F474233

General Info

Members Datasets Scaffolds Average Seq Length
672 250 1344 257

Family's Representative Sequence

Representative Sequence 3300022732|Ga0224569_101792|Ga0224569_1017921
Length 283
Sequence VSPVPHHTSNRHPPTHLTRSSTIARVSNAVRIGILGDFNSEFRSHPATADSLQHAARKLDLKVESEWIPTSSLTAPGAEKLLESFDGLWASPGSPYKSFDGMLKGIEFARRRDWPFLGTCGGFQYALIEFARNVLGIADADSAENNSGSKNIVIYPVACAVPNRKGDAPKLSGKVPEIRLRPGSYLQSFYGKDKEIVTEEFFCNFEVNPEYEWATMEAGFPVVARGSQGEIRAIESPTHRFFIATLFQPQLSSTEKNPHPIVLAFVQAAADWERKKLDDSVLE

Samples

Sample ID Description Type Environment
1 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
109 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
110 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.8
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 23.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224569_101792 3300022732 Bacteria 1776
2 rootL2_10039505 3300003322 Bacteria 1766
3 Ga0065712_10035299 3300005290 Bacteria 858
4 Ga0065712_10113431 3300005290 Unclassified 1783
5 Ga0065715_10006424 3300005293 Unclassified 4073
6 Ga0065715_10201311 3300005293 Bacteria 1360
7 Ga0070658_10123318 3300005327 Unclassified 2154
8 Ga0070676_10013263 3300005328 Unclassified 4514
9 Ga0070676_10223502 3300005328 Bacteria 1245
10 Ga0070683_100114474 3300005329 Bacteria 2545
11 Ga0070690_100012913 3300005330 Bacteria 4924
12 Ga0070690_100061327 3300005330 Unclassified 2422
13 Ga0068869_100013215 3300005334 Bacteria 5485
14 Ga0068869_100281927 3300005334 Unclassified 1336
15 Ga0070682_100005954 3300005337 Bacteria 6826
16 Ga0068868_100017815 3300005338 Bacteria 5298
17 Ga0068868_100023467 3300005338 Bacteria 4669
18 Ga0068868_100060269 3300005338 Bacteria 3004
19 Ga0068868_100061637 3300005338 Unclassified 2972
20 Ga0068868_100411987 3300005338 Unclassified 1168
21 Ga0070660_100022564 3300005339 Unclassified 4656
22 Ga0070660_100145507 3300005339 Bacteria 1903
23 Ga0070689_100005861 3300005340 Bacteria 8438
24 Ga0070691_10055823 3300005341 Bacteria 1892
25 Ga0070687_100000582 3300005343 Bacteria 12165
26 Ga0070661_100018482 3300005344 Bacteria 4955
27 Ga0070661_100263287 3300005344 Bacteria 1333
28 Ga0070668_100099498 3300005347 Unclassified 2302
29 Ga0070669_100097027 3300005353 Bacteria 2218
30 Ga0070671_100163380 3300005355 Bacteria 1882
31 Ga0070674_100438623 3300005356 Unclassified 1075
32 Ga0070688_100069454 3300005365 Unclassified 2249
33 Ga0070659_100057136 3300005366 Bacteria 3076
34 Ga0070667_100799666 3300005367 Unclassified 875
35 Ga0070709_10000350 3300005434 Bacteria 28601
36 Ga0070709_10010911 3300005434 Bacteria 5045
37 Ga0070709_10049410 3300005434 Bacteria 2630
38 Ga0070709_10125242 3300005434 Archaea 1747
39 Ga0070709_10147660 3300005434 Viruses 1622
40 Ga0070709_10208628 3300005434 Bacteria 1388
41 Ga0070709_10259569 3300005434 Bacteria 1255
42 Ga0070709_10374189 3300005434 Bacteria 1057
43 Ga0070709_10493374 3300005434 Bacteria 929
44 Ga0070714_100000040 3300005435 Bacteria 119253
45 Ga0070714_100086292 3300005435 Bacteria 2743
46 Ga0070714_100215936 3300005435 Bacteria 1760
47 Ga0070714_100268585 3300005435 Unclassified 1581
48 Ga0070714_100390860 3300005435 Unclassified 1313
49 Ga0070714_100467080 3300005435 Unclassified 1200
50 Ga0070713_100000178 3300005436 Bacteria 42547
51 Ga0070713_100002882 3300005436 Bacteria 11254
52 Ga0070713_100014973 3300005436 Bacteria 5775
53 Ga0070713_100017734 3300005436 Bacteria 5395
54 Ga0070713_100035427 3300005436 Bacteria 4017
55 Ga0070713_100040335 3300005436 Unclassified 3795
56 Ga0070713_100141726 3300005436 Bacteria 2130
57 Ga0070710_10019628 3300005437 Unclassified 3496
58 Ga0070710_10021173 3300005437 Unclassified 3384
59 Ga0070710_10335297 3300005437 Bacteria 997
60 Ga0070711_100002684 3300005439 Bacteria 10211
61 Ga0070711_100047623 3300005439 Unclassified 2928
62 Ga0070711_100063209 3300005439 Bacteria 2583
63 Ga0070711_100184038 3300005439 Unclassified 1601
64 Ga0070705_100045687 3300005440 Bacteria 2521
65 Ga0070705_100056713 3300005440 Bacteria 2308
66 Ga0070705_100449926 3300005440 Unclassified 966
67 Ga0070708_100001730 3300005445 Bacteria 16760
68 Ga0070708_100006238 3300005445 Bacteria 9478
69 Ga0070708_100046827 3300005445 Bacteria 3817
70 Ga0070708_100088748 3300005445 Bacteria 2812
71 Ga0070708_100156793 3300005445 Bacteria 2120
72 Ga0070708_100305126 3300005445 Bacteria 1499
73 Ga0070708_100369357 3300005445 Bacteria 1352
74 Ga0070708_100874834 3300005445 Bacteria 844
75 Ga0070678_100103711 3300005456 Bacteria 2210
76 Ga0070681_10000160 3300005458 Bacteria 50922
77 Ga0070681_10006674 3300005458 Bacteria 11229
78 Ga0070681_10032373 3300005458 Bacteria 5246
79 Ga0070681_10051200 3300005458 Bacteria 4119
80 Ga0068867_100025620 3300005459 Bacteria 4233
81 Ga0068867_100049792 3300005459 Bacteria 3084
82 Ga0070685_10009968 3300005466 Unclassified 4929
83 Ga0070706_100000434 3300005467 Bacteria 50174
84 Ga0070706_100000747 3300005467 Bacteria 36530
85 Ga0070706_100001372 3300005467 Bacteria 25863
86 Ga0070706_100039142 3300005467 Unclassified 4378
87 Ga0070706_100089628 3300005467 Unclassified 2852
88 Ga0070706_100108786 3300005467 Bacteria 2579
89 Ga0070706_100197748 3300005467 Bacteria 1878
90 Ga0070707_100001963 3300005468 Bacteria 19671
91 Ga0070707_100145893 3300005468 Bacteria 2303
92 Ga0070707_100207559 3300005468 Bacteria 1909
93 Ga0070707_100443418 3300005468 Bacteria 1259
94 Ga0070698_100000558 3300005471 Bacteria 39929
95 Ga0070698_100000584 3300005471 Bacteria 39203
96 Ga0070698_100009189 3300005471 Bacteria 10608
97 Ga0070698_100016837 3300005471 Bacteria 7710
98 Ga0070698_100107731 3300005471 Bacteria 2754
99 Ga0070699_100000648 3300005518 Bacteria 32606
100 Ga0070699_100007853 3300005518 Bacteria 9268
101 Ga0070699_100386582 3300005518 Unclassified 1264
102 Ga0070679_100003769 3300005530 Bacteria 13909
103 Ga0070679_100018592 3300005530 Bacteria 6747
104 Ga0070684_100003906 3300005535 Bacteria 11288
105 Ga0070684_100025479 3300005535 Bacteria 4973
106 Ga0070684_100273249 3300005535 Bacteria 1547
107 Ga0070697_100000814 3300005536 Bacteria 23385
108 Ga0070697_100000951 3300005536 Bacteria 21825
109 Ga0070697_100001885 3300005536 Bacteria 16026
110 Ga0070697_100003676 3300005536 Bacteria 11794
111 Ga0070697_100105732 3300005536 Bacteria 2342
112 Ga0070697_100190389 3300005536 Bacteria 1741
113 Ga0068853_100054090 3300005539 Bacteria 3459
114 Ga0068853_100082707 3300005539 Bacteria 2812
