F474233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 250 | 1344 | 257 |
Family's Representative Sequence
| Representative Sequence | 3300022732|Ga0224569_101792|Ga0224569_1017921 |
| Length | 283 |
| Sequence | VSPVPHHTSNRHPPTHLTRSSTIARVSNAVRIGILGDFNSEFRSHPATADSLQHAARKLDLKVESEWIPTSSLTAPGAEKLLESFDGLWASPGSPYKSFDGMLKGIEFARRRDWPFLGTCGGFQYALIEFARNVLGIADADSAENNSGSKNIVIYPVACAVPNRKGDAPKLSGKVPEIRLRPGSYLQSFYGKDKEIVTEEFFCNFEVNPEYEWATMEAGFPVVARGSQGEIRAIESPTHRFFIATLFQPQLSSTEKNPHPIVLAFVQAAADWERKKLDDSVLE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 109 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 110 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 237 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.07 |
| Metatranscriptomes | 1.93 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.8 |
| Rhizosphere | 94.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0224569_101792 | 3300022732 | Bacteria | 1776 |
| 2 | rootL2_10039505 | 3300003322 | Bacteria | 1766 |
| 3 | Ga0065712_10035299 | 3300005290 | Bacteria | 858 |
| 4 | Ga0065712_10113431 | 3300005290 | Unclassified | 1783 |
| 5 | Ga0065715_10006424 | 3300005293 | Unclassified | 4073 |
| 6 | Ga0065715_10201311 | 3300005293 | Bacteria | 1360 |
| 7 | Ga0070658_10123318 | 3300005327 | Unclassified | 2154 |
| 8 | Ga0070676_10013263 | 3300005328 | Unclassified | 4514 |
| 9 | Ga0070676_10223502 | 3300005328 | Bacteria | 1245 |
| 10 | Ga0070683_100114474 | 3300005329 | Bacteria | 2545 |
| 11 | Ga0070690_100012913 | 3300005330 | Bacteria | 4924 |
| 12 | Ga0070690_100061327 | 3300005330 | Unclassified | 2422 |
| 13 | Ga0068869_100013215 | 3300005334 | Bacteria | 5485 |
| 14 | Ga0068869_100281927 | 3300005334 | Unclassified | 1336 |
| 15 | Ga0070682_100005954 | 3300005337 | Bacteria | 6826 |
| 16 | Ga0068868_100017815 | 3300005338 | Bacteria | 5298 |
| 17 | Ga0068868_100023467 | 3300005338 | Bacteria | 4669 |
| 18 | Ga0068868_100060269 | 3300005338 | Bacteria | 3004 |
| 19 | Ga0068868_100061637 | 3300005338 | Unclassified | 2972 |
| 20 | Ga0068868_100411987 | 3300005338 | Unclassified | 1168 |
| 21 | Ga0070660_100022564 | 3300005339 | Unclassified | 4656 |
| 22 | Ga0070660_100145507 | 3300005339 | Bacteria | 1903 |
| 23 | Ga0070689_100005861 | 3300005340 | Bacteria | 8438 |
| 24 | Ga0070691_10055823 | 3300005341 | Bacteria | 1892 |
| 25 | Ga0070687_100000582 | 3300005343 | Bacteria | 12165 |
| 26 | Ga0070661_100018482 | 3300005344 | Bacteria | 4955 |
| 27 | Ga0070661_100263287 | 3300005344 | Bacteria | 1333 |
| 28 | Ga0070668_100099498 | 3300005347 | Unclassified | 2302 |
| 29 | Ga0070669_100097027 | 3300005353 | Bacteria | 2218 |
| 30 | Ga0070671_100163380 | 3300005355 | Bacteria | 1882 |
| 31 | Ga0070674_100438623 | 3300005356 | Unclassified | 1075 |
| 32 | Ga0070688_100069454 | 3300005365 | Unclassified | 2249 |
| 33 | Ga0070659_100057136 | 3300005366 | Bacteria | 3076 |
| 34 | Ga0070667_100799666 | 3300005367 | Unclassified | 875 |
| 35 | Ga0070709_10000350 | 3300005434 | Bacteria | 28601 |
| 36 | Ga0070709_10010911 | 3300005434 | Bacteria | 5045 |
| 37 | Ga0070709_10049410 | 3300005434 | Bacteria | 2630 |
| 38 | Ga0070709_10125242 | 3300005434 | Archaea | 1747 |
| 39 | Ga0070709_10147660 | 3300005434 | Viruses | 1622 |
| 40 | Ga0070709_10208628 | 3300005434 | Bacteria | 1388 |
| 41 | Ga0070709_10259569 | 3300005434 | Bacteria | 1255 |
| 42 | Ga0070709_10374189 | 3300005434 | Bacteria | 1057 |
| 43 | Ga0070709_10493374 | 3300005434 | Bacteria | 929 |
| 44 | Ga0070714_100000040 | 3300005435 | Bacteria | 119253 |
| 45 | Ga0070714_100086292 | 3300005435 | Bacteria | 2743 |
| 46 | Ga0070714_100215936 | 3300005435 | Bacteria | 1760 |
| 47 | Ga0070714_100268585 | 3300005435 | Unclassified | 1581 |
| 48 | Ga0070714_100390860 | 3300005435 | Unclassified | 1313 |
| 49 | Ga0070714_100467080 | 3300005435 | Unclassified | 1200 |
| 50 | Ga0070713_100000178 | 3300005436 | Bacteria | 42547 |
| 51 | Ga0070713_100002882 | 3300005436 | Bacteria | 11254 |
| 52 | Ga0070713_100014973 | 3300005436 | Bacteria | 5775 |
| 53 | Ga0070713_100017734 | 3300005436 | Bacteria | 5395 |
| 54 | Ga0070713_100035427 | 3300005436 | Bacteria | 4017 |
| 55 | Ga0070713_100040335 | 3300005436 | Unclassified | 3795 |
| 56 | Ga0070713_100141726 | 3300005436 | Bacteria | 2130 |
| 57 | Ga0070710_10019628 | 3300005437 | Unclassified | 3496 |
| 58 | Ga0070710_10021173 | 3300005437 | Unclassified | 3384 |
| 59 | Ga0070710_10335297 | 3300005437 | Bacteria | 997 |
| 60 | Ga0070711_100002684 | 3300005439 | Bacteria | 10211 |
| 61 | Ga0070711_100047623 | 3300005439 | Unclassified | 2928 |
| 62 | Ga0070711_100063209 | 3300005439 | Bacteria | 2583 |
| 63 | Ga0070711_100184038 | 3300005439 | Unclassified | 1601 |
| 64 | Ga0070705_100045687 | 3300005440 | Bacteria | 2521 |
| 65 | Ga0070705_100056713 | 3300005440 | Bacteria | 2308 |
| 66 | Ga0070705_100449926 | 3300005440 | Unclassified | 966 |
| 67 | Ga0070708_100001730 | 3300005445 | Bacteria | 16760 |
| 68 | Ga0070708_100006238 | 3300005445 | Bacteria | 9478 |
| 69 | Ga0070708_100046827 | 3300005445 | Bacteria | 3817 |
| 70 | Ga0070708_100088748 | 3300005445 | Bacteria | 2812 |
| 71 | Ga0070708_100156793 | 3300005445 | Bacteria | 2120 |
| 72 | Ga0070708_100305126 | 3300005445 | Bacteria | 1499 |
| 73 | Ga0070708_100369357 | 3300005445 | Bacteria | 1352 |
| 74 | Ga0070708_100874834 | 3300005445 | Bacteria | 844 |
| 75 | Ga0070678_100103711 | 3300005456 | Bacteria | 2210 |
| 76 | Ga0070681_10000160 | 3300005458 | Bacteria | 50922 |
| 77 | Ga0070681_10006674 | 3300005458 | Bacteria | 11229 |
| 78 | Ga0070681_10032373 | 3300005458 | Bacteria | 5246 |
| 79 | Ga0070681_10051200 | 3300005458 | Bacteria | 4119 |
| 80 | Ga0068867_100025620 | 3300005459 | Bacteria | 4233 |
| 81 | Ga0068867_100049792 | 3300005459 | Bacteria | 3084 |
| 82 | Ga0070685_10009968 | 3300005466 | Unclassified | 4929 |
| 83 | Ga0070706_100000434 | 3300005467 | Bacteria | 50174 |
| 84 | Ga0070706_100000747 | 3300005467 | Bacteria | 36530 |
| 85 | Ga0070706_100001372 | 3300005467 | Bacteria | 25863 |
| 86 | Ga0070706_100039142 | 3300005467 | Unclassified | 4378 |
| 87 | Ga0070706_100089628 | 3300005467 | Unclassified | 2852 |
| 88 | Ga0070706_100108786 | 3300005467 | Bacteria | 2579 |
| 89 | Ga0070706_100197748 | 3300005467 | Bacteria | 1878 |
| 90 | Ga0070707_100001963 | 3300005468 | Bacteria | 19671 |
| 91 | Ga0070707_100145893 | 3300005468 | Bacteria | 2303 |
| 92 | Ga0070707_100207559 | 3300005468 | Bacteria | 1909 |
| 93 | Ga0070707_100443418 | 3300005468 | Bacteria | 1259 |
| 94 | Ga0070698_100000558 | 3300005471 | Bacteria | 39929 |
| 95 | Ga0070698_100000584 | 3300005471 | Bacteria | 39203 |
| 96 | Ga0070698_100009189 | 3300005471 | Bacteria | 10608 |
| 97 | Ga0070698_100016837 | 3300005471 | Bacteria | 7710 |
| 98 | Ga0070698_100107731 | 3300005471 | Bacteria | 2754 |
| 99 | Ga0070699_100000648 | 3300005518 | Bacteria | 32606 |
| 100 | Ga0070699_100007853 | 3300005518 | Bacteria | 9268 |
| 101 | Ga0070699_100386582 | 3300005518 | Unclassified | 1264 |
| 102 | Ga0070679_100003769 | 3300005530 | Bacteria | 13909 |
| 103 | Ga0070679_100018592 | 3300005530 | Bacteria | 6747 |
| 104 | Ga0070684_100003906 | 3300005535 | Bacteria | 11288 |
| 105 | Ga0070684_100025479 | 3300005535 | Bacteria | 4973 |
| 106 | Ga0070684_100273249 | 3300005535 | Bacteria | 1547 |
| 107 | Ga0070697_100000814 | 3300005536 | Bacteria | 23385 |
| 108 | Ga0070697_100000951 | 3300005536 | Bacteria | 21825 |
| 109 | Ga0070697_100001885 | 3300005536 | Bacteria | 16026 |
| 110 | Ga0070697_100003676 | 3300005536 | Bacteria | 11794 |
| 111 | Ga0070697_100105732 | 3300005536 | Bacteria | 2342 |
| 112 | Ga0070697_100190389 | 3300005536 | Bacteria | 1741 |
| 113 | Ga0068853_100054090 | 3300005539 | Bacteria | 3459 |
| 114 | Ga0068853_100082707 | 3300005539 | Bacteria | 2812 |
| 115 | Ga0068853_100092976 | 3300005539 | Bacteria | 2654 |
| 116 | Ga0068853_100204066 | 3300005539 | Bacteria | 1799 |
| 117 | Ga0068853_100325257 | 3300005539 | Bacteria | 1426 |
| 118 | Ga0070672_100247316 | 3300005543 | Unclassified | 1501 |
| 119 | Ga0070672_100290603 | 3300005543 | Bacteria | 1384 |
| 120 | Ga0070686_100006943 | 3300005544 | Bacteria | 6308 |
| 121 | Ga0070686_100132445 | 3300005544 | Bacteria | 1726 |
