F473567

General Info

Members Datasets Scaffolds Average Seq Length
663 232 1326 277

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0248896|Ga0373935_0248896_84_1016
Length 310
Sequence VAVRAIDFHVHLPTPDWLDGSMAGYVEAAEAYFRAPVQRASLAELADRYRGLNVRAVLLAWDAETATGRPRVPNETVAAACRDFPDVFTGLGSVDPHKGDVAVAEVANIAALGLRGVKFHPSLQAFAPDDPAYRPVFAACQEHGLLALFHTGTSGIGAGQPGGQGIGLDYARPIRLDAVAAAHPGLTVVAAHFGWPWHMELVAMALHKTNVYIDISGWSPKRIPAELVRELRGRLSGQFLWGSDFPFITPERCLTELESLDLPEPALSRVLRENAARILRLDGADPGGRPPWNPPMTSGPVPPSPGLGRG

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.87
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 3.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0248896 3300035692 Bacteria 1243
2 JGI25407J50210_10004829 3300003373 Bacteria 3295
3 JGI25407J50210_10012278 3300003373 Bacteria 2195
4 Ga0070658_10115026 3300005327 Bacteria 2231
5 Ga0070683_100148020 3300005329 Bacteria 2226
6 Ga0070690_100149004 3300005330 Bacteria 1595
7 Ga0068869_100382039 3300005334 Bacteria 1154
8 Ga0070666_10105895 3300005335 Bacteria 1942
9 Ga0070682_100099519 3300005337 Bacteria 1917
10 Ga0070682_100326176 3300005337 Bacteria 1136
11 Ga0068868_100249768 3300005338 Bacteria 1493
12 Ga0070660_100109481 3300005339 Bacteria 2196
13 Ga0070691_10013756 3300005341 Bacteria 3712
14 Ga0070687_100057324 3300005343 Bacteria 2042
15 Ga0070661_100025073 3300005344 Bacteria 4283
16 Ga0070692_10092218 3300005345 Bacteria 1648
17 Ga0070671_100225826 3300005355 Bacteria 1589
18 Ga0070673_100184054 3300005364 Bacteria 1790
19 Ga0070659_100116332 3300005366 Bacteria 2161
20 Ga0070667_100285325 3300005367 Bacteria 1483
21 Ga0070709_10001274 3300005434 Bacteria 13768
22 Ga0070709_10001449 3300005434 Bacteria 12804
23 Ga0070709_10023539 3300005434 Bacteria 3618
24 Ga0070714_100000143 3300005435 Bacteria 57312
25 Ga0070714_100001490 3300005435 Bacteria 17034
26 Ga0070714_100002815 3300005435 Bacteria 12837
27 Ga0070714_100010943 3300005435 Bacteria 7186
28 Ga0070714_100129111 3300005435 Bacteria 2257
29 Ga0070714_100162968 3300005435 Bacteria 2019
30 Ga0070714_100169698 3300005435 Bacteria 1979
31 Ga0070714_100225511 3300005435 Bacteria 1724
32 Ga0070714_100236555 3300005435 Bacteria 1684
33 Ga0070713_100007522 3300005436 Bacteria 7654
34 Ga0070713_100016247 3300005436 Bacteria 5594
35 Ga0070713_100054442 3300005436 Bacteria 3319
36 Ga0070713_100096406 3300005436 Bacteria 2553
37 Ga0070713_100569748 3300005436 Bacteria 1074
38 Ga0070710_10000036 3300005437 Bacteria 61426
39 Ga0070710_10004042 3300005437 Bacteria 6962
40 Ga0070710_10026807 3300005437 Bacteria 3066
41 Ga0070710_10241937 3300005437 Unclassified 1156
42 Ga0070711_100001614 3300005439 Bacteria 12444
43 Ga0070711_100010311 3300005439 Bacteria 5779
44 Ga0070711_100043529 3300005439 Bacteria 3041
45 Ga0070711_100046889 3300005439 Bacteria 2947
46 Ga0070711_100172704 3300005439 Bacteria 1649
47 Ga0070711_100183165 3300005439 Bacteria 1604
48 Ga0070705_100051015 3300005440 Bacteria 2410
49 Ga0070705_100065783 3300005440 Bacteria 2171
50 Ga0070700_100117572 3300005441 Bacteria 1776
51 Ga0070708_100001904 3300005445 Bacteria 16050
52 Ga0070708_100002732 3300005445 Bacteria 13697
53 Ga0070708_100004260 3300005445 Bacteria 11241
54 Ga0070708_100012877 3300005445 Bacteria 6835
55 Ga0070708_100103114 3300005445 Bacteria 2615
56 Ga0070708_100284781 3300005445 Bacteria 1556
57 Ga0070663_100064924 3300005455 Bacteria 2640
58 Ga0070662_100279349 3300005457 Bacteria 1351