115 Ga0068853_100092976 3300005539 Bacteria 2654
116 Ga0068853_100204066 3300005539 Bacteria 1799
117 Ga0068853_100325257 3300005539 Bacteria 1426
118 Ga0070672_100247316 3300005543 Unclassified 1501
119 Ga0070672_100290603 3300005543 Bacteria 1384
120 Ga0070686_100006943 3300005544 Bacteria 6308
121 Ga0070686_100132445 3300005544 Bacteria 1726
122 Ga0070695_100083501 3300005545 Bacteria 2116
123 Ga0070695_100412772 3300005545 Bacteria 1026
124 Ga0070696_100035796 3300005546 Unclassified 3419
125 Ga0070693_100144112 3300005547 Bacteria 1503
126 Ga0070665_100319966 3300005548 Bacteria 1556
127 Ga0070665_100814246 3300005548 Bacteria 947
128 Ga0068855_100000151 3300005563 Bacteria 88133
129 Ga0068855_100002998 3300005563 Bacteria 20641
130 Ga0068855_100007501 3300005563 Bacteria 13205
131 Ga0068855_100158694 3300005563 Bacteria 2568
132 Ga0068855_100180524 3300005563 Bacteria 2386
133 Ga0068855_100357941 3300005563 Bacteria 1606
134 Ga0068855_100619694 3300005563 Unclassified 1165
135 Ga0070664_100001009 3300005564 Bacteria 22089
136 Ga0070664_100022499 3300005564 Bacteria 5198
137 Ga0068857_100004121 3300005577 Bacteria 12246
138 Ga0068857_100013259 3300005577 Bacteria 7179
139 Ga0068857_100041231 3300005577 Bacteria 4094
140 Ga0068854_100018457 3300005578 Bacteria 4683
141 Ga0068854_100024280 3300005578 Unclassified 4148
142 Ga0068856_100000119 3300005614 Bacteria 78324
143 Ga0068856_100000220 3300005614 Bacteria 61662
144 Ga0068856_100003015 3300005614 Bacteria 17242
145 Ga0068856_100016341 3300005614 Bacteria 7180
146 Ga0068856_100126556 3300005614 Unclassified 2558
147 Ga0070702_100021933 3300005615 Unclassified 3369
148 Ga0068852_100004234 3300005616 Bacteria 10130
149 Ga0068852_100367720 3300005616 Unclassified 1408
150 Ga0068864_100302837 3300005618 Bacteria 1497
151 Ga0068864_100822900 3300005618 Unclassified 914
152 Ga0068866_10002344 3300005718 Bacteria 7847
153 Ga0068866_10024488 3300005718 Bacteria 2823
154 Ga0068866_10027378 3300005718 Bacteria 2702
155 Ga0068866_10087690 3300005718 Bacteria 1687
156 Ga0068861_100076355 3300005719 Unclassified 2611
157 Ga0068861_100238477 3300005719 Bacteria 1546
158 Ga0068851_10001808 3300005834 Bacteria 9364
159 Ga0068851_10012496 3300005834 Bacteria 4004
160 Ga0068851_10148137 3300005834 Unclassified 1281
161 Ga0068851_10158244 3300005834 Bacteria 1242
162 Ga0068870_10003367 3300005840 Bacteria 6766
163 Ga0068863_100007048 3300005841 Bacteria 11015
164 Ga0068863_100047123 3300005841 Bacteria 4090
165 Ga0068863_100100228 3300005841 Bacteria 2753
166 Ga0068863_100198091 3300005841 Unclassified 1931
167 Ga0068858_100000231 3300005842 Bacteria 60174
168 Ga0068858_100009662 3300005842 Bacteria 9192
169 Ga0068858_100026194 3300005842 Bacteria 5421
170 Ga0068860_100008540 3300005843 Bacteria 10206
171 Ga0068860_100018877 3300005843 Bacteria 6700
172 Ga0068860_100089234 3300005843 Unclassified 2935
173 Ga0068860_100142298 3300005843 Bacteria 2306
174 Ga0068860_100315622 3300005843 Bacteria 1533
175 Ga0068862_100018399 3300005844 Bacteria 5817
176 Ga0068862_100044682 3300005844 Bacteria 3779
177 Ga0068862_100376089 3300005844 Bacteria 1324
178 Ga0070717_10001091 3300006028 Bacteria 18238
179 Ga0070717_10027214 3300006028 Bacteria 4569
180 Ga0070717_10036944 3300006028 Bacteria 3964
181 Ga0070717_10058945 3300006028 Unclassified 3175
182 Ga0070717_10256775 3300006028 Bacteria 1545
183 Ga0070717_10258189 3300006028 Unclassified 1541
184 Ga0070717_10618156 3300006028 Bacteria 983
185 Ga0070717_10807142 3300006028 Unclassified 854
186 Ga0070715_10005647 3300006163 Bacteria 4190
187 Ga0070715_10007956 3300006163 Unclassified 3673
188 Ga0070715_10073805 3300006163 Unclassified 1531
189 Ga0070716_100003422 3300006173 Bacteria 7459
190 Ga0070716_100005229 3300006173 Bacteria 6272
191 Ga0070716_100010931 3300006173 Bacteria 4566
192 Ga0070716_100018364 3300006173 Unclassified 3642
193 Ga0070716_100034625 3300006173 Bacteria 2771
194 Ga0070716_100117962 3300006173 Bacteria 1656
195 Ga0070716_100146637 3300006173 Bacteria 1513
196 Ga0070716_100193569 3300006173 Bacteria 1346
197 Ga0070712_100000302 3300006175 Bacteria 27828
198 Ga0070712_100000516 3300006175 Bacteria 22235
199 Ga0070712_100003211 3300006175 Bacteria 10076
200 Ga0070712_100007006 3300006175 Bacteria 7028
201 Ga0070712_100009124 3300006175 Bacteria 6244
202 Ga0070712_100058734 3300006175 Bacteria 2706
203 Ga0070712_100078505 3300006175 Unclassified 2383
204 Ga0070712_100090820 3300006175 Bacteria 2237
205 Ga0070712_100143551 3300006175 Bacteria 1825
206 Ga0097621_100000073 3300006237 Bacteria 52012
207 Ga0097621_100000591 3300006237 Bacteria 25513
208 Ga0097621_100020148 3300006237 Bacteria 5136
209 Ga0097621_100056516 3300006237 Bacteria 3206
210 Ga0097621_100487469 3300006237 Bacteria 1115
211 Ga0068871_100000697 3300006358 Bacteria 22812
212 Ga0068871_100001411 3300006358 Bacteria 16074
213 Ga0068871_100032583 3300006358 Bacteria 4118
214 Ga0075433_10070900 3300006852 Bacteria 3063
215 Ga0075433_10108651 3300006852 Unclassified 2460
216 Ga0075434_100003427 3300006871 Bacteria 14182
217 Ga0075434_100036813 3300006871 Bacteria 4840
218 Ga0075434_100329258 3300006871 Bacteria 1548
219 Ga0068865_100036167 3300006881 Unclassified 3327
220 Ga0068865_100158816 3300006881 Unclassified 1722
221 Ga0075436_100198127 3300006914 Bacteria 1422
222 Ga0075435_100102803 3300007076 Bacteria 2369
223 Ga0075435_100134262 3300007076 Unclassified 2072
224 Ga0105250_10011749 3300009092 Unclassified 3630
225 Ga0105240_10025067 3300009093 Bacteria 7850
226 Ga0105240_10085017 3300009093 Bacteria 3878
227 Ga0105240_10103929 3300009093 Unclassified 3450
228 Ga0105240_10163838 3300009093 Bacteria 2638
229 Ga0105240_10373039 3300009093 Bacteria 1613
230 Ga0105240_10553302 3300009093 Bacteria 1273
231 Ga0111539_10001725 3300009094 Bacteria 29105
232 Ga0111539_10210790 3300009094 Unclassified 2264
233 Ga0105245_10025564 3300009098 Bacteria 5194
234 Ga0105245_10052216 3300009098 Bacteria 3666
235 Ga0105245_10083843 3300009098 Unclassified 2918
236 Ga0105245_10190851 3300009098 Bacteria 1962
237 Ga0105245_10879158 3300009098 Unclassified 937
238 Ga0105243_10235196 3300009148 Unclassified 1627
239 Ga0105241_10012632 3300009174 Bacteria 6198
240 Ga0105241_10014788 3300009174 Bacteria 5713
241 Ga0105241_10039238 3300009174 Bacteria 3571
242 Ga0105241_10048357 3300009174 Bacteria 3237
243 Ga0105241_10089464 3300009174 Bacteria 2426