| 122 | Ga0070695_100083501 | 3300005545 | Bacteria | 2116 |
| 123 | Ga0070695_100412772 | 3300005545 | Bacteria | 1026 |
| 124 | Ga0070696_100035796 | 3300005546 | Unclassified | 3419 |
| 125 | Ga0070693_100144112 | 3300005547 | Bacteria | 1503 |
| 126 | Ga0070665_100319966 | 3300005548 | Bacteria | 1556 |
| 127 | Ga0070665_100814246 | 3300005548 | Bacteria | 947 |
| 128 | Ga0068855_100000151 | 3300005563 | Bacteria | 88133 |
| 129 | Ga0068855_100002998 | 3300005563 | Bacteria | 20641 |
| 130 | Ga0068855_100007501 | 3300005563 | Bacteria | 13205 |
| 131 | Ga0068855_100158694 | 3300005563 | Bacteria | 2568 |
| 132 | Ga0068855_100180524 | 3300005563 | Bacteria | 2386 |
| 133 | Ga0068855_100357941 | 3300005563 | Bacteria | 1606 |
| 134 | Ga0068855_100619694 | 3300005563 | Unclassified | 1165 |
| 135 | Ga0070664_100001009 | 3300005564 | Bacteria | 22089 |
| 136 | Ga0070664_100022499 | 3300005564 | Bacteria | 5198 |
| 137 | Ga0068857_100004121 | 3300005577 | Bacteria | 12246 |
| 138 | Ga0068857_100013259 | 3300005577 | Bacteria | 7179 |
| 139 | Ga0068857_100041231 | 3300005577 | Bacteria | 4094 |
| 140 | Ga0068854_100018457 | 3300005578 | Bacteria | 4683 |
| 141 | Ga0068854_100024280 | 3300005578 | Unclassified | 4148 |
| 142 | Ga0068856_100000119 | 3300005614 | Bacteria | 78324 |
| 143 | Ga0068856_100000220 | 3300005614 | Bacteria | 61662 |
| 144 | Ga0068856_100003015 | 3300005614 | Bacteria | 17242 |
| 145 | Ga0068856_100016341 | 3300005614 | Bacteria | 7180 |
| 146 | Ga0068856_100126556 | 3300005614 | Unclassified | 2558 |
| 147 | Ga0070702_100021933 | 3300005615 | Unclassified | 3369 |
| 148 | Ga0068852_100004234 | 3300005616 | Bacteria | 10130 |
| 149 | Ga0068852_100367720 | 3300005616 | Unclassified | 1408 |
| 150 | Ga0068864_100302837 | 3300005618 | Bacteria | 1497 |
| 151 | Ga0068864_100822900 | 3300005618 | Unclassified | 914 |
| 152 | Ga0068866_10002344 | 3300005718 | Bacteria | 7847 |
| 153 | Ga0068866_10024488 | 3300005718 | Bacteria | 2823 |
| 154 | Ga0068866_10027378 | 3300005718 | Bacteria | 2702 |
| 155 | Ga0068866_10087690 | 3300005718 | Bacteria | 1687 |
| 156 | Ga0068861_100076355 | 3300005719 | Unclassified | 2611 |
| 157 | Ga0068861_100238477 | 3300005719 | Bacteria | 1546 |
| 158 | Ga0068851_10001808 | 3300005834 | Bacteria | 9364 |
| 159 | Ga0068851_10012496 | 3300005834 | Bacteria | 4004 |
| 160 | Ga0068851_10148137 | 3300005834 | Unclassified | 1281 |
| 161 | Ga0068851_10158244 | 3300005834 | Bacteria | 1242 |
| 162 | Ga0068870_10003367 | 3300005840 | Bacteria | 6766 |
| 163 | Ga0068863_100007048 | 3300005841 | Bacteria | 11015 |
| 164 | Ga0068863_100047123 | 3300005841 | Bacteria | 4090 |
| 165 | Ga0068863_100100228 | 3300005841 | Bacteria | 2753 |
| 166 | Ga0068863_100198091 | 3300005841 | Unclassified | 1931 |
| 167 | Ga0068858_100000231 | 3300005842 | Bacteria | 60174 |
| 168 | Ga0068858_100009662 | 3300005842 | Bacteria | 9192 |
| 169 | Ga0068858_100026194 | 3300005842 | Bacteria | 5421 |
| 170 | Ga0068860_100008540 | 3300005843 | Bacteria | 10206 |
| 171 | Ga0068860_100018877 | 3300005843 | Bacteria | 6700 |
| 172 | Ga0068860_100089234 | 3300005843 | Unclassified | 2935 |
| 173 | Ga0068860_100142298 | 3300005843 | Bacteria | 2306 |
| 174 | Ga0068860_100315622 | 3300005843 | Bacteria | 1533 |
| 175 | Ga0068862_100018399 | 3300005844 | Bacteria | 5817 |
| 176 | Ga0068862_100044682 | 3300005844 | Bacteria | 3779 |
| 177 | Ga0068862_100376089 | 3300005844 | Bacteria | 1324 |
| 178 | Ga0070717_10001091 | 3300006028 | Bacteria | 18238 |
| 179 | Ga0070717_10027214 | 3300006028 | Bacteria | 4569 |
| 180 | Ga0070717_10036944 | 3300006028 | Bacteria | 3964 |
| 181 | Ga0070717_10058945 | 3300006028 | Unclassified | 3175 |
| 182 | Ga0070717_10256775 | 3300006028 | Bacteria | 1545 |
| 183 | Ga0070717_10258189 | 3300006028 | Unclassified | 1541 |
| 184 | Ga0070717_10618156 | 3300006028 | Bacteria | 983 |
| 185 | Ga0070717_10807142 | 3300006028 | Unclassified | 854 |
| 186 | Ga0070715_10005647 | 3300006163 | Bacteria | 4190 |
| 187 | Ga0070715_10007956 | 3300006163 | Unclassified | 3673 |
| 188 | Ga0070715_10073805 | 3300006163 | Unclassified | 1531 |
| 189 | Ga0070716_100003422 | 3300006173 | Bacteria | 7459 |
| 190 | Ga0070716_100005229 | 3300006173 | Bacteria | 6272 |
| 191 | Ga0070716_100010931 | 3300006173 | Bacteria | 4566 |
| 192 | Ga0070716_100018364 | 3300006173 | Unclassified | 3642 |
| 193 | Ga0070716_100034625 | 3300006173 | Bacteria | 2771 |
| 194 | Ga0070716_100117962 | 3300006173 | Bacteria | 1656 |
| 195 | Ga0070716_100146637 | 3300006173 | Bacteria | 1513 |
| 196 | Ga0070716_100193569 | 3300006173 | Bacteria | 1346 |
| 197 | Ga0070712_100000302 | 3300006175 | Bacteria | 27828 |
| 198 | Ga0070712_100000516 | 3300006175 | Bacteria | 22235 |
| 199 | Ga0070712_100003211 | 3300006175 | Bacteria | 10076 |
| 200 | Ga0070712_100007006 | 3300006175 | Bacteria | 7028 |
| 201 | Ga0070712_100009124 | 3300006175 | Bacteria | 6244 |
| 202 | Ga0070712_100058734 | 3300006175 | Bacteria | 2706 |
| 203 | Ga0070712_100078505 | 3300006175 | Unclassified | 2383 |
| 204 | Ga0070712_100090820 | 3300006175 | Bacteria | 2237 |
| 205 | Ga0070712_100143551 | 3300006175 | Bacteria | 1825 |
| 206 | Ga0097621_100000073 | 3300006237 | Bacteria | 52012 |
| 207 | Ga0097621_100000591 | 3300006237 | Bacteria | 25513 |
| 208 | Ga0097621_100020148 | 3300006237 | Bacteria | 5136 |
| 209 | Ga0097621_100056516 | 3300006237 | Bacteria | 3206 |
| 210 | Ga0097621_100487469 | 3300006237 | Bacteria | 1115 |
| 211 | Ga0068871_100000697 | 3300006358 | Bacteria | 22812 |
| 212 | Ga0068871_100001411 | 3300006358 | Bacteria | 16074 |
| 213 | Ga0068871_100032583 | 3300006358 | Bacteria | 4118 |
| 214 | Ga0075433_10070900 | 3300006852 | Bacteria | 3063 |
| 215 | Ga0075433_10108651 | 3300006852 | Unclassified | 2460 |
| 216 | Ga0075434_100003427 | 3300006871 | Bacteria | 14182 |
| 217 | Ga0075434_100036813 | 3300006871 | Bacteria | 4840 |
| 218 | Ga0075434_100329258 | 3300006871 | Bacteria | 1548 |
| 219 | Ga0068865_100036167 | 3300006881 | Unclassified | 3327 |
| 220 | Ga0068865_100158816 | 3300006881 | Unclassified | 1722 |
| 221 | Ga0075436_100198127 | 3300006914 | Bacteria | 1422 |
| 222 | Ga0075435_100102803 | 3300007076 | Bacteria | 2369 |
| 223 | Ga0075435_100134262 | 3300007076 | Unclassified | 2072 |
| 224 | Ga0105250_10011749 | 3300009092 | Unclassified | 3630 |
| 225 | Ga0105240_10025067 | 3300009093 | Bacteria | 7850 |
| 226 | Ga0105240_10085017 | 3300009093 | Bacteria | 3878 |
| 227 | Ga0105240_10103929 | 3300009093 | Unclassified | 3450 |
| 228 | Ga0105240_10163838 | 3300009093 | Bacteria | 2638 |
| 229 | Ga0105240_10373039 | 3300009093 | Bacteria | 1613 |
| 230 | Ga0105240_10553302 | 3300009093 | Bacteria | 1273 |
| 231 | Ga0111539_10001725 | 3300009094 | Bacteria | 29105 |
| 232 | Ga0111539_10210790 | 3300009094 | Unclassified | 2264 |
| 233 | Ga0105245_10025564 | 3300009098 | Bacteria | 5194 |
| 234 | Ga0105245_10052216 | 3300009098 | Bacteria | 3666 |
| 235 | Ga0105245_10083843 | 3300009098 | Unclassified | 2918 |
| 236 | Ga0105245_10190851 | 3300009098 | Bacteria | 1962 |
| 237 | Ga0105245_10879158 | 3300009098 | Unclassified | 937 |
| 238 | Ga0105243_10235196 | 3300009148 | Unclassified | 1627 |
| 239 | Ga0105241_10012632 | 3300009174 | Bacteria | 6198 |
| 240 | Ga0105241_10014788 | 3300009174 | Bacteria | 5713 |
| 241 | Ga0105241_10039238 | 3300009174 | Bacteria | 3571 |
| 242 | Ga0105241_10048357 | 3300009174 | Bacteria | 3237 |
| 243 | Ga0105241_10089464 | 3300009174 | Bacteria | 2426 |
| 244 | Ga0105242_10051629 | 3300009176 | Bacteria | 3352 |
| 245 | Ga0105248_10092429 | 3300009177 | Bacteria | 3407 |
| 246 | Ga0105248_10166301 | 3300009177 | Bacteria | 2487 |
| 247 | Ga0105248_10281448 | 3300009177 | Bacteria | 1872 |
| 248 | Ga0105237_10078356 | 3300009545 | Bacteria | 3294 |
| 249 | Ga0105238_10000497 | 3300009551 | Bacteria | 41307 |
| 250 | Ga0105238_10062825 | 3300009551 | Bacteria | 3714 |
| 251 | Ga0105249_10008098 | 3300009553 | Bacteria | 9164 |
| 252 | Ga0099796_10160737 | 3300010159 | Bacteria | 890 |
| 253 | Ga0105239_10004107 | 3300010375 | Bacteria | 17507 |
| 254 | Ga0105239_10023933 | 3300010375 | Bacteria | 6727 |
| 255 | Ga0105239_10065852 | 3300010375 | Bacteria | 3980 |
