| 1317 | Ga0495582_0498249 | |||
| 1318 | Ga0495639_0087558 | |||
| 1319 | Ga0495652_0118088 | |||
| 1320 | Ga0495652_0174695 | |||
| 1321 | Ga0495652_0396689 | |||
| 1322 | Ga0495652_0694819 | |||
| 1323 | Ga0495665_0074155 | |||
| 1324 | Ga0495665_0088050 | |||
| 1325 | Ga0495665_0368704 | |||
| 1326 | Ga0495586_0577893 | |||
| 1327 | Ga0495587_0016659 | |||
| 1328 | Ga0495587_0019030 | |||
| 1329 | Ga0495645_0263375 | |||
| 1330 | Ga0495645_0308725 | |||
| 1331 | Ga0495667_0081508 | |||
| 1332 | Ga0495667_0659922 | |||
| 1333 | Ga0495634_0285539 | |||
| 1334 | Ga0495635_0460815 | |||
| 1335 | Ga0495599_0013497 | |||
| 1336 | Ga0495646_0672169 | |||
| 1337 | Ga0495658_0703085 | |||
| 1338 | Ga0495613_0160780 | |||
| 1339 | Ga0495624_0570708 | |||
| 1340 | Ga0495600_0448890 | |||
| 1341 | Ga0495581_0789698 | |||
| 1342 | Ga0495674_0804274 | |||
| 1343 | Ga0495676_0312735 | |||
| 1344 | Ga0495680_0086942 | |||
| 1345 | Ga0495680_1066815 | |||
| 1346 | Ga0495675_0513321 | |||
| 1347 | Ga0495675_0641388 | |||
| 1348 | Ga0495684_0218717 | |||
| 1349 | Ga0495684_0239159 | |||
| 1350 | Ga0495684_0380968 | |||
| 1351 | Ga0495684_1063816 | |||
| 1352 | Ga0495602_0182725 | |||
| 1353 | Ga0496112_0588996 | |||
| 1354 | Ga0496115_0213731 | |||
| 1355 | Ga0496115_0381539 | |||
| 1356 | Ga0501040_0776356 | |||
| 1357 | Ga0501045_0443615 | |||
| 1358 | nmdc:mga0qj67_253037_c1 | |||
| 1359 | nmdc:mga0n895_826430_c1 | |||
| 1360 | nmdc:mga08x19_569754_c1 | |||
| 1361 | Ga0495601_0382222 | |||
| 1362 | Ga0495601_0633622 | |||
| 1363 | Ga0495612_0253959 | |||
| 1364 | Ga0495619_0630432 | |||
| 1365 | Ga0495619_1060824 | |||
| 1366 | Ga0500568_0002530 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4w4m-assembly10.cif.gz_J | crystal structure of prgk 19-92 | 0.7705 | 12 | 84 |
| 2y9j-assembly1.cif.gz_Y | three-dimensional model of salmonella's needle complex at subnanometer resolution | 0.7547 | 14 | 87 |
| 3u0o-assembly1.cif.gz_A | the crystal structure of selenophosphate synthetase from e. coli | 0.7498 | 55 | 83 |
| 4w4m-assembly10.cif.gz_J | crystal structure of prgk 19-92 | 0.7496 | 12 | 84 |
| 1yj7-assembly1.cif.gz_A | crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj | 0.7478 | 12 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AD21_4_109_2.60.40.1130 | Mainly Beta;Sandwich;Immunoglobulin-like;Rab geranylgeranyltransferase alpha-subunit, insert domain | 0.7926 | 23 | 81 | 2.60.40.1130 |
| 1yj7B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 | 0.7432 | 14 | 87 | 3.30.70.1530 |
| af_P09391_1_67_3.30.70.2350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7294 | 14 | 77 | 3.30.70.2350 |
| 2hfvA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain | 0.713 | 13 | 83 | 3.30.70.790 |
| 1yj7B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 | 0.6689 | 14 | 87 | 3.30.70.1530 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522BLE3-F1-model_v4 | DUF2007 domain-containing protein | 0.8842 | 10 | 79 |
|
| AF-A0A3D3XPD8-F1-model_v4 | DUF2007 domain-containing protein | 0.8737 | 11 | 79 |
|
| AF-Q9WY53-F1-model_v4 | DUF2007 domain-containing protein | 0.8671 | 12 | 79 |
|
| AF-A0A7C5C5T0-F1-model_v4 | DUF2007 domain-containing protein | 0.8489 | 12 | 79 |
|
| AF-A0A3D1ATM7-F1-model_v4 | DUF2007 domain-containing protein | 0.8476 | 2 | 86 |
|