244 Ga0105242_10051629 3300009176 Bacteria 3352
245 Ga0105248_10092429 3300009177 Bacteria 3407
246 Ga0105248_10166301 3300009177 Bacteria 2487
247 Ga0105248_10281448 3300009177 Bacteria 1872
248 Ga0105237_10078356 3300009545 Bacteria 3294
249 Ga0105238_10000497 3300009551 Bacteria 41307
250 Ga0105238_10062825 3300009551 Bacteria 3714
251 Ga0105249_10008098 3300009553 Bacteria 9164
252 Ga0099796_10160737 3300010159 Bacteria 890
253 Ga0105239_10004107 3300010375 Bacteria 17507
254 Ga0105239_10023933 3300010375 Bacteria 6727
255 Ga0105239_10065852 3300010375 Bacteria 3980
256 Ga0105239_10142754 3300010375 Unclassified 2669
257 Ga0105239_10331209 3300010375 Bacteria 1717
258 Ga0105239_10488933 3300010375 Unclassified 1399
259 Ga0105239_11403149 3300010375 Unclassified 806
260 Ga0105246_10002297 3300011119 Bacteria 11534
261 Ga0157373_10114035 3300013100 Unclassified 1899
262 Ga0157373_10220480 3300013100 Bacteria 1338
263 Ga0157371_10018154 3300013102 Bacteria 5209
264 Ga0157371_10022982 3300013102 Bacteria 4560
265 Ga0157371_10306907 3300013102 Unclassified 1149
266 Ga0157369_10000108 3300013105 Bacteria 117027
267 Ga0157369_10042083 3300013105 Bacteria 4984
268 Ga0157369_10046247 3300013105 Unclassified 4730
269 Ga0157369_10255062 3300013105 Bacteria 1830
270 Ga0157369_10609182 3300013105 Unclassified 1127
271 Ga0157369_10867758 3300013105 Bacteria 926
272 Ga0157374_10001195 3300013296 Bacteria 22177
273 Ga0157374_10001477 3300013296 Bacteria 19860
274 Ga0157374_10002238 3300013296 Bacteria 16295
275 Ga0157374_10008126 3300013296 Bacteria 8967
276 Ga0157374_10016227 3300013296 Bacteria 6544
277 Ga0157374_10019923 3300013296 Bacteria 5946
278 Ga0157374_10450777 3300013296 Bacteria 1288
279 Ga0157378_10000030 3300013297 Bacteria 124811
280 Ga0157378_10000099 3300013297 Bacteria 81561
281 Ga0157378_10008641 3300013297 Bacteria 8864
282 Ga0157378_10035410 3300013297 Bacteria 4415
283 Ga0157378_10044565 3300013297 Bacteria 3940
284 Ga0157378_10072246 3300013297 Bacteria 3100
285 Ga0157378_10197277 3300013297 Bacteria 1902
286 Ga0163162_10015270 3300013306 Bacteria 7502
287 Ga0163162_10042764 3300013306 Unclassified 4535
288 Ga0163162_10160719 3300013306 Bacteria 2368
289 Ga0163162_10599879 3300013306 Unclassified 1227
290 Ga0157372_10000576 3300013307 Bacteria 40151
291 Ga0157372_10009048 3300013307 Bacteria 10583
292 Ga0157372_10009135 3300013307 Bacteria 10530
293 Ga0157372_10028758 3300013307 Bacteria 6067
294 Ga0157372_10123660 3300013307 Unclassified 2974
295 Ga0157372_10134785 3300013307 Bacteria 2843
296 Ga0157372_10166588 3300013307 Unclassified 2548
297 Ga0157372_10181702 3300013307 Bacteria 2435
298 Ga0157375_10593977 3300013308 Unclassified 1267
299 Ga0163163_10027104 3300014325 Bacteria 5484
300 Ga0163163_10043414 3300014325 Unclassified 4407
301 Ga0163163_10348719 3300014325 Bacteria 1536
302 Ga0163163_10536694 3300014325 Unclassified 1232
303 Ga0157380_10019134 3300014326 Bacteria 5100
304 Ga0182008_10002806 3300014497 Bacteria 10777
305 Ga0157377_10002339 3300014745 Bacteria 8357
306 Ga0157379_10008128 3300014968 Bacteria 9113
307 Ga0157379_10038083 3300014968 Unclassified 4290
308 Ga0157379_10189082 3300014968 Bacteria 1861
309 Ga0157379_10234981 3300014968 Bacteria 1662
310 Ga0157376_10007486 3300014969 Bacteria 7802
311 Ga0157376_10038390 3300014969 Bacteria 3896
312 Ga0157376_10078486 3300014969 Bacteria 2827
313 Ga0157376_10101993 3300014969 Bacteria 2509
314 Ga0157376_10149985 3300014969 Unclassified 2101
315 Ga0157376_10216058 3300014969 Bacteria 1773
316 Ga0182006_1093894 3300015261 Unclassified 1074
317 Ga0182007_10004978 3300015262 Bacteria 5916
318 Ga0182007_10023467 3300015262 Unclassified 2168
319 Ga0182005_1025472 3300015265 Unclassified 1614
320 Ga0163161_10003125 3300017792 Bacteria 11672
321 Ga0224569_102686 3300022732 Unclassified 1425
322 Ga0224571_102495 3300022734 Unclassified 1170
323 Ga0224572_1001779 3300024225 Unclassified 3302
324 Ga0224572_1003555 3300024225 Unclassified 2641
325 Ga0228598_1000043 3300024227 Bacteria 17812
326 Ga0228598_1000726 3300024227 Bacteria 7053
327 Ga0207697_10019520 3300025315 Bacteria 2776
328 Ga0207692_10009477 3300025898 Unclassified 4071
329 Ga0207642_10008283 3300025899 Unclassified 3557
330 Ga0207642_10014854 3300025899 Bacteria 2885
331 Ga0207710_10115117 3300025900 Bacteria 1280
332 Ga0207688_10057239 3300025901 Unclassified 2191
333 Ga0207647_10008012 3300025904 Bacteria 7598
334 Ga0207647_10008692 3300025904 Bacteria 7255
335 Ga0207647_10015621 3300025904 Bacteria 5199
336 Ga0207647_10087607 3300025904 Bacteria 1859
337 Ga0207685_10002145 3300025905 Bacteria 4437
338 Ga0207685_10015555 3300025905 Bacteria 2413
339 Ga0207685_10051654 3300025905 Unclassified 1589
340 Ga0207699_10000578 3300025906 Bacteria 18048
341 Ga0207699_10034971 3300025906 Bacteria 2855
342 Ga0207699_10036809 3300025906 Bacteria 2793
343 Ga0207699_10048345 3300025906 Unclassified 2498
344 Ga0207699_10077329 3300025906 Bacteria 2053
345 Ga0207699_10081677 3300025906 Bacteria 2006
346 Ga0207699_10190222 3300025906 Bacteria 1385
347 Ga0207699_10201584 3300025906 Bacteria 1349
348 Ga0207699_10478647 3300025906 Bacteria 896
349 Ga0207645_10003048 3300025907 Bacteria 12889
350 Ga0207645_10107051 3300025907 Bacteria 1808
351 Ga0207643_10000363 3300025908 Bacteria 30460
352 Ga0207684_10000203 3300025910 Bacteria 91833
353 Ga0207684_10000560 3300025910 Bacteria 45531
354 Ga0207684_10000966 3300025910 Bacteria 32224
355 Ga0207684_10003721 3300025910 Bacteria 14769
356 Ga0207684_10165735 3300025910 Bacteria 1904
357 Ga0207684_10271203 3300025910 Unclassified 1464
358 Ga0207684_10393837 3300025910 Bacteria 1191
359 Ga0207654_10035546 3300025911 Bacteria 2777
360 Ga0207654_10128355 3300025911 Unclassified 1602
361 Ga0207654_10144389 3300025911 Bacteria 1521
362 Ga0207654_10159255 3300025911 Bacteria 1457
363 Ga0207707_10003004 3300025912 Bacteria 14996
364 Ga0207707_10005292 3300025912 Bacteria 11290
365 Ga0207707_10076214 3300025912 Bacteria 2926
366 Ga0207707_10117563 3300025912 Bacteria 2324
367 Ga0207707_10378861 3300025912 Unclassified 1216
368 Ga0207707_10635026 3300025912 Bacteria 901
369 Ga0207695_10054089 3300025913 Bacteria 4195
370 Ga0207695_10120523 3300025913 Bacteria 2592
371 Ga0207695_10572675 3300025913 Unclassified 1011
372 Ga0207671_10033453 3300025914 Bacteria 3825
373 Ga0207671_10341144 3300025914 Bacteria 1187