| 256 | Ga0105239_10142754 | 3300010375 | Unclassified | 2669 |
| 257 | Ga0105239_10331209 | 3300010375 | Bacteria | 1717 |
| 258 | Ga0105239_10488933 | 3300010375 | Unclassified | 1399 |
| 259 | Ga0105239_11403149 | 3300010375 | Unclassified | 806 |
| 260 | Ga0105246_10002297 | 3300011119 | Bacteria | 11534 |
| 261 | Ga0157373_10114035 | 3300013100 | Unclassified | 1899 |
| 262 | Ga0157373_10220480 | 3300013100 | Bacteria | 1338 |
| 263 | Ga0157371_10018154 | 3300013102 | Bacteria | 5209 |
| 264 | Ga0157371_10022982 | 3300013102 | Bacteria | 4560 |
| 265 | Ga0157371_10306907 | 3300013102 | Unclassified | 1149 |
| 266 | Ga0157369_10000108 | 3300013105 | Bacteria | 117027 |
| 267 | Ga0157369_10042083 | 3300013105 | Bacteria | 4984 |
| 268 | Ga0157369_10046247 | 3300013105 | Unclassified | 4730 |
| 269 | Ga0157369_10255062 | 3300013105 | Bacteria | 1830 |
| 270 | Ga0157369_10609182 | 3300013105 | Unclassified | 1127 |
| 271 | Ga0157369_10867758 | 3300013105 | Bacteria | 926 |
| 272 | Ga0157374_10001195 | 3300013296 | Bacteria | 22177 |
| 273 | Ga0157374_10001477 | 3300013296 | Bacteria | 19860 |
| 274 | Ga0157374_10002238 | 3300013296 | Bacteria | 16295 |
| 275 | Ga0157374_10008126 | 3300013296 | Bacteria | 8967 |
| 276 | Ga0157374_10016227 | 3300013296 | Bacteria | 6544 |
| 277 | Ga0157374_10019923 | 3300013296 | Bacteria | 5946 |
| 278 | Ga0157374_10450777 | 3300013296 | Bacteria | 1288 |
| 279 | Ga0157378_10000030 | 3300013297 | Bacteria | 124811 |
| 280 | Ga0157378_10000099 | 3300013297 | Bacteria | 81561 |
| 281 | Ga0157378_10008641 | 3300013297 | Bacteria | 8864 |
| 282 | Ga0157378_10035410 | 3300013297 | Bacteria | 4415 |
| 283 | Ga0157378_10044565 | 3300013297 | Bacteria | 3940 |
| 284 | Ga0157378_10072246 | 3300013297 | Bacteria | 3100 |
| 285 | Ga0157378_10197277 | 3300013297 | Bacteria | 1902 |
| 286 | Ga0163162_10015270 | 3300013306 | Bacteria | 7502 |
| 287 | Ga0163162_10042764 | 3300013306 | Unclassified | 4535 |
| 288 | Ga0163162_10160719 | 3300013306 | Bacteria | 2368 |
| 289 | Ga0163162_10599879 | 3300013306 | Unclassified | 1227 |
| 290 | Ga0157372_10000576 | 3300013307 | Bacteria | 40151 |
| 291 | Ga0157372_10009048 | 3300013307 | Bacteria | 10583 |
| 292 | Ga0157372_10009135 | 3300013307 | Bacteria | 10530 |
| 293 | Ga0157372_10028758 | 3300013307 | Bacteria | 6067 |
| 294 | Ga0157372_10123660 | 3300013307 | Unclassified | 2974 |
| 295 | Ga0157372_10134785 | 3300013307 | Bacteria | 2843 |
| 296 | Ga0157372_10166588 | 3300013307 | Unclassified | 2548 |
| 297 | Ga0157372_10181702 | 3300013307 | Bacteria | 2435 |
| 298 | Ga0157375_10593977 | 3300013308 | Unclassified | 1267 |
| 299 | Ga0163163_10027104 | 3300014325 | Bacteria | 5484 |
| 300 | Ga0163163_10043414 | 3300014325 | Unclassified | 4407 |
| 301 | Ga0163163_10348719 | 3300014325 | Bacteria | 1536 |
| 302 | Ga0163163_10536694 | 3300014325 | Unclassified | 1232 |
| 303 | Ga0157380_10019134 | 3300014326 | Bacteria | 5100 |
| 304 | Ga0182008_10002806 | 3300014497 | Bacteria | 10777 |
| 305 | Ga0157377_10002339 | 3300014745 | Bacteria | 8357 |
| 306 | Ga0157379_10008128 | 3300014968 | Bacteria | 9113 |
| 307 | Ga0157379_10038083 | 3300014968 | Unclassified | 4290 |
| 308 | Ga0157379_10189082 | 3300014968 | Bacteria | 1861 |
| 309 | Ga0157379_10234981 | 3300014968 | Bacteria | 1662 |
| 310 | Ga0157376_10007486 | 3300014969 | Bacteria | 7802 |
| 311 | Ga0157376_10038390 | 3300014969 | Bacteria | 3896 |
| 312 | Ga0157376_10078486 | 3300014969 | Bacteria | 2827 |
| 313 | Ga0157376_10101993 | 3300014969 | Bacteria | 2509 |
| 314 | Ga0157376_10149985 | 3300014969 | Unclassified | 2101 |
| 315 | Ga0157376_10216058 | 3300014969 | Bacteria | 1773 |
| 316 | Ga0182006_1093894 | 3300015261 | Unclassified | 1074 |
| 317 | Ga0182007_10004978 | 3300015262 | Bacteria | 5916 |
| 318 | Ga0182007_10023467 | 3300015262 | Unclassified | 2168 |
| 319 | Ga0182005_1025472 | 3300015265 | Unclassified | 1614 |
| 320 | Ga0163161_10003125 | 3300017792 | Bacteria | 11672 |
| 321 | Ga0224569_102686 | 3300022732 | Unclassified | 1425 |
| 322 | Ga0224571_102495 | 3300022734 | Unclassified | 1170 |
| 323 | Ga0224572_1001779 | 3300024225 | Unclassified | 3302 |
| 324 | Ga0224572_1003555 | 3300024225 | Unclassified | 2641 |
| 325 | Ga0228598_1000043 | 3300024227 | Bacteria | 17812 |
| 326 | Ga0228598_1000726 | 3300024227 | Bacteria | 7053 |
| 327 | Ga0207697_10019520 | 3300025315 | Bacteria | 2776 |
| 328 | Ga0207692_10009477 | 3300025898 | Unclassified | 4071 |
| 329 | Ga0207642_10008283 | 3300025899 | Unclassified | 3557 |
| 330 | Ga0207642_10014854 | 3300025899 | Bacteria | 2885 |
| 331 | Ga0207710_10115117 | 3300025900 | Bacteria | 1280 |
| 332 | Ga0207688_10057239 | 3300025901 | Unclassified | 2191 |
| 333 | Ga0207647_10008012 | 3300025904 | Bacteria | 7598 |
| 334 | Ga0207647_10008692 | 3300025904 | Bacteria | 7255 |
| 335 | Ga0207647_10015621 | 3300025904 | Bacteria | 5199 |
| 336 | Ga0207647_10087607 | 3300025904 | Bacteria | 1859 |
| 337 | Ga0207685_10002145 | 3300025905 | Bacteria | 4437 |
| 338 | Ga0207685_10015555 | 3300025905 | Bacteria | 2413 |
| 339 | Ga0207685_10051654 | 3300025905 | Unclassified | 1589 |
| 340 | Ga0207699_10000578 | 3300025906 | Bacteria | 18048 |
| 341 | Ga0207699_10034971 | 3300025906 | Bacteria | 2855 |
| 342 | Ga0207699_10036809 | 3300025906 | Bacteria | 2793 |
| 343 | Ga0207699_10048345 | 3300025906 | Unclassified | 2498 |
| 344 | Ga0207699_10077329 | 3300025906 | Bacteria | 2053 |
| 345 | Ga0207699_10081677 | 3300025906 | Bacteria | 2006 |
| 346 | Ga0207699_10190222 | 3300025906 | Bacteria | 1385 |
| 347 | Ga0207699_10201584 | 3300025906 | Bacteria | 1349 |
| 348 | Ga0207699_10478647 | 3300025906 | Bacteria | 896 |
| 349 | Ga0207645_10003048 | 3300025907 | Bacteria | 12889 |
| 350 | Ga0207645_10107051 | 3300025907 | Bacteria | 1808 |
| 351 | Ga0207643_10000363 | 3300025908 | Bacteria | 30460 |
| 352 | Ga0207684_10000203 | 3300025910 | Bacteria | 91833 |
| 353 | Ga0207684_10000560 | 3300025910 | Bacteria | 45531 |
| 354 | Ga0207684_10000966 | 3300025910 | Bacteria | 32224 |
| 355 | Ga0207684_10003721 | 3300025910 | Bacteria | 14769 |
| 356 | Ga0207684_10165735 | 3300025910 | Bacteria | 1904 |
| 357 | Ga0207684_10271203 | 3300025910 | Unclassified | 1464 |
| 358 | Ga0207684_10393837 | 3300025910 | Bacteria | 1191 |
| 359 | Ga0207654_10035546 | 3300025911 | Bacteria | 2777 |
| 360 | Ga0207654_10128355 | 3300025911 | Unclassified | 1602 |
| 361 | Ga0207654_10144389 | 3300025911 | Bacteria | 1521 |
| 362 | Ga0207654_10159255 | 3300025911 | Bacteria | 1457 |
| 363 | Ga0207707_10003004 | 3300025912 | Bacteria | 14996 |
| 364 | Ga0207707_10005292 | 3300025912 | Bacteria | 11290 |
| 365 | Ga0207707_10076214 | 3300025912 | Bacteria | 2926 |
| 366 | Ga0207707_10117563 | 3300025912 | Bacteria | 2324 |
| 367 | Ga0207707_10378861 | 3300025912 | Unclassified | 1216 |
| 368 | Ga0207707_10635026 | 3300025912 | Bacteria | 901 |
| 369 | Ga0207695_10054089 | 3300025913 | Bacteria | 4195 |
| 370 | Ga0207695_10120523 | 3300025913 | Bacteria | 2592 |
| 371 | Ga0207695_10572675 | 3300025913 | Unclassified | 1011 |
| 372 | Ga0207671_10033453 | 3300025914 | Bacteria | 3825 |
| 373 | Ga0207671_10341144 | 3300025914 | Bacteria | 1187 |
| 374 | Ga0207693_10000071 | 3300025915 | Bacteria | 89988 |
| 375 | Ga0207693_10000373 | 3300025915 | Bacteria | 41202 |
| 376 | Ga0207693_10004195 | 3300025915 | Bacteria | 12218 |
| 377 | Ga0207693_10005083 | 3300025915 | Bacteria | 11026 |
| 378 | Ga0207693_10015729 | 3300025915 | Bacteria | 6063 |
| 379 | Ga0207693_10016451 | 3300025915 | Bacteria | 5909 |
| 380 | Ga0207693_10068637 | 3300025915 | Bacteria | 2775 |
| 381 | Ga0207663_10015835 | 3300025916 | Bacteria | 4169 |
| 382 | Ga0207663_10046547 | 3300025916 | Bacteria | 2673 |
| 383 | Ga0207663_10089819 | 3300025916 | Unclassified | 2035 |
| 384 | Ga0207663_10156469 | 3300025916 | Unclassified | 1604 |
| 385 | Ga0207663_10208696 | 3300025916 | Bacteria | 1414 |
| 386 | Ga0207663_10429722 | 3300025916 | Unclassified | 1015 |
| 387 | Ga0207660_10154978 | 3300025917 | Bacteria | 1763 |
| 388 | Ga0207660_10265251 | 3300025917 | Bacteria | 1359 |
| 389 | Ga0207662_10000664 | 3300025918 | Bacteria | 15610 |
| 390 | Ga0207657_10001432 | 3300025919 | Bacteria | 25493 |