59 Ga0070681_10034293 3300005458 Bacteria 5096
60 Ga0070681_10221649 3300005458 Bacteria 1806
61 Ga0070706_100000279 3300005467 Bacteria 62322
62 Ga0070706_100000502 3300005467 Bacteria 45881
63 Ga0070706_100003771 3300005467 Bacteria 14792
64 Ga0070706_100008106 3300005467 Bacteria 9794
65 Ga0070706_100012264 3300005467 Bacteria 7942
66 Ga0070706_100014354 3300005467 Bacteria 7320
67 Ga0070706_100031977 3300005467 Bacteria 4852
68 Ga0070706_100040206 3300005467 Bacteria 4317
69 Ga0070706_100114309 3300005467 Bacteria 2513
70 Ga0070706_100283411 3300005467 Unclassified 1546
71 Ga0070706_100297030 3300005467 Bacteria 1507
72 Ga0070706_100477754 3300005467 Bacteria 1159
73 Ga0070706_100526722 3300005467 Bacteria 1099
74 Ga0070707_100000340 3300005468 Bacteria 45896
75 Ga0070707_100001105 3300005468 Bacteria 26635
76 Ga0070707_100008544 3300005468 Bacteria 9516
77 Ga0070707_100012266 3300005468 Bacteria 8005
78 Ga0070707_100012547 3300005468 Bacteria 7914
79 Ga0070707_100015356 3300005468 Bacteria 7185
80 Ga0070707_100017140 3300005468 Bacteria 6805
81 Ga0070707_100020448 3300005468 Bacteria 6244
82 Ga0070707_100030107 3300005468 Bacteria 5164
83 Ga0070707_100049120 3300005468 Bacteria 4043
84 Ga0070707_100054759 3300005468 Bacteria 3825
85 Ga0070707_100074513 3300005468 Bacteria 3273
86 Ga0070707_100086133 3300005468 Bacteria 3038
87 Ga0070707_100087006 3300005468 Bacteria 3022
88 Ga0070707_100110462 3300005468 Bacteria 2666
89 Ga0070707_100192169 3300005468 Unclassified 1990
90 Ga0070707_100438614 3300005468 Bacteria 1266
91 Ga0070698_100000534 3300005471 Bacteria 40564
92 Ga0070698_100010857 3300005471 Bacteria 9691
93 Ga0070698_100011092 3300005471 Bacteria 9576
94 Ga0070698_100014380 3300005471 Bacteria 8362
95 Ga0070698_100014913 3300005471 Bacteria 8216
96 Ga0070698_100015773 3300005471 Bacteria 7981
97 Ga0070698_100042717 3300005471 Bacteria 4651
98 Ga0070698_100063868 3300005471 Bacteria 3712
99 Ga0070698_100108000 3300005471 Unclassified 2750
100 Ga0070698_100119727 3300005471 Unclassified 2593
101 Ga0070698_100215638 3300005471 Bacteria 1853
102 Ga0070698_100221100 3300005471 Unclassified 1827
103 Ga0070698_100314234 3300005471 Bacteria 1497
104 Ga0070698_100432010 3300005471 Bacteria 1252
105 Ga0070698_100441310 3300005471 Bacteria 1237
106 Ga0070699_100000329 3300005518 Bacteria 45881
107 Ga0070699_100000431 3300005518 Bacteria 40272
108 Ga0070699_100001089 3300005518 Bacteria 25316
109 Ga0070699_100122780 3300005518 Unclassified 2285
110 Ga0070699_100220160 3300005518 Unclassified 1691
111 Ga0070699_100411335 3300005518 Bacteria 1224
112 Ga0070679_100004220 3300005530 Bacteria 13260
113 Ga0070679_100194797 3300005530 Bacteria 1994
114 Ga0070684_100020441 3300005535 Bacteria 5492
115 Ga0070697_100000026 3300005536 Bacteria 126954
116 Ga0070697_100000929 3300005536 Bacteria 22008
117 Ga0070697_100016128 3300005536 Bacteria 5875
118 Ga0070697_100029276 3300005536 Bacteria 4413
119 Ga0070697_100045485 3300005536 Bacteria 3557
120 Ga0070697_100164125 3300005536 Unclassified 1878
121 Ga0070697_100176568 3300005536 Unclassified 1810
122 Ga0070697_100195075 3300005536 Unclassified 1719
123 Ga0070697_100458224 3300005536 Bacteria 1111
124 Ga0070672_100469589 3300005543 Bacteria 1085
125 Ga0070695_100003515 3300005545 Bacteria 9151
126 Ga0070695_100034344 3300005545 Bacteria 3179
127 Ga0070695_100135109 3300005545 Bacteria 1704
128 Ga0070695_100263482 3300005545 Bacteria 1260