374 Ga0207693_10000071 3300025915 Bacteria 89988
375 Ga0207693_10000373 3300025915 Bacteria 41202
376 Ga0207693_10004195 3300025915 Bacteria 12218
377 Ga0207693_10005083 3300025915 Bacteria 11026
378 Ga0207693_10015729 3300025915 Bacteria 6063
379 Ga0207693_10016451 3300025915 Bacteria 5909
380 Ga0207693_10068637 3300025915 Bacteria 2775
381 Ga0207663_10015835 3300025916 Bacteria 4169
382 Ga0207663_10046547 3300025916 Bacteria 2673
383 Ga0207663_10089819 3300025916 Unclassified 2035
384 Ga0207663_10156469 3300025916 Unclassified 1604
385 Ga0207663_10208696 3300025916 Bacteria 1414
386 Ga0207663_10429722 3300025916 Unclassified 1015
387 Ga0207660_10154978 3300025917 Bacteria 1763
388 Ga0207660_10265251 3300025917 Bacteria 1359
389 Ga0207662_10000664 3300025918 Bacteria 15610
390 Ga0207657_10001432 3300025919 Bacteria 25493
391 Ga0207657_10006629 3300025919 Bacteria 11986
392 Ga0207657_10011646 3300025919 Bacteria 8720
393 Ga0207649_10003934 3300025920 Bacteria 8101
394 Ga0207649_10020337 3300025920 Bacteria 3806
395 Ga0207652_10005098 3300025921 Bacteria 10660
396 Ga0207652_10085577 3300025921 Bacteria 2763
397 Ga0207652_10351587 3300025921 Unclassified 1330
398 Ga0207646_10000657 3300025922 Bacteria 44736
399 Ga0207646_10001084 3300025922 Bacteria 34596
400 Ga0207646_10020896 3300025922 Bacteria 6057
401 Ga0207646_10076903 3300025922 Bacteria 2983
402 Ga0207646_10475507 3300025922 Bacteria 1127
403 Ga0207681_10075603 3300025923 Bacteria 2363
404 Ga0207681_10092393 3300025923 Unclassified 2163
405 Ga0207694_10000864 3300025924 Bacteria 26978
406 Ga0207694_10045564 3300025924 Bacteria 3387
407 Ga0207694_10058027 3300025924 Bacteria 3011
408 Ga0207694_10654826 3300025924 Unclassified 885
409 Ga0207650_10000051 3300025925 Bacteria 168652
410 Ga0207650_10087631 3300025925 Bacteria 2372
411 Ga0207650_10613986 3300025925 Unclassified 915
412 Ga0207659_10047131 3300025926 Unclassified 3047
413 Ga0207687_10007789 3300025927 Bacteria 7026
414 Ga0207687_10058509 3300025927 Unclassified 2712
415 Ga0207687_10060643 3300025927 Unclassified 2669
416 Ga0207687_10125026 3300025927 Bacteria 1929
417 Ga0207700_10000089 3300025928 Bacteria 56639
418 Ga0207700_10000151 3300025928 Bacteria 41533
419 Ga0207700_10037360 3300025928 Bacteria 3516
420 Ga0207700_10052468 3300025928 Bacteria 3049
421 Ga0207700_10061467 3300025928 Bacteria 2849
422 Ga0207700_10067798 3300025928 Bacteria 2733
423 Ga0207700_10275864 3300025928 Unclassified 1445
424 Ga0207700_10302096 3300025928 Bacteria 1382
425 Ga0207700_10383563 3300025928 Bacteria 1229
426 Ga0207700_10579687 3300025928 Unclassified 997
427 Ga0207664_10000029 3300025929 Bacteria 183815
428 Ga0207664_10002505 3300025929 Bacteria 12164
429 Ga0207664_10076232 3300025929 Bacteria 2714
430 Ga0207664_10112581 3300025929 Bacteria 2266
431 Ga0207664_10425012 3300025929 Unclassified 1184
432 Ga0207644_10186883 3300025931 Unclassified 1627
433 Ga0207690_10281024 3300025932 Bacteria 1296
434 Ga0207690_10377270 3300025932 Unclassified 1126
435 Ga0207706_10000783 3300025933 Bacteria 32931
436 Ga0207706_10013806 3300025933 Bacteria 7330
437 Ga0207686_10016623 3300025934 Unclassified 4132
438 Ga0207686_10205919 3300025934 Bacteria 1411
439 Ga0207709_10136057 3300025935 Bacteria 1682
440 Ga0207669_10134358 3300025937 Bacteria 1706
441 Ga0207704_10047195 3300025938 Bacteria 2572
442 Ga0207704_10138636 3300025938 Bacteria 1698
443 Ga0207665_10001361 3300025939 Bacteria 16470
444 Ga0207665_10005766 3300025939 Bacteria 8235
445 Ga0207665_10033385 3300025939 Bacteria 3410
446 Ga0207665_10044943 3300025939 Bacteria 2956
447 Ga0207665_10050559 3300025939 Bacteria 2795
448 Ga0207665_10116174 3300025939 Bacteria 1886
449 Ga0207665_10175931 3300025939 Unclassified 1548
450 Ga0207665_10333832 3300025939 Unclassified 1141
451 Ga0207691_10005718 3300025940 Bacteria 12024
452 Ga0207691_10153040 3300025940 Unclassified 2027
453 Ga0207691_10347327 3300025940 Bacteria 1269
454 Ga0207711_10002266 3300025941 Bacteria 17271
455 Ga0207711_10024402 3300025941 Bacteria 5065
456 Ga0207711_10088575 3300025941 Bacteria 2718
457 Ga0207689_10000860 3300025942 Bacteria 29295
458 Ga0207689_10001015 3300025942 Bacteria 26978
459 Ga0207661_10000969 3300025944 Bacteria 18902
460 Ga0207661_10098593 3300025944 Bacteria 2449
461 Ga0207661_10111202 3300025944 Bacteria 2317
462 Ga0207661_10257823 3300025944 Unclassified 1552
463 Ga0207679_10000203 3300025945 Bacteria 47291
464 Ga0207679_10008130 3300025945 Bacteria 6673
465 Ga0207679_10026112 3300025945 Bacteria 4025
466 Ga0207679_10054777 3300025945 Bacteria 2938
467 Ga0207667_10001767 3300025949 Bacteria 27219
468 Ga0207667_10015239 3300025949 Bacteria 8740
469 Ga0207667_10023096 3300025949 Bacteria 6852
470 Ga0207667_10060734 3300025949 Bacteria 3956
471 Ga0207651_10011127 3300025960 Bacteria 5020
472 Ga0207712_10027192 3300025961 Bacteria 3819
473 Ga0207668_10404067 3300025972 Unclassified 1155
474 Ga0207640_10014450 3300025981 Bacteria 4547
475 Ga0207640_10041985 3300025981 Bacteria 2913
476 Ga0207640_10221073 3300025981 Bacteria 1450
477 Ga0207640_10520323 3300025981 Unclassified 994
478 Ga0207658_10002771 3300025986 Bacteria 12627
479 Ga0207658_10074272 3300025986 Bacteria 2583
480 Ga0207677_10034909 3300026023 Bacteria 3261
481 Ga0207677_10050795 3300026023 Bacteria 2807
482 Ga0207677_10409368 3300026023 Unclassified 1152
483 Ga0207703_10002784 3300026035 Bacteria 14952
484 Ga0207703_10047615 3300026035 Bacteria 3458
485 Ga0207703_10440686 3300026035 Unclassified 1215
486 Ga0207639_10025861 3300026041 Bacteria 4259
487 Ga0207639_10075734 3300026041 Unclassified 2647
488 Ga0207639_10079614 3300026041 Bacteria 2590
489 Ga0207639_10285962 3300026041 Bacteria 1452
490 Ga0207639_10698024 3300026041 Bacteria 941
491 Ga0207678_10001066 3300026067 Bacteria 25100
492 Ga0207678_10078153 3300026067 Bacteria 2834
493 Ga0207708_10098080 3300026075 Bacteria 2265
494 Ga0207702_10000086 3300026078 Bacteria 106199
495 Ga0207702_10000764 3300026078 Bacteria 34175
496 Ga0207702_10915377 3300026078 Unclassified 869
497 Ga0207641_10000025 3300026088 Bacteria 247727
498 Ga0207641_10008135 3300026088 Bacteria 8684
499 Ga0207641_10185082 3300026088 Bacteria 1910
500 Ga0207641_10410976 3300026088 Unclassified 1301
501 Ga0207641_10458734 3300026088 Bacteria 1233
502 Ga0207641_10521001 3300026088 Bacteria 1156
503 Ga0207641_10844326 3300026088 Bacteria 907