| 391 | Ga0207657_10006629 | 3300025919 | Bacteria | 11986 |
| 392 | Ga0207657_10011646 | 3300025919 | Bacteria | 8720 |
| 393 | Ga0207649_10003934 | 3300025920 | Bacteria | 8101 |
| 394 | Ga0207649_10020337 | 3300025920 | Bacteria | 3806 |
| 395 | Ga0207652_10005098 | 3300025921 | Bacteria | 10660 |
| 396 | Ga0207652_10085577 | 3300025921 | Bacteria | 2763 |
| 397 | Ga0207652_10351587 | 3300025921 | Unclassified | 1330 |
| 398 | Ga0207646_10000657 | 3300025922 | Bacteria | 44736 |
| 399 | Ga0207646_10001084 | 3300025922 | Bacteria | 34596 |
| 400 | Ga0207646_10020896 | 3300025922 | Bacteria | 6057 |
| 401 | Ga0207646_10076903 | 3300025922 | Bacteria | 2983 |
| 402 | Ga0207646_10475507 | 3300025922 | Bacteria | 1127 |
| 403 | Ga0207681_10075603 | 3300025923 | Bacteria | 2363 |
| 404 | Ga0207681_10092393 | 3300025923 | Unclassified | 2163 |
| 405 | Ga0207694_10000864 | 3300025924 | Bacteria | 26978 |
| 406 | Ga0207694_10045564 | 3300025924 | Bacteria | 3387 |
| 407 | Ga0207694_10058027 | 3300025924 | Bacteria | 3011 |
| 408 | Ga0207694_10654826 | 3300025924 | Unclassified | 885 |
| 409 | Ga0207650_10000051 | 3300025925 | Bacteria | 168652 |
| 410 | Ga0207650_10087631 | 3300025925 | Bacteria | 2372 |
| 411 | Ga0207650_10613986 | 3300025925 | Unclassified | 915 |
| 412 | Ga0207659_10047131 | 3300025926 | Unclassified | 3047 |
| 413 | Ga0207687_10007789 | 3300025927 | Bacteria | 7026 |
| 414 | Ga0207687_10058509 | 3300025927 | Unclassified | 2712 |
| 415 | Ga0207687_10060643 | 3300025927 | Unclassified | 2669 |
| 416 | Ga0207687_10125026 | 3300025927 | Bacteria | 1929 |
| 417 | Ga0207700_10000089 | 3300025928 | Bacteria | 56639 |
| 418 | Ga0207700_10000151 | 3300025928 | Bacteria | 41533 |
| 419 | Ga0207700_10037360 | 3300025928 | Bacteria | 3516 |
| 420 | Ga0207700_10052468 | 3300025928 | Bacteria | 3049 |
| 421 | Ga0207700_10061467 | 3300025928 | Bacteria | 2849 |
| 422 | Ga0207700_10067798 | 3300025928 | Bacteria | 2733 |
| 423 | Ga0207700_10275864 | 3300025928 | Unclassified | 1445 |
| 424 | Ga0207700_10302096 | 3300025928 | Bacteria | 1382 |
| 425 | Ga0207700_10383563 | 3300025928 | Bacteria | 1229 |
| 426 | Ga0207700_10579687 | 3300025928 | Unclassified | 997 |
| 427 | Ga0207664_10000029 | 3300025929 | Bacteria | 183815 |
| 428 | Ga0207664_10002505 | 3300025929 | Bacteria | 12164 |
| 429 | Ga0207664_10076232 | 3300025929 | Bacteria | 2714 |
| 430 | Ga0207664_10112581 | 3300025929 | Bacteria | 2266 |
| 431 | Ga0207664_10425012 | 3300025929 | Unclassified | 1184 |
| 432 | Ga0207644_10186883 | 3300025931 | Unclassified | 1627 |
| 433 | Ga0207690_10281024 | 3300025932 | Bacteria | 1296 |
| 434 | Ga0207690_10377270 | 3300025932 | Unclassified | 1126 |
| 435 | Ga0207706_10000783 | 3300025933 | Bacteria | 32931 |
| 436 | Ga0207706_10013806 | 3300025933 | Bacteria | 7330 |
| 437 | Ga0207686_10016623 | 3300025934 | Unclassified | 4132 |
| 438 | Ga0207686_10205919 | 3300025934 | Bacteria | 1411 |
| 439 | Ga0207709_10136057 | 3300025935 | Bacteria | 1682 |
| 440 | Ga0207669_10134358 | 3300025937 | Bacteria | 1706 |
| 441 | Ga0207704_10047195 | 3300025938 | Bacteria | 2572 |
| 442 | Ga0207704_10138636 | 3300025938 | Bacteria | 1698 |
| 443 | Ga0207665_10001361 | 3300025939 | Bacteria | 16470 |
| 444 | Ga0207665_10005766 | 3300025939 | Bacteria | 8235 |
| 445 | Ga0207665_10033385 | 3300025939 | Bacteria | 3410 |
| 446 | Ga0207665_10044943 | 3300025939 | Bacteria | 2956 |
| 447 | Ga0207665_10050559 | 3300025939 | Bacteria | 2795 |
| 448 | Ga0207665_10116174 | 3300025939 | Bacteria | 1886 |
| 449 | Ga0207665_10175931 | 3300025939 | Unclassified | 1548 |
| 450 | Ga0207665_10333832 | 3300025939 | Unclassified | 1141 |
| 451 | Ga0207691_10005718 | 3300025940 | Bacteria | 12024 |
| 452 | Ga0207691_10153040 | 3300025940 | Unclassified | 2027 |
| 453 | Ga0207691_10347327 | 3300025940 | Bacteria | 1269 |
| 454 | Ga0207711_10002266 | 3300025941 | Bacteria | 17271 |
| 455 | Ga0207711_10024402 | 3300025941 | Bacteria | 5065 |
| 456 | Ga0207711_10088575 | 3300025941 | Bacteria | 2718 |
| 457 | Ga0207689_10000860 | 3300025942 | Bacteria | 29295 |
| 458 | Ga0207689_10001015 | 3300025942 | Bacteria | 26978 |
| 459 | Ga0207661_10000969 | 3300025944 | Bacteria | 18902 |
| 460 | Ga0207661_10098593 | 3300025944 | Bacteria | 2449 |
| 461 | Ga0207661_10111202 | 3300025944 | Bacteria | 2317 |
| 462 | Ga0207661_10257823 | 3300025944 | Unclassified | 1552 |
| 463 | Ga0207679_10000203 | 3300025945 | Bacteria | 47291 |
| 464 | Ga0207679_10008130 | 3300025945 | Bacteria | 6673 |
| 465 | Ga0207679_10026112 | 3300025945 | Bacteria | 4025 |
| 466 | Ga0207679_10054777 | 3300025945 | Bacteria | 2938 |
| 467 | Ga0207667_10001767 | 3300025949 | Bacteria | 27219 |
| 468 | Ga0207667_10015239 | 3300025949 | Bacteria | 8740 |
| 469 | Ga0207667_10023096 | 3300025949 | Bacteria | 6852 |
| 470 | Ga0207667_10060734 | 3300025949 | Bacteria | 3956 |
| 471 | Ga0207651_10011127 | 3300025960 | Bacteria | 5020 |
| 472 | Ga0207712_10027192 | 3300025961 | Bacteria | 3819 |
| 473 | Ga0207668_10404067 | 3300025972 | Unclassified | 1155 |
| 474 | Ga0207640_10014450 | 3300025981 | Bacteria | 4547 |
| 475 | Ga0207640_10041985 | 3300025981 | Bacteria | 2913 |
| 476 | Ga0207640_10221073 | 3300025981 | Bacteria | 1450 |
| 477 | Ga0207640_10520323 | 3300025981 | Unclassified | 994 |
| 478 | Ga0207658_10002771 | 3300025986 | Bacteria | 12627 |
| 479 | Ga0207658_10074272 | 3300025986 | Bacteria | 2583 |
| 480 | Ga0207677_10034909 | 3300026023 | Bacteria | 3261 |
| 481 | Ga0207677_10050795 | 3300026023 | Bacteria | 2807 |
| 482 | Ga0207677_10409368 | 3300026023 | Unclassified | 1152 |
| 483 | Ga0207703_10002784 | 3300026035 | Bacteria | 14952 |
| 484 | Ga0207703_10047615 | 3300026035 | Bacteria | 3458 |
| 485 | Ga0207703_10440686 | 3300026035 | Unclassified | 1215 |
| 486 | Ga0207639_10025861 | 3300026041 | Bacteria | 4259 |
| 487 | Ga0207639_10075734 | 3300026041 | Unclassified | 2647 |
| 488 | Ga0207639_10079614 | 3300026041 | Bacteria | 2590 |
| 489 | Ga0207639_10285962 | 3300026041 | Bacteria | 1452 |
| 490 | Ga0207639_10698024 | 3300026041 | Bacteria | 941 |
| 491 | Ga0207678_10001066 | 3300026067 | Bacteria | 25100 |
| 492 | Ga0207678_10078153 | 3300026067 | Bacteria | 2834 |
| 493 | Ga0207708_10098080 | 3300026075 | Bacteria | 2265 |
| 494 | Ga0207702_10000086 | 3300026078 | Bacteria | 106199 |
| 495 | Ga0207702_10000764 | 3300026078 | Bacteria | 34175 |
| 496 | Ga0207702_10915377 | 3300026078 | Unclassified | 869 |
| 497 | Ga0207641_10000025 | 3300026088 | Bacteria | 247727 |
| 498 | Ga0207641_10008135 | 3300026088 | Bacteria | 8684 |
| 499 | Ga0207641_10185082 | 3300026088 | Bacteria | 1910 |
| 500 | Ga0207641_10410976 | 3300026088 | Unclassified | 1301 |
| 501 | Ga0207641_10458734 | 3300026088 | Bacteria | 1233 |
| 502 | Ga0207641_10521001 | 3300026088 | Bacteria | 1156 |
| 503 | Ga0207641_10844326 | 3300026088 | Bacteria | 907 |
| 504 | Ga0207648_10000966 | 3300026089 | Bacteria | 32474 |
| 505 | Ga0207648_10018922 | 3300026089 | Bacteria | 6221 |
| 506 | Ga0207648_10049644 | 3300026089 | Unclassified | 3671 |
| 507 | Ga0207676_10002968 | 3300026095 | Bacteria | 12105 |
| 508 | Ga0207676_10396687 | 3300026095 | Unclassified | 1288 |
| 509 | Ga0207676_10624765 | 3300026095 | Unclassified | 1037 |
| 510 | Ga0207674_10000281 | 3300026116 | Bacteria | 64232 |
| 511 | Ga0207674_10001451 | 3300026116 | Bacteria | 30625 |
| 512 | Ga0207674_10050860 | 3300026116 | Bacteria | 4231 |
| 513 | Ga0207675_100052462 | 3300026118 | Unclassified | 3805 |
| 514 | Ga0207675_100282776 | 3300026118 | Bacteria | 1612 |
| 515 | Ga0207683_10000742 | 3300026121 | Bacteria | 29663 |
| 516 | Ga0207698_10191412 | 3300026142 | Unclassified | 1822 |
| 517 | Ga0207428_10159339 | 3300027907 | Bacteria | 1714 |
| 518 | Ga0265356_1000061 | 3300028017 | Bacteria | 17872 |
| 519 | Ga0265356_1005330 | 3300028017 | Bacteria | 1538 |
| 520 | Ga0268266_10012116 | 3300028379 | Bacteria | 7463 |
| 521 | Ga0268266_10041699 | 3300028379 | Bacteria | 3918 |
| 522 | Ga0268266_10765129 | 3300028379 | Bacteria | 932 |
| 523 | Ga0268265_10048950 | 3300028380 | Bacteria | 3176 |
| 524 | Ga0268264_10025027 | 3300028381 | Bacteria | 4877 |
| 525 | Ga0268264_10065356 | 3300028381 | Bacteria | 3065 |
| 526 | Ga0268264_10073669 | 3300028381 | Bacteria | 2899 |
| 527 | Ga0268264_10120172 | 3300028381 | Bacteria | 2315 |
| 528 | Ga0268264_10797795 | 3300028381 | Unclassified | 943 |
| 529 | Ga0265338_10001594 | 3300028800 | Bacteria | 36404 |
| 530 | Ga0265338_10002879 | 3300028800 | Bacteria | 25111 |
| 531 | Ga0265338_10086960 | 3300028800 | Bacteria | 2599 |
| 532 | Ga0265338_10105178 | 3300028800 | Unclassified | 2288 |
| 533 | Ga0265762_1000174 | 3300030760 | Bacteria | 10217 |
| 534 | Ga0265762_1000799 | 3300030760 | Bacteria | 5616 |
| 535 | Ga0265762_1001512 | 3300030760 | Unclassified | 4220 |
| 536 | Ga0265762_1029986 | 3300030760 | Bacteria | 1030 |
| 537 | Ga0265770_1005637 | 3300030878 | Unclassified | 1733 |
| 538 | Ga0265770_1012516 | 3300030878 | Unclassified | 1258 |
| 539 | Ga0265765_1000227 | 3300030879 | Bacteria | 3970 |
| 540 | Ga0265760_10000916 | 3300031090 | Bacteria | 8522 |
| 541 | Ga0265760_10001157 | 3300031090 | Bacteria | 7688 |
| 542 | Ga0265760_10003613 | 3300031090 | Bacteria | 4485 |
| 543 | Ga0265760_10007604 | 3300031090 | Unclassified | 3095 |
| 544 | Ga0265760_10014723 | 3300031090 | Unclassified | 2242 |
| 545 | Ga0265760_10019982 | 3300031090 | Unclassified | 1931 |
| 546 | Ga0265330_10004610 | 3300031235 | Bacteria | 6968 |
| 547 | Ga0265325_10006588 | 3300031241 | Bacteria | 7034 |
| 548 | Ga0265325_10087888 | 3300031241 | Unclassified | 1536 |
| 549 | Ga0265339_10002485 | 3300031249 | Bacteria | 13174 |
| 550 | Ga0265316_10016481 | 3300031344 | Bacteria | 6407 |
| 551 | Ga0265316_10048368 | 3300031344 | Unclassified | 3357 |
| 552 | Ga0265314_10006083 | 3300031711 | Bacteria | 10723 |
| 553 | Ga0265314_10018014 | 3300031711 | Bacteria | 5523 |
| 554 | Ga0265314_10062976 | 3300031711 | Unclassified | 2518 |
| 555 | Ga0265342_10017755 | 3300031712 | Bacteria | 4621 |
| 556 | Ga0373926_0011088 | 3300035083 | Bacteria | 3029 |
| 557 | Ga0373926_0123373 | 3300035083 | Unclassified | 978 |
| 558 | Ga0373934_0056436 | 3300035086 | Bacteria | 1562 |
| 559 | Ga0373923_0003916 | 3300035111 | Bacteria | 4860 |
| 560 | Ga0373932_0011372 | 3300035112 | Bacteria | 2174 |
| 561 | Ga0373939_0074223 | 3300035114 | Bacteria | 1115 |
| 562 | Ga0373945_0001340 | 3300035116 | Bacteria | 7483 |
| 563 | Ga0373954_0020415 | 3300035118 | Bacteria | 2997 |
| 564 | Ga0373960_0019967 | 3300035121 | Bacteria | 1767 |
| 565 | Ga0373943_0000083 | 3300035170 | Bacteria | 33682 |
| 566 | Ga0373946_0137812 | 3300035171 | Unclassified | 1128 |
| 567 | Ga0373924_0035713 | 3300035410 | Unclassified | 2016 |
| 568 | Ga0373924_0042504 | 3300035410 | Bacteria | 1864 |
| 569 | Ga0373931_0057807 | 3300035691 | Bacteria | 2081 |
| 570 | Ga0373931_0084697 | 3300035691 | Bacteria | 1756 |
| 571 | Ga0373931_0362750 | 3300035691 | Bacteria | 909 |
| 572 | Ga0373931_0398299 | 3300035691 | Unclassified | 871 |
| 573 | Ga0373935_0012955 | 3300035692 | Bacteria | 5025 |
| 574 | Ga0373935_0018540 | 3300035692 | Bacteria | 4235 |
| 575 | Ga0373935_0247514 | 3300035692 | Bacteria | 1246 |
| 576 | Ga0373927_0000193 | 3300035695 | Bacteria | 48831 |
| 577 | Ga0373927_0023786 | 3300035695 | Bacteria | 4010 |
| 578 | Ga0373927_0339267 | 3300035695 | Bacteria | 990 |
| 579 | Ga0373947_0002347 | 3300035725 | Bacteria | 11445 |
| 580 | Ga0373947_0065445 | 3300035725 | Bacteria | 2217 |
| 581 | Ga0373937_0036782 | 3300036401 | Bacteria | 4462 |
| 582 | Ga0373937_0113989 | 3300036401 | Bacteria | 2516 |
| 583 | Ga0373937_0186297 | 3300036401 | Unclassified | 1950 |
| 584 | Ga0373925_0002463 | 3300037068 | Bacteria | 14807 |
| 585 | Ga0373925_0170188 | 3300037068 | Bacteria | 1720 |
| 586 | Ga0373925_0236812 | 3300037068 | Bacteria | 1461 |
| 587 | Ga0373925_0286992 | 3300037068 | Unclassified | 1326 |
| 588 | Ga0436360_0795382 | 3300039438 | Unclassified | 939 |
| 589 | Ga0451807_2696225 | 3300041486 | Bacteria | 4712 |
| 590 | Ga0466966_0187557 | 3300044684 | Bacteria | 1254 |
| 591 | Ga0466964_0081776 | 3300044706 | Bacteria | 1388 |
| 592 | Ga0466959_0173018 | 3300045049 | Unclassified | 1514 |
| 593 | Ga0466959_0362717 | 3300045049 | Unclassified | 987 |
| 594 | Ga0466967_0085163 | 3300045976 | Unclassified | 2861 |
| 595 | Ga0466967_0513580 | 3300045976 | Unclassified | 1177 |
| 596 | Ga0495629_0005723 | 3300046459 | Bacteria | 9275 |
| 597 | Ga0495651_0162932 | 3300046462 | Bacteria | 1596 |
| 598 | Ga0495580_0000108 | 3300046472 | Bacteria | 55508 |
| 599 | Ga0495580_0001723 | 3300046472 | Bacteria | 19219 |
| 600 | Ga0495580_0002290 | 3300046472 | Bacteria | 16705 |
| 601 | Ga0495580_0025729 | 3300046472 | Bacteria | 4299 |
| 602 | Ga0495580_0028672 | 3300046472 | Bacteria | 4046 |
| 603 | Ga0495580_0038669 | 3300046472 | Unclassified | 3416 |
| 604 | Ga0495580_0047096 | 3300046472 | Bacteria | 3057 |
| 605 | Ga0495580_0055297 | 3300046472 | Bacteria | 2797 |
| 606 | Ga0495580_0284646 | 3300046472 | Unclassified | 1127 |
| 607 | Ga0495582_0002288 | 3300046473 | Bacteria | 10720 |
| 608 | Ga0495582_0031658 | 3300046473 | Bacteria | 2908 |
| 609 | Ga0495664_0015596 | 3300046477 | Bacteria | 4321 |
| 610 | Ga0495618_0166044 | 3300046514 | Bacteria | 1406 |
| 611 | Ga0495652_0358841 | 3300046529 | Bacteria | 1042 |
| 612 | Ga0495586_0221672 | 3300046535 | Bacteria | 1075 |
| 613 | Ga0495667_0148637 | 3300046559 | Bacteria | 1509 |
| 614 | Ga0495667_0273564 | 3300046559 | Bacteria | 1073 |
| 615 | Ga0495659_0083055 | 3300046664 | Bacteria | 1219 |
| 616 | Ga0495646_0186170 | 3300046680 | Unclassified | 1137 |
| 617 | Ga0495658_0069764 | 3300046683 | Unclassified | 2038 |
| 618 | Ga0495669_0032145 | 3300046684 | Bacteria | 2306 |
| 619 | Ga0495674_0006546 | 3300047319 | Bacteria | 11177 |
| 620 | Ga0495674_0024813 | 3300047319 | Bacteria | 5504 |
| 621 | Ga0495674_0193313 | 3300047319 | Bacteria | 1690 |
| 622 | Ga0495674_0625385 | 3300047319 | Bacteria | 851 |
| 623 | Ga0495676_0301638 | 3300047321 | Bacteria | 1080 |
| 624 | Ga0496100_0040425 | 3300048903 | Bacteria | 2967 |
| 625 | Ga0496100_0404625 | 3300048903 | Unclassified | 1040 |
| 626 | Ga0496101_0065623 | 3300048904 | Bacteria | 2646 |
| 627 | Ga0496101_0084194 | 3300048904 | Unclassified | 2355 |
| 628 | Ga0496102_0149775 | 3300048905 | Bacteria | 2192 |
| 629 | Ga0496102_0235323 | 3300048905 | Unclassified | 1727 |
| 630 | Ga0496103_0104171 | 3300048906 | Bacteria | 1798 |
| 631 | Ga0496103_0248430 | 3300048906 | Bacteria | 1145 |
| 632 | Ga0496104_0042124 | 3300048907 | Bacteria | 4284 |
| 633 | Ga0496104_0058617 | 3300048907 | Unclassified | 3645 |
| 634 | Ga0496104_0215187 | 3300048907 | Bacteria | 1833 |
| 635 | Ga0496104_0790759 | 3300048907 | Unclassified | 855 |
| 636 | Ga0496105_0054121 | 3300048908 | Bacteria | 3314 |
| 637 | Ga0496105_0217933 | 3300048908 | Unclassified | 1554 |
| 638 | Ga0496106_0040558 | 3300048909 | Unclassified | 3487 |
| 639 | Ga0496106_0241258 | 3300048909 | Unclassified | 1444 |
| 640 | Ga0496108_0000169 | 3300048911 | Bacteria | 61406 |
| 641 | Ga0496108_0108448 | 3300048911 | Bacteria | 2372 |
| 642 | Ga0496109_0000072 | 3300048912 | Bacteria | 107549 |
| 643 | Ga0496109_0155443 | 3300048912 | Bacteria | 2142 |
| 644 | Ga0496109_0210200 | 3300048912 | Bacteria | 1830 |
| 645 | Ga0496110_0013408 | 3300048913 | Bacteria | 6775 |
| 646 | Ga0496111_0130620 | 3300048914 | Unclassified | 1858 |
| 647 | Ga0496112_0000064 | 3300048915 | Bacteria | 72159 |
| 648 | Ga0496112_0003953 | 3300048915 | Bacteria | 12423 |
| 649 | Ga0496112_0011741 | 3300048915 | Bacteria | 8020 |
| 650 | Ga0496112_0047008 | 3300048915 | Bacteria | 4233 |
| 651 | Ga0496112_0090510 | 3300048915 | Bacteria | 3029 |
| 652 | Ga0496112_0102589 | 3300048915 | Bacteria | 2830 |
| 653 | Ga0496112_0228185 | 3300048915 | Unclassified | 1817 |
| 654 | Ga0496112_0693803 | 3300048915 | Bacteria | 946 |
| 655 | Ga0496112_0763627 | 3300048915 | Bacteria | 892 |
| 656 | Ga0496113_0001888 | 3300048916 | Bacteria | 11952 |
| 657 | Ga0496114_0013431 | 3300048917 | Bacteria | 6565 |
| 658 | Ga0496114_0126017 | 3300048917 | Bacteria | 2208 |
| 659 | Ga0496115_0026977 | 3300048918 | Bacteria | 4490 |
| 660 | Ga0496115_0028234 | 3300048918 | Bacteria | 4397 |
| 661 | Ga0496115_0047333 | 3300048918 | Bacteria | 3439 |
| 662 | Ga0501047_0099493 | 3300049581 | Bacteria | 2787 |
| 663 | Ga0501083_0024907 | 3300049744 | Bacteria | 4144 |