504 Ga0207648_10000966 3300026089 Bacteria 32474
505 Ga0207648_10018922 3300026089 Bacteria 6221
506 Ga0207648_10049644 3300026089 Unclassified 3671
507 Ga0207676_10002968 3300026095 Bacteria 12105
508 Ga0207676_10396687 3300026095 Unclassified 1288
509 Ga0207676_10624765 3300026095 Unclassified 1037
510 Ga0207674_10000281 3300026116 Bacteria 64232
511 Ga0207674_10001451 3300026116 Bacteria 30625
512 Ga0207674_10050860 3300026116 Bacteria 4231
513 Ga0207675_100052462 3300026118 Unclassified 3805
514 Ga0207675_100282776 3300026118 Bacteria 1612
515 Ga0207683_10000742 3300026121 Bacteria 29663
516 Ga0207698_10191412 3300026142 Unclassified 1822
517 Ga0207428_10159339 3300027907 Bacteria 1714
518 Ga0265356_1000061 3300028017 Bacteria 17872
519 Ga0265356_1005330 3300028017 Bacteria 1538
520 Ga0268266_10012116 3300028379 Bacteria 7463
521 Ga0268266_10041699 3300028379 Bacteria 3918
522 Ga0268266_10765129 3300028379 Bacteria 932
523 Ga0268265_10048950 3300028380 Bacteria 3176
524 Ga0268264_10025027 3300028381 Bacteria 4877
525 Ga0268264_10065356 3300028381 Bacteria 3065
526 Ga0268264_10073669 3300028381 Bacteria 2899
527 Ga0268264_10120172 3300028381 Bacteria 2315
528 Ga0268264_10797795 3300028381 Unclassified 943
529 Ga0265338_10001594 3300028800 Bacteria 36404
530 Ga0265338_10002879 3300028800 Bacteria 25111
531 Ga0265338_10086960 3300028800 Bacteria 2599
532 Ga0265338_10105178 3300028800 Unclassified 2288
533 Ga0265762_1000174 3300030760 Bacteria 10217
534 Ga0265762_1000799 3300030760 Bacteria 5616
535 Ga0265762_1001512 3300030760 Unclassified 4220
536 Ga0265762_1029986 3300030760 Bacteria 1030
537 Ga0265770_1005637 3300030878 Unclassified 1733
538 Ga0265770_1012516 3300030878 Unclassified 1258
539 Ga0265765_1000227 3300030879 Bacteria 3970
540 Ga0265760_10000916 3300031090 Bacteria 8522
541 Ga0265760_10001157 3300031090 Bacteria 7688
542 Ga0265760_10003613 3300031090 Bacteria 4485
543 Ga0265760_10007604 3300031090 Unclassified 3095
544 Ga0265760_10014723 3300031090 Unclassified 2242
545 Ga0265760_10019982 3300031090 Unclassified 1931
546 Ga0265330_10004610 3300031235 Bacteria 6968
547 Ga0265325_10006588 3300031241 Bacteria 7034
548 Ga0265325_10087888 3300031241 Unclassified 1536
549 Ga0265339_10002485 3300031249 Bacteria 13174
550 Ga0265316_10016481 3300031344 Bacteria 6407
551 Ga0265316_10048368 3300031344 Unclassified 3357
552 Ga0265314_10006083 3300031711 Bacteria 10723
553 Ga0265314_10018014 3300031711 Bacteria 5523
554 Ga0265314_10062976 3300031711 Unclassified 2518
555 Ga0265342_10017755 3300031712 Bacteria 4621
556 Ga0373926_0011088 3300035083 Bacteria 3029
557 Ga0373926_0123373 3300035083 Unclassified 978
558 Ga0373934_0056436 3300035086 Bacteria 1562
559 Ga0373923_0003916 3300035111 Bacteria 4860
560 Ga0373932_0011372 3300035112 Bacteria 2174
561 Ga0373939_0074223 3300035114 Bacteria 1115
562 Ga0373945_0001340 3300035116 Bacteria 7483
563 Ga0373954_0020415 3300035118 Bacteria 2997
564 Ga0373960_0019967 3300035121 Bacteria 1767
565 Ga0373943_0000083 3300035170 Bacteria 33682
566 Ga0373946_0137812 3300035171 Unclassified 1128
567 Ga0373924_0035713 3300035410 Unclassified 2016
568 Ga0373924_0042504 3300035410 Bacteria 1864
569 Ga0373931_0057807 3300035691 Bacteria 2081
570 Ga0373931_0084697 3300035691 Bacteria 1756
571 Ga0373931_0362750 3300035691 Bacteria 909
572 Ga0373931_0398299 3300035691 Unclassified 871
573 Ga0373935_0012955 3300035692 Bacteria 5025
574 Ga0373935_0018540 3300035692 Bacteria 4235
575 Ga0373935_0247514 3300035692 Bacteria 1246
576 Ga0373927_0000193 3300035695 Bacteria 48831
577 Ga0373927_0023786 3300035695 Bacteria 4010
578 Ga0373927_0339267 3300035695 Bacteria 990
579 Ga0373947_0002347 3300035725 Bacteria 11445
580 Ga0373947_0065445 3300035725 Bacteria 2217
581 Ga0373937_0036782 3300036401 Bacteria 4462
582 Ga0373937_0113989 3300036401 Bacteria 2516
583 Ga0373937_0186297 3300036401 Unclassified 1950
584 Ga0373925_0002463 3300037068 Bacteria 14807
585 Ga0373925_0170188 3300037068 Bacteria 1720
586 Ga0373925_0236812 3300037068 Bacteria 1461
587 Ga0373925_0286992 3300037068 Unclassified 1326
588 Ga0436360_0795382 3300039438 Unclassified 939
589 Ga0451807_2696225 3300041486 Bacteria 4712
590 Ga0466966_0187557 3300044684 Bacteria 1254
591 Ga0466964_0081776 3300044706 Bacteria 1388
592 Ga0466959_0173018 3300045049 Unclassified 1514
593 Ga0466959_0362717 3300045049 Unclassified 987
594 Ga0466967_0085163 3300045976 Unclassified 2861
595 Ga0466967_0513580 3300045976 Unclassified 1177
596 Ga0495629_0005723 3300046459 Bacteria 9275
597 Ga0495651_0162932 3300046462 Bacteria 1596
598 Ga0495580_0000108 3300046472 Bacteria 55508
599 Ga0495580_0001723 3300046472 Bacteria 19219
600 Ga0495580_0002290 3300046472 Bacteria 16705
601 Ga0495580_0025729 3300046472 Bacteria 4299
602 Ga0495580_0028672 3300046472 Bacteria 4046
603 Ga0495580_0038669 3300046472 Unclassified 3416
604 Ga0495580_0047096 3300046472 Bacteria 3057
605 Ga0495580_0055297 3300046472 Bacteria 2797
606 Ga0495580_0284646 3300046472 Unclassified 1127
607 Ga0495582_0002288 3300046473 Bacteria 10720
608 Ga0495582_0031658 3300046473 Bacteria 2908
609 Ga0495664_0015596 3300046477 Bacteria 4321
610 Ga0495618_0166044 3300046514 Bacteria 1406
611 Ga0495652_0358841 3300046529 Bacteria 1042
612 Ga0495586_0221672 3300046535 Bacteria 1075
613 Ga0495667_0148637 3300046559 Bacteria 1509
614 Ga0495667_0273564 3300046559 Bacteria 1073
615 Ga0495659_0083055 3300046664 Bacteria 1219
616 Ga0495646_0186170 3300046680 Unclassified 1137
617 Ga0495658_0069764 3300046683 Unclassified 2038
618 Ga0495669_0032145 3300046684 Bacteria 2306
619 Ga0495674_0006546 3300047319 Bacteria 11177
620 Ga0495674_0024813 3300047319 Bacteria 5504
621 Ga0495674_0193313 3300047319 Bacteria 1690
622 Ga0495674_0625385 3300047319 Bacteria 851
623 Ga0495676_0301638 3300047321 Bacteria 1080
624 Ga0496100_0040425 3300048903 Bacteria 2967
625 Ga0496100_0404625 3300048903 Unclassified 1040
626 Ga0496101_0065623 3300048904 Bacteria 2646
627 Ga0496101_0084194 3300048904 Unclassified 2355
628 Ga0496102_0149775 3300048905 Bacteria 2192
629 Ga0496102_0235323 3300048905 Unclassified 1727
630 Ga0496103_0104171 3300048906 Bacteria 1798
631 Ga0496103_0248430 3300048906 Bacteria 1145
632 Ga0496104_0042124 3300048907 Bacteria 4284
633 Ga0496104_0058617 3300048907 Unclassified 3645
634 Ga0496104_0215187 3300048907 Bacteria 1833
635 Ga0496104_0790759 3300048907 Unclassified 855