| 664 | nmdc:mga08y16_13459_c1 | 3300050511 | Bacteria | 8608 |
| 665 | nmdc:mga0n895_418882_c1 | 3300050512 | Bacteria | 1354 |
| 666 | nmdc:mga0rr50_453849_c1 | 3300050513 | Unclassified | 1087 |
| 667 | nmdc:mga0rr50_89888_c1 | 3300050513 | Bacteria | 2388 |
| 668 | nmdc:mga0a205_116448_c1 | 3300050515 | Unclassified | 2571 |
| 669 | nmdc:mga0a205_335181_c1 | 3300050515 | Bacteria | 1382 |
| 670 | Ga0495601_0222157 | 3300053077 | Bacteria | 1234 |
| 671 | Ga0501084_0002658 | 3300054114 | Bacteria | 14402 |
| 672 | Ga0501082_0020439 | 3300060353 | Bacteria | 5709 |
| 673 | Ga0224569_101792 | |||
| 674 | rootL2_10039505 | |||
| 675 | Ga0065712_10035299 | |||
| 676 | Ga0065712_10113431 | |||
| 677 | Ga0065715_10006424 | |||
| 678 | Ga0065715_10201311 | |||
| 679 | Ga0070658_10123318 | |||
| 680 | Ga0070676_10013263 | |||
| 681 | Ga0070676_10223502 | |||
| 682 | Ga0070683_100114474 | |||
| 683 | Ga0070690_100012913 | |||
| 684 | Ga0070690_100061327 | |||
| 685 | Ga0068869_100013215 | |||
| 686 | Ga0068869_100281927 | |||
| 687 | Ga0070682_100005954 | |||
| 688 | Ga0068868_100017815 | |||
| 689 | Ga0068868_100023467 | |||
| 690 | Ga0068868_100060269 | |||
| 691 | Ga0068868_100061637 | |||
| 692 | Ga0068868_100411987 | |||
| 693 | Ga0070660_100022564 | |||
| 694 | Ga0070660_100145507 | |||
| 695 | Ga0070689_100005861 | |||
| 696 | Ga0070691_10055823 | |||
| 697 | Ga0070687_100000582 | |||
| 698 | Ga0070661_100018482 | |||
| 699 | Ga0070661_100263287 | |||
| 700 | Ga0070668_100099498 | |||
| 701 | Ga0070669_100097027 | |||
| 702 | Ga0070671_100163380 | |||
| 703 | Ga0070674_100438623 | |||
| 704 | Ga0070688_100069454 | |||
| 705 | Ga0070659_100057136 | |||
| 706 | Ga0070667_100799666 | |||
| 707 | Ga0070709_10000350 | |||
| 708 | Ga0070709_10010911 | |||
| 709 | Ga0070709_10049410 | |||
| 710 | Ga0070709_10125242 | |||
| 711 | Ga0070709_10147660 | |||
| 712 | Ga0070709_10208628 | |||
| 713 | Ga0070709_10259569 | |||
| 714 | Ga0070709_10374189 | |||
| 715 | Ga0070709_10493374 | |||
| 716 | Ga0070714_100000040 | |||
| 717 | Ga0070714_100086292 | |||
| 718 | Ga0070714_100215936 | |||
| 719 | Ga0070714_100268585 | |||
| 720 | Ga0070714_100390860 | |||
| 721 | Ga0070714_100467080 | |||
| 722 | Ga0070713_100000178 | |||
| 723 | Ga0070713_100002882 | |||
| 724 | Ga0070713_100014973 | |||
| 725 | Ga0070713_100017734 | |||
| 726 | Ga0070713_100035427 | |||
| 727 | Ga0070713_100040335 | |||
| 728 | Ga0070713_100141726 | |||
| 729 | Ga0070710_10019628 | |||
| 730 | Ga0070710_10021173 | |||
| 731 | Ga0070710_10335297 | |||
| 732 | Ga0070711_100002684 | |||
| 733 | Ga0070711_100047623 | |||
| 734 | Ga0070711_100063209 | |||
| 735 | Ga0070711_100184038 | |||
| 736 | Ga0070705_100045687 | |||
| 737 | Ga0070705_100056713 | |||
| 738 | Ga0070705_100449926 | |||
| 739 | Ga0070708_100001730 | |||
| 740 | Ga0070708_100006238 | |||
| 741 | Ga0070708_100046827 | |||
| 742 | Ga0070708_100088748 | |||
| 743 | Ga0070708_100156793 | |||
| 744 | Ga0070708_100305126 | |||
| 745 | Ga0070708_100369357 | |||
| 746 | Ga0070708_100874834 | |||
| 747 | Ga0070678_100103711 | |||
| 748 | Ga0070681_10000160 | |||
| 749 | Ga0070681_10006674 | |||
| 750 | Ga0070681_10032373 | |||
| 751 | Ga0070681_10051200 | |||
| 752 | Ga0068867_100025620 | |||
| 753 | Ga0068867_100049792 | |||
| 754 | Ga0070685_10009968 | |||
| 755 | Ga0070706_100000434 | |||
| 756 | Ga0070706_100000747 | |||
| 757 | Ga0070706_100001372 | |||
| 758 | Ga0070706_100039142 | |||
| 759 | Ga0070706_100089628 | |||
| 760 | Ga0070706_100108786 | |||
| 761 | Ga0070706_100197748 | |||
| 762 | Ga0070707_100001963 | |||
| 763 | Ga0070707_100145893 | |||
| 764 | Ga0070707_100207559 | |||
| 765 | Ga0070707_100443418 | |||
| 766 | Ga0070698_100000558 | |||
| 767 | Ga0070698_100000584 | |||
| 768 | Ga0070698_100009189 | |||
| 769 | Ga0070698_100016837 | |||
| 770 | Ga0070698_100107731 | |||
| 771 | Ga0070699_100000648 | |||
| 772 | Ga0070699_100007853 | |||
| 773 | Ga0070699_100386582 | |||
| 774 | Ga0070679_100003769 | |||
| 775 | Ga0070679_100018592 | |||
| 776 | Ga0070684_100003906 | |||
| 777 | Ga0070684_100025479 | |||
| 778 | Ga0070684_100273249 | |||
| 779 | Ga0070697_100000814 | |||
| 780 | Ga0070697_100000951 | |||
| 781 | Ga0070697_100001885 | |||
| 782 | Ga0070697_100003676 | |||
| 783 | Ga0070697_100105732 | |||
| 784 | Ga0070697_100190389 | |||
| 785 | Ga0068853_100054090 | |||
| 786 | Ga0068853_100082707 | |||
| 787 | Ga0068853_100092976 | |||
| 788 | Ga0068853_100204066 | |||
| 789 | Ga0068853_100325257 | |||
| 790 | Ga0070672_100247316 | |||
| 791 | Ga0070672_100290603 | |||
| 792 | Ga0070686_100006943 | |||
| 793 | Ga0070686_100132445 | |||
| 794 | Ga0070695_100083501 | |||
| 795 | Ga0070695_100412772 | |||
| 796 | Ga0070696_100035796 | |||
| 797 | Ga0070693_100144112 | |||
| 798 | Ga0070665_100319966 | |||
| 799 | Ga0070665_100814246 | |||
| 800 | Ga0068855_100000151 | |||
| 801 | Ga0068855_100002998 | |||
| 802 | Ga0068855_100007501 | |||
| 803 | Ga0068855_100158694 | |||
| 804 | Ga0068855_100180524 | |||
| 805 | Ga0068855_100357941 | |||
| 806 | Ga0068855_100619694 | |||
| 807 | Ga0070664_100001009 | |||
| 808 | Ga0070664_100022499 | |||
| 809 | Ga0068857_100004121 | |||
| 810 | Ga0068857_100013259 | |||
| 811 | Ga0068857_100041231 | |||
| 812 | Ga0068854_100018457 | |||
| 813 | Ga0068854_100024280 | |||
| 814 | Ga0068856_100000119 | |||
| 815 | Ga0068856_100000220 | |||
| 816 | Ga0068856_100003015 | |||
| 817 | Ga0068856_100016341 | |||
| 818 | Ga0068856_100126556 | |||
| 819 | Ga0070702_100021933 | |||
| 820 | Ga0068852_100004234 | |||
| 821 | Ga0068852_100367720 | |||
| 822 | Ga0068864_100302837 | |||
| 823 | Ga0068864_100822900 | |||
| 824 | Ga0068866_10002344 | |||
| 825 | Ga0068866_10024488 | |||
| 826 | Ga0068866_10027378 | |||
| 827 | Ga0068866_10087690 | |||
| 828 | Ga0068861_100076355 | |||
| 829 | Ga0068861_100238477 | |||
| 830 | Ga0068851_10001808 | |||
| 831 | Ga0068851_10012496 | |||
| 832 | Ga0068851_10148137 | |||
| 833 | Ga0068851_10158244 | |||
| 834 | Ga0068870_10003367 | |||
| 835 | Ga0068863_100007048 | |||
| 836 | Ga0068863_100047123 | |||
| 837 | Ga0068863_100100228 | |||
| 838 | Ga0068863_100198091 | |||
| 839 | Ga0068858_100000231 | |||
| 840 | Ga0068858_100009662 | |||
| 841 | Ga0068858_100026194 | |||
| 842 | Ga0068860_100008540 | |||
| 843 | Ga0068860_100018877 | |||
| 844 | Ga0068860_100089234 | |||
| 845 | Ga0068860_100142298 | |||
| 846 | Ga0068860_100315622 | |||
| 847 | Ga0068862_100018399 | |||
| 848 | Ga0068862_100044682 | |||
| 849 | Ga0068862_100376089 | |||
| 850 | Ga0070717_10001091 | |||
| 851 | Ga0070717_10027214 | |||
| 852 | Ga0070717_10036944 | |||
| 853 | Ga0070717_10058945 | |||
| 854 | Ga0070717_10256775 | |||
| 855 | Ga0070717_10258189 | |||
| 856 | Ga0070717_10618156 | |||
| 857 | Ga0070717_10807142 | |||
| 858 | Ga0070715_10005647 | |||
| 859 | Ga0070715_10007956 | |||
| 860 | Ga0070715_10073805 | |||
| 861 | Ga0070716_100003422 | |||
| 862 | Ga0070716_100005229 | |||
| 863 | Ga0070716_100010931 | |||
| 864 | Ga0070716_100018364 | |||
| 865 | Ga0070716_100034625 | |||
| 866 | Ga0070716_100117962 | |||
| 867 | Ga0070716_100146637 | |||
| 868 | Ga0070716_100193569 | |||
| 869 | Ga0070712_100000302 | |||
| 870 | Ga0070712_100000516 | |||
| 871 | Ga0070712_100003211 | |||
| 872 | Ga0070712_100007006 | |||
| 873 | Ga0070712_100009124 | |||
| 874 | Ga0070712_100058734 | |||
| 875 | Ga0070712_100078505 | |||
| 876 | Ga0070712_100090820 | |||
| 877 | Ga0070712_100143551 | |||
| 878 | Ga0097621_100000073 | |||
| 879 | Ga0097621_100000591 | |||
| 880 | Ga0097621_100020148 | |||
| 881 | Ga0097621_100056516 | |||
| 882 | Ga0097621_100487469 | |||
| 883 | Ga0068871_100000697 | |||
| 884 | Ga0068871_100001411 | |||
| 885 | Ga0068871_100032583 | |||
| 886 | Ga0075433_10070900 | |||
| 887 | Ga0075433_10108651 | |||
| 888 | Ga0075434_100003427 | |||
| 889 | Ga0075434_100036813 | |||
| 890 | Ga0075434_100329258 | |||
| 891 | Ga0068865_100036167 | |||
| 892 | Ga0068865_100158816 | |||
| 893 | Ga0075436_100198127 | |||
| 894 | Ga0075435_100102803 | |||
| 895 | Ga0075435_100134262 | |||
| 896 | Ga0105250_10011749 | |||
| 897 | Ga0105240_10025067 | |||
| 898 | Ga0105240_10085017 | |||
| 899 | Ga0105240_10103929 | |||