636 Ga0496105_0054121 3300048908 Bacteria 3314
637 Ga0496105_0217933 3300048908 Unclassified 1554
638 Ga0496106_0040558 3300048909 Unclassified 3487
639 Ga0496106_0241258 3300048909 Unclassified 1444
640 Ga0496108_0000169 3300048911 Bacteria 61406
641 Ga0496108_0108448 3300048911 Bacteria 2372
642 Ga0496109_0000072 3300048912 Bacteria 107549
643 Ga0496109_0155443 3300048912 Bacteria 2142
644 Ga0496109_0210200 3300048912 Bacteria 1830
645 Ga0496110_0013408 3300048913 Bacteria 6775
646 Ga0496111_0130620 3300048914 Unclassified 1858
647 Ga0496112_0000064 3300048915 Bacteria 72159
648 Ga0496112_0003953 3300048915 Bacteria 12423
649 Ga0496112_0011741 3300048915 Bacteria 8020
650 Ga0496112_0047008 3300048915 Bacteria 4233
651 Ga0496112_0090510 3300048915 Bacteria 3029
652 Ga0496112_0102589 3300048915 Bacteria 2830
653 Ga0496112_0228185 3300048915 Unclassified 1817
654 Ga0496112_0693803 3300048915 Bacteria 946
655 Ga0496112_0763627 3300048915 Bacteria 892
656 Ga0496113_0001888 3300048916 Bacteria 11952
657 Ga0496114_0013431 3300048917 Bacteria 6565
658 Ga0496114_0126017 3300048917 Bacteria 2208
659 Ga0496115_0026977 3300048918 Bacteria 4490
660 Ga0496115_0028234 3300048918 Bacteria 4397
661 Ga0496115_0047333 3300048918 Bacteria 3439
662 Ga0501047_0099493 3300049581 Bacteria 2787
663 Ga0501083_0024907 3300049744 Bacteria 4144
664 nmdc:mga08y16_13459_c1 3300050511 Bacteria 8608
665 nmdc:mga0n895_418882_c1 3300050512 Bacteria 1354
666 nmdc:mga0rr50_453849_c1 3300050513 Unclassified 1087
667 nmdc:mga0rr50_89888_c1 3300050513 Bacteria 2388
668 nmdc:mga0a205_116448_c1 3300050515 Unclassified 2571
669 nmdc:mga0a205_335181_c1 3300050515 Bacteria 1382
670 Ga0495601_0222157 3300053077 Bacteria 1234
671 Ga0501084_0002658 3300054114 Bacteria 14402
672 Ga0501082_0020439 3300060353 Bacteria 5709
673 Ga0224569_101792
674 rootL2_10039505
675 Ga0065712_10035299
676 Ga0065712_10113431
677 Ga0065715_10006424
678 Ga0065715_10201311
679 Ga0070658_10123318
680 Ga0070676_10013263
681 Ga0070676_10223502
682 Ga0070683_100114474
683 Ga0070690_100012913
684 Ga0070690_100061327
685 Ga0068869_100013215
686 Ga0068869_100281927
687 Ga0070682_100005954
688 Ga0068868_100017815
689 Ga0068868_100023467
690 Ga0068868_100060269
691 Ga0068868_100061637
692 Ga0068868_100411987
693 Ga0070660_100022564
694 Ga0070660_100145507
695 Ga0070689_100005861
696 Ga0070691_10055823
697 Ga0070687_100000582
698 Ga0070661_100018482
699 Ga0070661_100263287
700 Ga0070668_100099498
701 Ga0070669_100097027
702 Ga0070671_100163380
703 Ga0070674_100438623
704 Ga0070688_100069454
705 Ga0070659_100057136
706 Ga0070667_100799666
707 Ga0070709_10000350
708 Ga0070709_10010911
709 Ga0070709_10049410
710 Ga0070709_10125242
711 Ga0070709_10147660
712 Ga0070709_10208628
713 Ga0070709_10259569
714 Ga0070709_10374189
715 Ga0070709_10493374
716 Ga0070714_100000040
717 Ga0070714_100086292
718 Ga0070714_100215936
719 Ga0070714_100268585
720 Ga0070714_100390860
721 Ga0070714_100467080
722 Ga0070713_100000178
723 Ga0070713_100002882
724 Ga0070713_100014973
725 Ga0070713_100017734
726 Ga0070713_100035427
727 Ga0070713_100040335
728 Ga0070713_100141726
729 Ga0070710_10019628
730 Ga0070710_10021173
731 Ga0070710_10335297
732 Ga0070711_100002684
733 Ga0070711_100047623
734 Ga0070711_100063209
735 Ga0070711_100184038
736 Ga0070705_100045687
737 Ga0070705_100056713
738 Ga0070705_100449926
739 Ga0070708_100001730
740 Ga0070708_100006238
741 Ga0070708_100046827
742 Ga0070708_100088748
743 Ga0070708_100156793
744 Ga0070708_100305126
745 Ga0070708_100369357
746 Ga0070708_100874834
747 Ga0070678_100103711
748 Ga0070681_10000160
749 Ga0070681_10006674
750 Ga0070681_10032373
751 Ga0070681_10051200
752 Ga0068867_100025620
753 Ga0068867_100049792
754 Ga0070685_10009968
755 Ga0070706_100000434
756 Ga0070706_100000747
757 Ga0070706_100001372
758 Ga0070706_100039142
759 Ga0070706_100089628
760 Ga0070706_100108786
761 Ga0070706_100197748
762 Ga0070707_100001963
763 Ga0070707_100145893
764 Ga0070707_100207559
765 Ga0070707_100443418
766 Ga0070698_100000558
767 Ga0070698_100000584
768 Ga0070698_100009189
769 Ga0070698_100016837
770 Ga0070698_100107731
771 Ga0070699_100000648
772 Ga0070699_100007853
773 Ga0070699_100386582
774 Ga0070679_100003769
775 Ga0070679_100018592
776 Ga0070684_100003906
777 Ga0070684_100025479
778 Ga0070684_100273249
779 Ga0070697_100000814
780 Ga0070697_100000951
781 Ga0070697_100001885
782 Ga0070697_100003676
783 Ga0070697_100105732
784 Ga0070697_100190389
785 Ga0068853_100054090
786 Ga0068853_100082707
787 Ga0068853_100092976
788 Ga0068853_100204066
789 Ga0068853_100325257
790 Ga0070672_100247316
791 Ga0070672_100290603
792 Ga0070686_100006943
793 Ga0070686_100132445
794 Ga0070695_100083501
795 Ga0070695_100412772
796 Ga0070696_100035796
797 Ga0070693_100144112
798 Ga0070665_100319966
799 Ga0070665_100814246
800 Ga0068855_100000151
801 Ga0068855_100002998
802 Ga0068855_100007501
803 Ga0068855_100158694
804 Ga0068855_100180524
805 Ga0068855_100357941
806 Ga0068855_100619694
807 Ga0070664_100001009
808 Ga0070664_100022499
809 Ga0068857_100004121
810 Ga0068857_100013259
811 Ga0068857_100041231
812 Ga0068854_100018457
813 Ga0068854_100024280
814 Ga0068856_100000119
815 Ga0068856_100000220
816 Ga0068856_100003015
817 Ga0068856_100016341
818 Ga0068856_100126556
819 Ga0070702_100021933
820 Ga0068852_100004234
821 Ga0068852_100367720
822 Ga0068864_100302837
823 Ga0068864_100822900
824 Ga0068866_10002344
825 Ga0068866_10024488
826 Ga0068866_10027378
827 Ga0068866_10087690
828 Ga0068861_100076355
829 Ga0068861_100238477
830 Ga0068851_10001808
831 Ga0068851_10012496
832 Ga0068851_10148137
833 Ga0068851_10158244
834 Ga0068870_10003367
835 Ga0068863_100007048
836 Ga0068863_100047123
837 Ga0068863_100100228
838 Ga0068863_100198091
839 Ga0068858_100000231
840 Ga0068858_100009662
841 Ga0068858_100026194
842 Ga0068860_100008540
843 Ga0068860_100018877
844 Ga0068860_100089234
845 Ga0068860_100142298
846 Ga0068860_100315622
847 Ga0068862_100018399
848 Ga0068862_100044682
849 Ga0068862_100376089
850 Ga0070717_10001091
851 Ga0070717_10027214
852 Ga0070717_10036944
853 Ga0070717_10058945
854 Ga0070717_10256775
855 Ga0070717_10258189
856 Ga0070717_10618156
857 Ga0070717_10807142
858 Ga0070715_10005647
859 Ga0070715_10007956
860 Ga0070715_10073805
861 Ga0070716_100003422
862 Ga0070716_100005229
863 Ga0070716_100010931
864 Ga0070716_100018364
865 Ga0070716_100034625
866 Ga0070716_100117962
867 Ga0070716_100146637
868 Ga0070716_100193569
869 Ga0070712_100000302
870 Ga0070712_100000516
871 Ga0070712_100003211
872 Ga0070712_100007006
873 Ga0070712_100009124
874 Ga0070712_100058734
875 Ga0070712_100078505
876 Ga0070712_100090820
877 Ga0070712_100143551
878 Ga0097621_100000073
879 Ga0097621_100000591
880 Ga0097621_100020148
881 Ga0097621_100056516
882 Ga0097621_100487469
883 Ga0068871_100000697
884 Ga0068871_100001411
885 Ga0068871_100032583
886 Ga0075433_10070900
887 Ga0075433_10108651
888 Ga0075434_100003427
889 Ga0075434_100036813
890 Ga0075434_100329258
891 Ga0068865_100036167
892 Ga0068865_100158816
893 Ga0075436_100198127
894 Ga0075435_100102803
895 Ga0075435_100134262
896 Ga0105250_10011749
897 Ga0105240_10025067
898 Ga0105240_10085017
899 Ga0105240_10103929
900 Ga0105240_10163838
901 Ga0105240_10373039
902 Ga0105240_10553302
903 Ga0111539_10001725
904 Ga0111539_10210790
905 Ga0105245_10025564
906 Ga0105245_10052216
907 Ga0105245_10083843
908 Ga0105245_10190851
909 Ga0105245_10879158
910 Ga0105243_10235196
911 Ga0105241_10012632
912 Ga0105241_10014788
913 Ga0105241_10039238
914 Ga0105241_10048357
915 Ga0105241_10089464
916 Ga0105242_10051629
917 Ga0105248_10092429
918 Ga0105248_10166301
919 Ga0105248_10281448
920 Ga0105237_10078356
921 Ga0105238_10000497
922 Ga0105238_10062825
923 Ga0105249_10008098
924 Ga0099796_10160737
925 Ga0105239_10004107
926 Ga0105239_10023933
927 Ga0105239_10065852
928 Ga0105239_10142754
929 Ga0105239_10331209
930 Ga0105239_10488933
931 Ga0105239_11403149
932 Ga0105246_10002297
933 Ga0157373_10114035
934 Ga0157373_10220480
935 Ga0157371_10018154
936 Ga0157371_10022982
937 Ga0157371_10306907
938 Ga0157369_10000108
939 Ga0157369_10042083
940 Ga0157369_10046247
941 Ga0157369_10255062
942 Ga0157369_10609182
943 Ga0157369_10867758
944 Ga0157374_10001195
945 Ga0157374_10001477
946 Ga0157374_10002238
947 Ga0157374_10008126
948 Ga0157374_10016227
949 Ga0157374_10019923
950 Ga0157374_10450777
951 Ga0157378_10000030
952 Ga0157378_10000099
953 Ga0157378_10008641
954 Ga0157378_10035410
955 Ga0157378_10044565
956 Ga0157378_10072246
957 Ga0157378_10197277
958 Ga0163162_10015270
959 Ga0163162_10042764
960 Ga0163162_10160719
961 Ga0163162_10599879
962 Ga0157372_10000576
963 Ga0157372_10009048
964 Ga0157372_10009135
965 Ga0157372_10028758
966 Ga0157372_10123660
967 Ga0157372_10134785
968 Ga0157372_10166588
969 Ga0157372_10181702
970 Ga0157375_10593977
971 Ga0163163_10027104
972 Ga0163163_10043414
973 Ga0163163_10348719
974 Ga0163163_10536694
975 Ga0157380_10019134
976 Ga0182008_10002806
977 Ga0157377_10002339
978 Ga0157379_10008128
979 Ga0157379_10038083
980 Ga0157379_10189082
981 Ga0157379_10234981
982 Ga0157376_10007486
983 Ga0157376_10038390
984 Ga0157376_10078486
985 Ga0157376_10101993
986 Ga0157376_10149985
987 Ga0157376_10216058
988 Ga0182006_1093894
989 Ga0182007_10004978
990 Ga0182007_10023467
991 Ga0182005_1025472
992 Ga0163161_10003125
993 Ga0224569_102686
994 Ga0224571_102495
995 Ga0224572_1001779
996 Ga0224572_1003555
997 Ga0228598_1000043
998 Ga0228598_1000726
999 Ga0207697_10019520
1000 Ga0207692_10009477
1001 Ga0207642_10008283
1002 Ga0207642_10014854
1003 Ga0207710_10115117
1004 Ga0207688_10057239
1005 Ga0207647_10008012
1006 Ga0207647_10008692
1007 Ga0207647_10015621
1008 Ga0207647_10087607
1009 Ga0207685_10002145
1010 Ga0207685_10015555
1011 Ga0207685_10051654
1012 Ga0207699_10000578
1013 Ga0207699_10034971
1014 Ga0207699_10036809
1015 Ga0207699_10048345
1016 Ga0207699_10077329
1017 Ga0207699_10081677
1018 Ga0207699_10190222
1019 Ga0207699_10201584
1020 Ga0207699_10478647
1021 Ga0207645_10003048
1022 Ga0207645_10107051
1023 Ga0207643_10000363
1024 Ga0207684_10000203
1025 Ga0207684_10000560
1026 Ga0207684_10000966
1027 Ga0207684_10003721
1028 Ga0207684_10165735
1029 Ga0207684_10271203
1030 Ga0207684_10393837
1031 Ga0207654_10035546
1032 Ga0207654_10128355
1033 Ga0207654_10144389
1034 Ga0207654_10159255
1035 Ga0207707_10003004
1036 Ga0207707_10005292
1037 Ga0207707_10076214
1038 Ga0207707_10117563
1039 Ga0207707_10378861
1040 Ga0207707_10635026
1041 Ga0207695_10054089
1042 Ga0207695_10120523
1043 Ga0207695_10572675
1044 Ga0207671_10033453
1045 Ga0207671_10341144
1046 Ga0207693_10000071
1047 Ga0207693_10000373
1048 Ga0207693_10004195
1049 Ga0207693_10005083
1050 Ga0207693_10015729
1051 Ga0207693_10016451
1052 Ga0207693_10068637
1053 Ga0207663_10015835
1054 Ga0207663_10046547
1055 Ga0207663_10089819
1056 Ga0207663_10156469
1057 Ga0207663_10208696
1058 Ga0207663_10429722
1059 Ga0207660_10154978
1060 Ga0207660_10265251
1061 Ga0207662_10000664
1062 Ga0207657_10001432
1063 Ga0207657_10006629
1064 Ga0207657_10011646
1065 Ga0207649_10003934
1066 Ga0207649_10020337
1067 Ga0207652_10005098
1068 Ga0207652_10085577
1069 Ga0207652_10351587
1070 Ga0207646_10000657
1071 Ga0207646_10001084
1072 Ga0207646_10020896
1073 Ga0207646_10076903
1074 Ga0207646_10475507
1075 Ga0207681_10075603
1076 Ga0207681_10092393
1077 Ga0207694_10000864
1078 Ga0207694_10045564
1079 Ga0207694_10058027
1080 Ga0207694_10654826
1081 Ga0207650_10000051
1082 Ga0207650_10087631
1083 Ga0207650_10613986
1084 Ga0207659_10047131
1085 Ga0207687_10007789
1086 Ga0207687_10058509
1087 Ga0207687_10060643
1088 Ga0207687_10125026
1089 Ga0207700_10000089
1090 Ga0207700_10000151
1091 Ga0207700_10037360
1092 Ga0207700_10052468
1093 Ga0207700_10061467
1094 Ga0207700_10067798
1095 Ga0207700_10275864
1096 Ga0207700_10302096
1097 Ga0207700_10383563
1098 Ga0207700_10579687
1099 Ga0207664_10000029
1100 Ga0207664_10002505
1101 Ga0207664_10076232
1102 Ga0207664_10112581
1103 Ga0207664_10425012
1104 Ga0207644_10186883
1105 Ga0207690_10281024
1106 Ga0207690_10377270
1107 Ga0207706_10000783
1108 Ga0207706_10013806
1109 Ga0207686_10016623
1110 Ga0207686_10205919
1111 Ga0207709_10136057
1112 Ga0207669_10134358
1113 Ga0207704_10047195
1114 Ga0207704_10138636
1115 Ga0207665_10001361
1116 Ga0207665_10005766
1117 Ga0207665_10033385
1118 Ga0207665_10044943
1119 Ga0207665_10050559
1120 Ga0207665_10116174
1121 Ga0207665_10175931
1122 Ga0207665_10333832
1123 Ga0207691_10005718
1124 Ga0207691_10153040
1125 Ga0207691_10347327
1126 Ga0207711_10002266
1127 Ga0207711_10024402
1128 Ga0207711_10088575
1129 Ga0207689_10000860
1130 Ga0207689_10001015
1131 Ga0207661_10000969
1132 Ga0207661_10098593
1133 Ga0207661_10111202
1134 Ga0207661_10257823
1135 Ga0207679_10000203
1136 Ga0207679_10008130