| 900 | Ga0105240_10163838 | |||
| 901 | Ga0105240_10373039 | |||
| 902 | Ga0105240_10553302 | |||
| 903 | Ga0111539_10001725 | |||
| 904 | Ga0111539_10210790 | |||
| 905 | Ga0105245_10025564 | |||
| 906 | Ga0105245_10052216 | |||
| 907 | Ga0105245_10083843 | |||
| 908 | Ga0105245_10190851 | |||
| 909 | Ga0105245_10879158 | |||
| 910 | Ga0105243_10235196 | |||
| 911 | Ga0105241_10012632 | |||
| 912 | Ga0105241_10014788 | |||
| 913 | Ga0105241_10039238 | |||
| 914 | Ga0105241_10048357 | |||
| 915 | Ga0105241_10089464 | |||
| 916 | Ga0105242_10051629 | |||
| 917 | Ga0105248_10092429 | |||
| 918 | Ga0105248_10166301 | |||
| 919 | Ga0105248_10281448 | |||
| 920 | Ga0105237_10078356 | |||
| 921 | Ga0105238_10000497 | |||
| 922 | Ga0105238_10062825 | |||
| 923 | Ga0105249_10008098 | |||
| 924 | Ga0099796_10160737 | |||
| 925 | Ga0105239_10004107 | |||
| 926 | Ga0105239_10023933 | |||
| 927 | Ga0105239_10065852 | |||
| 928 | Ga0105239_10142754 | |||
| 929 | Ga0105239_10331209 | |||
| 930 | Ga0105239_10488933 | |||
| 931 | Ga0105239_11403149 | |||
| 932 | Ga0105246_10002297 | |||
| 933 | Ga0157373_10114035 | |||
| 934 | Ga0157373_10220480 | |||
| 935 | Ga0157371_10018154 | |||
| 936 | Ga0157371_10022982 | |||
| 937 | Ga0157371_10306907 | |||
| 938 | Ga0157369_10000108 | |||
| 939 | Ga0157369_10042083 | |||
| 940 | Ga0157369_10046247 | |||
| 941 | Ga0157369_10255062 | |||
| 942 | Ga0157369_10609182 | |||
| 943 | Ga0157369_10867758 | |||
| 944 | Ga0157374_10001195 | |||
| 945 | Ga0157374_10001477 | |||
| 946 | Ga0157374_10002238 | |||
| 947 | Ga0157374_10008126 | |||
| 948 | Ga0157374_10016227 | |||
| 949 | Ga0157374_10019923 | |||
| 950 | Ga0157374_10450777 | |||
| 951 | Ga0157378_10000030 | |||
| 952 | Ga0157378_10000099 | |||
| 953 | Ga0157378_10008641 | |||
| 954 | Ga0157378_10035410 | |||
| 955 | Ga0157378_10044565 | |||
| 956 | Ga0157378_10072246 | |||
| 957 | Ga0157378_10197277 | |||
| 958 | Ga0163162_10015270 | |||
| 959 | Ga0163162_10042764 | |||
| 960 | Ga0163162_10160719 | |||
| 961 | Ga0163162_10599879 | |||
| 962 | Ga0157372_10000576 | |||
| 963 | Ga0157372_10009048 | |||
| 964 | Ga0157372_10009135 | |||
| 965 | Ga0157372_10028758 | |||
| 966 | Ga0157372_10123660 | |||
| 967 | Ga0157372_10134785 | |||
| 968 | Ga0157372_10166588 | |||
| 969 | Ga0157372_10181702 | |||
| 970 | Ga0157375_10593977 | |||
| 971 | Ga0163163_10027104 | |||
| 972 | Ga0163163_10043414 | |||
| 973 | Ga0163163_10348719 | |||
| 974 | Ga0163163_10536694 | |||
| 975 | Ga0157380_10019134 | |||
| 976 | Ga0182008_10002806 | |||
| 977 | Ga0157377_10002339 | |||
| 978 | Ga0157379_10008128 | |||
| 979 | Ga0157379_10038083 | |||
| 980 | Ga0157379_10189082 | |||
| 981 | Ga0157379_10234981 | |||
| 982 | Ga0157376_10007486 | |||
| 983 | Ga0157376_10038390 | |||
| 984 | Ga0157376_10078486 | |||
| 985 | Ga0157376_10101993 | |||
| 986 | Ga0157376_10149985 | |||
| 987 | Ga0157376_10216058 | |||
| 988 | Ga0182006_1093894 | |||
| 989 | Ga0182007_10004978 | |||
| 990 | Ga0182007_10023467 | |||
| 991 | Ga0182005_1025472 | |||
| 992 | Ga0163161_10003125 | |||
| 993 | Ga0224569_102686 | |||
| 994 | Ga0224571_102495 | |||
| 995 | Ga0224572_1001779 | |||
| 996 | Ga0224572_1003555 | |||
| 997 | Ga0228598_1000043 | |||
| 998 | Ga0228598_1000726 | |||
| 999 | Ga0207697_10019520 | |||
| 1000 | Ga0207692_10009477 | |||
| 1001 | Ga0207642_10008283 | |||
| 1002 | Ga0207642_10014854 | |||
| 1003 | Ga0207710_10115117 | |||
| 1004 | Ga0207688_10057239 | |||
| 1005 | Ga0207647_10008012 | |||
| 1006 | Ga0207647_10008692 | |||
| 1007 | Ga0207647_10015621 | |||
| 1008 | Ga0207647_10087607 | |||
| 1009 | Ga0207685_10002145 | |||
| 1010 | Ga0207685_10015555 | |||
| 1011 | Ga0207685_10051654 | |||
| 1012 | Ga0207699_10000578 | |||
| 1013 | Ga0207699_10034971 | |||
| 1014 | Ga0207699_10036809 | |||
| 1015 | Ga0207699_10048345 | |||
| 1016 | Ga0207699_10077329 | |||
| 1017 | Ga0207699_10081677 | |||
| 1018 | Ga0207699_10190222 | |||
| 1019 | Ga0207699_10201584 | |||
| 1020 | Ga0207699_10478647 | |||
| 1021 | Ga0207645_10003048 | |||
| 1022 | Ga0207645_10107051 | |||
| 1023 | Ga0207643_10000363 | |||
| 1024 | Ga0207684_10000203 | |||
| 1025 | Ga0207684_10000560 | |||
| 1026 | Ga0207684_10000966 | |||
| 1027 | Ga0207684_10003721 | |||
| 1028 | Ga0207684_10165735 | |||
| 1029 | Ga0207684_10271203 | |||
| 1030 | Ga0207684_10393837 | |||
| 1031 | Ga0207654_10035546 | |||
| 1032 | Ga0207654_10128355 | |||
| 1033 | Ga0207654_10144389 | |||
| 1034 | Ga0207654_10159255 | |||
| 1035 | Ga0207707_10003004 | |||
| 1036 | Ga0207707_10005292 | |||
| 1037 | Ga0207707_10076214 | |||
| 1038 | Ga0207707_10117563 | |||
| 1039 | Ga0207707_10378861 | |||
| 1040 | Ga0207707_10635026 | |||
| 1041 | Ga0207695_10054089 | |||
| 1042 | Ga0207695_10120523 | |||
| 1043 | Ga0207695_10572675 | |||
| 1044 | Ga0207671_10033453 | |||
| 1045 | Ga0207671_10341144 | |||
| 1046 | Ga0207693_10000071 | |||
| 1047 | Ga0207693_10000373 | |||
| 1048 | Ga0207693_10004195 | |||
| 1049 | Ga0207693_10005083 | |||
| 1050 | Ga0207693_10015729 | |||
| 1051 | Ga0207693_10016451 | |||
| 1052 | Ga0207693_10068637 | |||
| 1053 | Ga0207663_10015835 | |||
| 1054 | Ga0207663_10046547 | |||
| 1055 | Ga0207663_10089819 | |||
| 1056 | Ga0207663_10156469 | |||
| 1057 | Ga0207663_10208696 | |||
| 1058 | Ga0207663_10429722 | |||
| 1059 | Ga0207660_10154978 | |||
| 1060 | Ga0207660_10265251 | |||
| 1061 | Ga0207662_10000664 | |||
| 1062 | Ga0207657_10001432 | |||
| 1063 | Ga0207657_10006629 | |||
| 1064 | Ga0207657_10011646 | |||
| 1065 | Ga0207649_10003934 | |||
| 1066 | Ga0207649_10020337 | |||
| 1067 | Ga0207652_10005098 | |||
| 1068 | Ga0207652_10085577 | |||
| 1069 | Ga0207652_10351587 | |||
| 1070 | Ga0207646_10000657 | |||
| 1071 | Ga0207646_10001084 | |||
| 1072 | Ga0207646_10020896 | |||
| 1073 | Ga0207646_10076903 | |||
| 1074 | Ga0207646_10475507 | |||
| 1075 | Ga0207681_10075603 | |||
| 1076 | Ga0207681_10092393 | |||
| 1077 | Ga0207694_10000864 | |||
| 1078 | Ga0207694_10045564 | |||
| 1079 | Ga0207694_10058027 | |||
| 1080 | Ga0207694_10654826 | |||
| 1081 | Ga0207650_10000051 | |||
| 1082 | Ga0207650_10087631 | |||
| 1083 | Ga0207650_10613986 | |||
| 1084 | Ga0207659_10047131 | |||
| 1085 | Ga0207687_10007789 | |||
| 1086 | Ga0207687_10058509 | |||
| 1087 | Ga0207687_10060643 | |||
| 1088 | Ga0207687_10125026 | |||
| 1089 | Ga0207700_10000089 | |||
| 1090 | Ga0207700_10000151 | |||
| 1091 | Ga0207700_10037360 | |||
| 1092 | Ga0207700_10052468 | |||
| 1093 | Ga0207700_10061467 | |||
| 1094 | Ga0207700_10067798 | |||
| 1095 | Ga0207700_10275864 | |||
| 1096 | Ga0207700_10302096 | |||
| 1097 | Ga0207700_10383563 | |||
| 1098 | Ga0207700_10579687 | |||
| 1099 | Ga0207664_10000029 | |||
| 1100 | Ga0207664_10002505 | |||
| 1101 | Ga0207664_10076232 | |||
| 1102 | Ga0207664_10112581 | |||
| 1103 | Ga0207664_10425012 | |||
| 1104 | Ga0207644_10186883 | |||
| 1105 | Ga0207690_10281024 | |||
| 1106 | Ga0207690_10377270 | |||
| 1107 | Ga0207706_10000783 | |||
| 1108 | Ga0207706_10013806 | |||
| 1109 | Ga0207686_10016623 | |||
| 1110 | Ga0207686_10205919 | |||
| 1111 | Ga0207709_10136057 | |||
| 1112 | Ga0207669_10134358 | |||
| 1113 | Ga0207704_10047195 | |||
| 1114 | Ga0207704_10138636 | |||
| 1115 | Ga0207665_10001361 | |||
| 1116 | Ga0207665_10005766 | |||
| 1117 | Ga0207665_10033385 | |||
| 1118 | Ga0207665_10044943 | |||
| 1119 | Ga0207665_10050559 | |||
| 1120 | Ga0207665_10116174 | |||
| 1121 | Ga0207665_10175931 | |||
| 1122 | Ga0207665_10333832 | |||
| 1123 | Ga0207691_10005718 | |||
| 1124 | Ga0207691_10153040 | |||
| 1125 | Ga0207691_10347327 | |||
| 1126 | Ga0207711_10002266 | |||
| 1127 | Ga0207711_10024402 | |||
| 1128 | Ga0207711_10088575 | |||
| 1129 | Ga0207689_10000860 | |||
| 1130 | Ga0207689_10001015 | |||
| 1131 | Ga0207661_10000969 | |||
| 1132 | Ga0207661_10098593 | |||
| 1133 | Ga0207661_10111202 | |||
| 1134 | Ga0207661_10257823 | |||
| 1135 | Ga0207679_10000203 | |||
| 1136 | Ga0207679_10008130 | |||
| 1137 | Ga0207679_10026112 | |||
| 1138 | Ga0207679_10054777 | |||
| 1139 | Ga0207667_10001767 | |||
| 1140 | Ga0207667_10015239 | |||
| 1141 | Ga0207667_10023096 | |||
| 1142 | Ga0207667_10060734 | |||
| 1143 | Ga0207651_10011127 | |||
| 1144 | Ga0207712_10027192 | |||
| 1145 | Ga0207668_10404067 | |||