1137 Ga0207679_10026112
1138 Ga0207679_10054777
1139 Ga0207667_10001767
1140 Ga0207667_10015239
1141 Ga0207667_10023096
1142 Ga0207667_10060734
1143 Ga0207651_10011127
1144 Ga0207712_10027192
1145 Ga0207668_10404067
1146 Ga0207640_10014450
1147 Ga0207640_10041985
1148 Ga0207640_10221073
1149 Ga0207640_10520323
1150 Ga0207658_10002771
1151 Ga0207658_10074272
1152 Ga0207677_10034909
1153 Ga0207677_10050795
1154 Ga0207677_10409368
1155 Ga0207703_10002784
1156 Ga0207703_10047615
1157 Ga0207703_10440686
1158 Ga0207639_10025861
1159 Ga0207639_10075734
1160 Ga0207639_10079614
1161 Ga0207639_10285962
1162 Ga0207639_10698024
1163 Ga0207678_10001066
1164 Ga0207678_10078153
1165 Ga0207708_10098080
1166 Ga0207702_10000086
1167 Ga0207702_10000764
1168 Ga0207702_10915377
1169 Ga0207641_10000025
1170 Ga0207641_10008135
1171 Ga0207641_10185082
1172 Ga0207641_10410976
1173 Ga0207641_10458734
1174 Ga0207641_10521001
1175 Ga0207641_10844326
1176 Ga0207648_10000966
1177 Ga0207648_10018922
1178 Ga0207648_10049644
1179 Ga0207676_10002968
1180 Ga0207676_10396687
1181 Ga0207676_10624765
1182 Ga0207674_10000281
1183 Ga0207674_10001451
1184 Ga0207674_10050860
1185 Ga0207675_100052462
1186 Ga0207675_100282776
1187 Ga0207683_10000742
1188 Ga0207698_10191412
1189 Ga0207428_10159339
1190 Ga0265356_1000061
1191 Ga0265356_1005330
1192 Ga0268266_10012116
1193 Ga0268266_10041699
1194 Ga0268266_10765129
1195 Ga0268265_10048950
1196 Ga0268264_10025027
1197 Ga0268264_10065356
1198 Ga0268264_10073669
1199 Ga0268264_10120172
1200 Ga0268264_10797795
1201 Ga0265338_10001594
1202 Ga0265338_10002879
1203 Ga0265338_10086960
1204 Ga0265338_10105178
1205 Ga0265762_1000174
1206 Ga0265762_1000799
1207 Ga0265762_1001512
1208 Ga0265762_1029986
1209 Ga0265770_1005637
1210 Ga0265770_1012516
1211 Ga0265765_1000227
1212 Ga0265760_10000916
1213 Ga0265760_10001157
1214 Ga0265760_10003613
1215 Ga0265760_10007604
1216 Ga0265760_10014723
1217 Ga0265760_10019982
1218 Ga0265330_10004610
1219 Ga0265325_10006588
1220 Ga0265325_10087888
1221 Ga0265339_10002485
1222 Ga0265316_10016481
1223 Ga0265316_10048368
1224 Ga0265314_10006083
1225 Ga0265314_10018014
1226 Ga0265314_10062976
1227 Ga0265342_10017755
1228 Ga0373926_0011088
1229 Ga0373926_0123373
1230 Ga0373934_0056436
1231 Ga0373923_0003916
1232 Ga0373932_0011372
1233 Ga0373939_0074223
1234 Ga0373945_0001340
1235 Ga0373954_0020415
1236 Ga0373960_0019967
1237 Ga0373943_0000083
1238 Ga0373946_0137812
1239 Ga0373924_0035713
1240 Ga0373924_0042504
1241 Ga0373931_0057807
1242 Ga0373931_0084697
1243 Ga0373931_0362750
1244 Ga0373931_0398299
1245 Ga0373935_0012955
1246 Ga0373935_0018540
1247 Ga0373935_0247514
1248 Ga0373927_0000193
1249 Ga0373927_0023786
1250 Ga0373927_0339267
1251 Ga0373947_0002347
1252 Ga0373947_0065445
1253 Ga0373937_0036782
1254 Ga0373937_0113989
1255 Ga0373937_0186297
1256 Ga0373925_0002463
1257 Ga0373925_0170188
1258 Ga0373925_0236812
1259 Ga0373925_0286992
1260 Ga0436360_0795382
1261 Ga0451807_2696225
1262 Ga0466966_0187557
1263 Ga0466964_0081776
1264 Ga0466959_0173018
1265 Ga0466959_0362717
1266 Ga0466967_0085163
1267 Ga0466967_0513580
1268 Ga0495629_0005723
1269 Ga0495651_0162932
1270 Ga0495580_0000108
1271 Ga0495580_0001723
1272 Ga0495580_0002290
1273 Ga0495580_0025729
1274 Ga0495580_0028672
1275 Ga0495580_0038669
1276 Ga0495580_0047096
1277 Ga0495580_0055297
1278 Ga0495580_0284646
1279 Ga0495582_0002288
1280 Ga0495582_0031658
1281 Ga0495664_0015596
1282 Ga0495618_0166044
1283 Ga0495652_0358841
1284 Ga0495586_0221672
1285 Ga0495667_0148637
1286 Ga0495667_0273564
1287 Ga0495659_0083055
1288 Ga0495646_0186170
1289 Ga0495658_0069764
1290 Ga0495669_0032145
1291 Ga0495674_0006546
1292 Ga0495674_0024813
1293 Ga0495674_0193313
1294 Ga0495674_0625385
1295 Ga0495676_0301638
1296 Ga0496100_0040425
1297 Ga0496100_0404625
1298 Ga0496101_0065623
1299 Ga0496101_0084194
1300 Ga0496102_0149775
1301 Ga0496102_0235323
1302 Ga0496103_0104171
1303 Ga0496103_0248430
1304 Ga0496104_0042124
1305 Ga0496104_0058617
1306 Ga0496104_0215187
1307 Ga0496104_0790759
1308 Ga0496105_0054121
1309 Ga0496105_0217933
1310 Ga0496106_0040558
1311 Ga0496106_0241258
1312 Ga0496108_0000169
1313 Ga0496108_0108448
1314 Ga0496109_0000072
1315 Ga0496109_0155443
1316 Ga0496109_0210200
1317 Ga0496110_0013408
1318 Ga0496111_0130620
1319 Ga0496112_0000064
1320 Ga0496112_0003953
1321 Ga0496112_0011741
1322 Ga0496112_0047008
1323 Ga0496112_0090510
1324 Ga0496112_0102589
1325 Ga0496112_0228185
1326 Ga0496112_0693803
1327 Ga0496112_0763627
1328 Ga0496113_0001888
1329 Ga0496114_0013431
1330 Ga0496114_0126017
1331 Ga0496115_0026977
1332 Ga0496115_0028234
1333 Ga0496115_0047333
1334 Ga0501047_0099493
1335 Ga0501083_0024907
1336 nmdc:mga08y16_13459_c1
1337 nmdc:mga0n895_418882_c1
1338 nmdc:mga0rr50_453849_c1
1339 nmdc:mga0rr50_89888_c1
1340 nmdc:mga0a205_116448_c1
1341 nmdc:mga0a205_335181_c1
1342 Ga0495601_0222157
1343 Ga0501084_0002658
1344 Ga0501082_0020439

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

46

268

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vcn-assembly1.cif.gz_A crystal structure of t.th. hb8 ctp synthetase complex with sulfate anion 0.9251 3 240
4zdi-assembly3.cif.gz_C crystal structure of the m. tuberculosis ctp synthase pyrg (apo form) 0.9064 3 240
3nva-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8944 3 241
4zdi-assembly3.cif.gz_D crystal structure of the m. tuberculosis ctp synthase pyrg (apo form) 0.8941 3 240
4zdi-assembly5.cif.gz_F crystal structure of the m. tuberculosis ctp synthase pyrg (apo form) 0.8941 3 240
ID Description Score Start End Superfamily
3nvaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8997 3 241 3.40.50.880
af_Q54V77_308_569_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8989 2 240 3.40.50.880
4zdiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8967 3 240 3.40.50.880
2ad5B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8921 3 240 3.40.50.880
3nvaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8889 3 241 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V7D6F5-F1-model_v4 CTP synthase (glutamine hydrolyzing) 0.9759 1 92
AF-A0A2V8YEI5-F1-model_v4 Glutamine amidotransferase domain-containing protein 0.9742 2 92
AF-A0A7C2WGX6-F1-model_v4 CTP synthase (glutamine hydrolyzing) 0.9738 1 92
AF-A0A848ZLC6-F1-model_v4 CTP synthase (glutamine hydrolyzing) 0.9738 2 92
AF-W4M1P6-F1-model_v4 Uncharacterized protein 0.9725 1 92

Map