| 1146 | Ga0207640_10014450 | |||
| 1147 | Ga0207640_10041985 | |||
| 1148 | Ga0207640_10221073 | |||
| 1149 | Ga0207640_10520323 | |||
| 1150 | Ga0207658_10002771 | |||
| 1151 | Ga0207658_10074272 | |||
| 1152 | Ga0207677_10034909 | |||
| 1153 | Ga0207677_10050795 | |||
| 1154 | Ga0207677_10409368 | |||
| 1155 | Ga0207703_10002784 | |||
| 1156 | Ga0207703_10047615 | |||
| 1157 | Ga0207703_10440686 | |||
| 1158 | Ga0207639_10025861 | |||
| 1159 | Ga0207639_10075734 | |||
| 1160 | Ga0207639_10079614 | |||
| 1161 | Ga0207639_10285962 | |||
| 1162 | Ga0207639_10698024 | |||
| 1163 | Ga0207678_10001066 | |||
| 1164 | Ga0207678_10078153 | |||
| 1165 | Ga0207708_10098080 | |||
| 1166 | Ga0207702_10000086 | |||
| 1167 | Ga0207702_10000764 | |||
| 1168 | Ga0207702_10915377 | |||
| 1169 | Ga0207641_10000025 | |||
| 1170 | Ga0207641_10008135 | |||
| 1171 | Ga0207641_10185082 | |||
| 1172 | Ga0207641_10410976 | |||
| 1173 | Ga0207641_10458734 | |||
| 1174 | Ga0207641_10521001 | |||
| 1175 | Ga0207641_10844326 | |||
| 1176 | Ga0207648_10000966 | |||
| 1177 | Ga0207648_10018922 | |||
| 1178 | Ga0207648_10049644 | |||
| 1179 | Ga0207676_10002968 | |||
| 1180 | Ga0207676_10396687 | |||
| 1181 | Ga0207676_10624765 | |||
| 1182 | Ga0207674_10000281 | |||
| 1183 | Ga0207674_10001451 | |||
| 1184 | Ga0207674_10050860 | |||
| 1185 | Ga0207675_100052462 | |||
| 1186 | Ga0207675_100282776 | |||
| 1187 | Ga0207683_10000742 | |||
| 1188 | Ga0207698_10191412 | |||
| 1189 | Ga0207428_10159339 | |||
| 1190 | Ga0265356_1000061 | |||
| 1191 | Ga0265356_1005330 | |||
| 1192 | Ga0268266_10012116 | |||
| 1193 | Ga0268266_10041699 | |||
| 1194 | Ga0268266_10765129 | |||
| 1195 | Ga0268265_10048950 | |||
| 1196 | Ga0268264_10025027 | |||
| 1197 | Ga0268264_10065356 | |||
| 1198 | Ga0268264_10073669 | |||
| 1199 | Ga0268264_10120172 | |||
| 1200 | Ga0268264_10797795 | |||
| 1201 | Ga0265338_10001594 | |||
| 1202 | Ga0265338_10002879 | |||
| 1203 | Ga0265338_10086960 | |||
| 1204 | Ga0265338_10105178 | |||
| 1205 | Ga0265762_1000174 | |||
| 1206 | Ga0265762_1000799 | |||
| 1207 | Ga0265762_1001512 | |||
| 1208 | Ga0265762_1029986 | |||
| 1209 | Ga0265770_1005637 | |||
| 1210 | Ga0265770_1012516 | |||
| 1211 | Ga0265765_1000227 | |||
| 1212 | Ga0265760_10000916 | |||
| 1213 | Ga0265760_10001157 | |||
| 1214 | Ga0265760_10003613 | |||
| 1215 | Ga0265760_10007604 | |||
| 1216 | Ga0265760_10014723 | |||
| 1217 | Ga0265760_10019982 | |||
| 1218 | Ga0265330_10004610 | |||
| 1219 | Ga0265325_10006588 | |||
| 1220 | Ga0265325_10087888 | |||
| 1221 | Ga0265339_10002485 | |||
| 1222 | Ga0265316_10016481 | |||
| 1223 | Ga0265316_10048368 | |||
| 1224 | Ga0265314_10006083 | |||
| 1225 | Ga0265314_10018014 | |||
| 1226 | Ga0265314_10062976 | |||
| 1227 | Ga0265342_10017755 | |||
| 1228 | Ga0373926_0011088 | |||
| 1229 | Ga0373926_0123373 | |||
| 1230 | Ga0373934_0056436 | |||
| 1231 | Ga0373923_0003916 | |||
| 1232 | Ga0373932_0011372 | |||
| 1233 | Ga0373939_0074223 | |||
| 1234 | Ga0373945_0001340 | |||
| 1235 | Ga0373954_0020415 | |||
| 1236 | Ga0373960_0019967 | |||
| 1237 | Ga0373943_0000083 | |||
| 1238 | Ga0373946_0137812 | |||
| 1239 | Ga0373924_0035713 | |||
| 1240 | Ga0373924_0042504 | |||
| 1241 | Ga0373931_0057807 | |||
| 1242 | Ga0373931_0084697 | |||
| 1243 | Ga0373931_0362750 | |||
| 1244 | Ga0373931_0398299 | |||
| 1245 | Ga0373935_0012955 | |||
| 1246 | Ga0373935_0018540 | |||
| 1247 | Ga0373935_0247514 | |||
| 1248 | Ga0373927_0000193 | |||
| 1249 | Ga0373927_0023786 | |||
| 1250 | Ga0373927_0339267 | |||
| 1251 | Ga0373947_0002347 | |||
| 1252 | Ga0373947_0065445 | |||
| 1253 | Ga0373937_0036782 | |||
| 1254 | Ga0373937_0113989 | |||
| 1255 | Ga0373937_0186297 | |||
| 1256 | Ga0373925_0002463 | |||
| 1257 | Ga0373925_0170188 | |||
| 1258 | Ga0373925_0236812 | |||
| 1259 | Ga0373925_0286992 | |||
| 1260 | Ga0436360_0795382 | |||
| 1261 | Ga0451807_2696225 | |||
| 1262 | Ga0466966_0187557 | |||
| 1263 | Ga0466964_0081776 | |||
| 1264 | Ga0466959_0173018 | |||
| 1265 | Ga0466959_0362717 | |||
| 1266 | Ga0466967_0085163 | |||
| 1267 | Ga0466967_0513580 | |||
| 1268 | Ga0495629_0005723 | |||
| 1269 | Ga0495651_0162932 | |||
| 1270 | Ga0495580_0000108 | |||
| 1271 | Ga0495580_0001723 | |||
| 1272 | Ga0495580_0002290 | |||
| 1273 | Ga0495580_0025729 | |||
| 1274 | Ga0495580_0028672 | |||
| 1275 | Ga0495580_0038669 | |||
| 1276 | Ga0495580_0047096 | |||
| 1277 | Ga0495580_0055297 | |||
| 1278 | Ga0495580_0284646 | |||
| 1279 | Ga0495582_0002288 | |||
| 1280 | Ga0495582_0031658 | |||
| 1281 | Ga0495664_0015596 | |||
| 1282 | Ga0495618_0166044 | |||
| 1283 | Ga0495652_0358841 | |||
| 1284 | Ga0495586_0221672 | |||
| 1285 | Ga0495667_0148637 | |||
| 1286 | Ga0495667_0273564 | |||
| 1287 | Ga0495659_0083055 | |||
| 1288 | Ga0495646_0186170 | |||
| 1289 | Ga0495658_0069764 | |||
| 1290 | Ga0495669_0032145 | |||
| 1291 | Ga0495674_0006546 | |||
| 1292 | Ga0495674_0024813 | |||
| 1293 | Ga0495674_0193313 | |||
| 1294 | Ga0495674_0625385 | |||
| 1295 | Ga0495676_0301638 | |||
| 1296 | Ga0496100_0040425 | |||
| 1297 | Ga0496100_0404625 | |||
| 1298 | Ga0496101_0065623 | |||
| 1299 | Ga0496101_0084194 | |||
| 1300 | Ga0496102_0149775 | |||
| 1301 | Ga0496102_0235323 | |||
| 1302 | Ga0496103_0104171 | |||
| 1303 | Ga0496103_0248430 | |||
| 1304 | Ga0496104_0042124 | |||
| 1305 | Ga0496104_0058617 | |||
| 1306 | Ga0496104_0215187 | |||
| 1307 | Ga0496104_0790759 | |||
| 1308 | Ga0496105_0054121 | |||
| 1309 | Ga0496105_0217933 | |||
| 1310 | Ga0496106_0040558 | |||
| 1311 | Ga0496106_0241258 | |||
| 1312 | Ga0496108_0000169 | |||
| 1313 | Ga0496108_0108448 | |||
| 1314 | Ga0496109_0000072 | |||
| 1315 | Ga0496109_0155443 | |||
| 1316 | Ga0496109_0210200 | |||
| 1317 | Ga0496110_0013408 | |||
| 1318 | Ga0496111_0130620 | |||
| 1319 | Ga0496112_0000064 | |||
| 1320 | Ga0496112_0003953 | |||
| 1321 | Ga0496112_0011741 | |||
| 1322 | Ga0496112_0047008 | |||
| 1323 | Ga0496112_0090510 | |||
| 1324 | Ga0496112_0102589 | |||
| 1325 | Ga0496112_0228185 | |||
| 1326 | Ga0496112_0693803 | |||
| 1327 | Ga0496112_0763627 | |||
| 1328 | Ga0496113_0001888 | |||
| 1329 | Ga0496114_0013431 | |||
| 1330 | Ga0496114_0126017 | |||
| 1331 | Ga0496115_0026977 | |||
| 1332 | Ga0496115_0028234 | |||
| 1333 | Ga0496115_0047333 | |||
| 1334 | Ga0501047_0099493 | |||
| 1335 | Ga0501083_0024907 | |||
| 1336 | nmdc:mga08y16_13459_c1 | |||
| 1337 | nmdc:mga0n895_418882_c1 | |||
| 1338 | nmdc:mga0rr50_453849_c1 | |||
| 1339 | nmdc:mga0rr50_89888_c1 | |||
| 1340 | nmdc:mga0a205_116448_c1 | |||
| 1341 | nmdc:mga0a205_335181_c1 | |||
| 1342 | Ga0495601_0222157 | |||
| 1343 | Ga0501084_0002658 | |||
| 1344 | Ga0501082_0020439 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vcn-assembly1.cif.gz_A | crystal structure of t.th. hb8 ctp synthetase complex with sulfate anion | 0.9251 | 3 | 240 |
| 4zdi-assembly3.cif.gz_C | crystal structure of the m. tuberculosis ctp synthase pyrg (apo form) | 0.9064 | 3 | 240 |
| 3nva-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8944 | 3 | 241 |
| 4zdi-assembly3.cif.gz_D | crystal structure of the m. tuberculosis ctp synthase pyrg (apo form) | 0.8941 | 3 | 240 |
| 4zdi-assembly5.cif.gz_F | crystal structure of the m. tuberculosis ctp synthase pyrg (apo form) | 0.8941 | 3 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3nvaB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8997 | 3 | 241 | 3.40.50.880 |
| af_Q54V77_308_569_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8989 | 2 | 240 | 3.40.50.880 |
| 4zdiA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8967 | 3 | 240 | 3.40.50.880 |
| 2ad5B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8921 | 3 | 240 | 3.40.50.880 |
| 3nvaB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8889 | 3 | 241 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7D6F5-F1-model_v4 | CTP synthase (glutamine hydrolyzing) | 0.9759 | 1 | 92 |
|
| AF-A0A2V8YEI5-F1-model_v4 | Glutamine amidotransferase domain-containing protein | 0.9742 | 2 | 92 |
|
| AF-A0A7C2WGX6-F1-model_v4 | CTP synthase (glutamine hydrolyzing) | 0.9738 | 1 | 92 |
|
| AF-A0A848ZLC6-F1-model_v4 | CTP synthase (glutamine hydrolyzing) | 0.9738 | 2 | 92 |
|
| AF-W4M1P6-F1-model_v4 | Uncharacterized protein | 0.9725 | 1 | 92 |
|