129 Ga0070696_100048211 3300005546 Bacteria 2957
130 Ga0070696_100148392 3300005546 Unclassified 1719
131 Ga0070693_100132031 3300005547 Bacteria 1562
132 Ga0070665_100514608 3300005548 Bacteria 1208
133 Ga0070704_100005853 3300005549 Bacteria 7202
134 Ga0068855_100201406 3300005563 Bacteria 2241
135 Ga0070664_100115255 3300005564 Bacteria 2348
136 Ga0068857_100324497 3300005577 Bacteria 1422
137 Ga0068856_100329025 3300005614 Bacteria 1545
138 Ga0070702_100071857 3300005615 Bacteria 2046
139 Ga0068859_100126926 3300005617 Bacteria 2620
140 Ga0068864_100143172 3300005618 Bacteria 2158
141 Ga0068864_100229919 3300005618 Bacteria 1715
142 Ga0068861_100456117 3300005719 Bacteria 1147
143 Ga0068870_10095819 3300005840 Bacteria 1668
144 Ga0068863_100116636 3300005841 Bacteria 2544
145 Ga0068863_100268564 3300005841 Bacteria 1651
146 Ga0068863_100289550 3300005841 Bacteria 1588
147 Ga0068860_100269460 3300005843 Bacteria 1661
148 Ga0081538_10004627 3300005981 Bacteria 12629
149 Ga0081538_10007541 3300005981 Bacteria 9399
150 Ga0081538_10011641 3300005981 Bacteria 7112
151 Ga0081538_10030568 3300005981 Bacteria 3653
152 Ga0081540_1000070 3300005983 Bacteria 111392
153 Ga0081540_1000680 3300005983 Bacteria 31845
154 Ga0081539_10009328 3300005985 Bacteria 8234
155 Ga0070717_10001367 3300006028 Bacteria 16807
156 Ga0070717_10009035 3300006028 Bacteria 7480
157 Ga0070717_10040491 3300006028 Bacteria 3795
158 Ga0070717_10062041 3300006028 Bacteria 3099
159 Ga0070717_10099162 3300006028 Bacteria 2471
160 Ga0070717_10113713 3300006028 Bacteria 2311
161 Ga0070717_10133954 3300006028 Bacteria 2132
162 Ga0070717_10203435 3300006028 Bacteria 1735
163 Ga0075432_10080426 3300006058 Bacteria 1181
164 Ga0070715_10001982 3300006163 Bacteria 6171
165 Ga0070715_10007382 3300006163 Bacteria 3783
166 Ga0070715_10024155 3300006163 Bacteria 2390
167 Ga0070715_10025092 3300006163 Bacteria 2357
168 Ga0070715_10066943 3300006163 Bacteria 1594
169 Ga0070716_100000168 3300006173 Bacteria 25952
170 Ga0070716_100002131 3300006173 Bacteria 9091
171 Ga0070716_100015263 3300006173 Bacteria 3943
172 Ga0070716_100194506 3300006173 Bacteria 1343
173 Ga0070716_100232902 3300006173 Bacteria 1244
174 Ga0070712_100017132 3300006175 Bacteria 4686
175 Ga0070712_100019233 3300006175 Bacteria 4451
176 Ga0070712_100047071 3300006175 Bacteria 2983
177 Ga0097621_100207742 3300006237 Bacteria 1702
178 Ga0068871_100044997 3300006358 Bacteria 3551
179 Ga0075433_10007041 3300006852 Bacteria 8907
180 Ga0075433_10026971 3300006852 Bacteria 4869
181 Ga0075433_10067252 3300006852 Bacteria 3145
182 Ga0075433_10106303 3300006852 Bacteria 2487
183 Ga0075433_10213046 3300006852 Unclassified 1716
184 Ga0075434_100036206 3300006871 Bacteria 4882
185 Ga0075434_100100976 3300006871 Bacteria 2891
186 Ga0075434_100132593 3300006871 Bacteria 2511
187 Ga0075434_100315369 3300006871 Bacteria 1584
188 Ga0075434_100588874 3300006871 Bacteria 1131
189 Ga0068865_100331903 3300006881 Bacteria 1226
190 Ga0075436_100011093 3300006914 Bacteria 6180
191 Ga0075436_100046683 3300006914 Bacteria 2987
192 Ga0075436_100062847 3300006914 Bacteria 2566
193 Ga0075436_100077904 3300006914 Bacteria 2296
194 Ga0075436_100214017 3300006914 Bacteria 1367
195 Ga0075436_100342949 3300006914 Bacteria 1076
196 Ga0097620_100126930 3300006931 Bacteria 2620
197 Ga0075435_100006737 3300007076 Bacteria 8148
198 Ga0075435_100069429 3300007076 Bacteria 2873
199 Ga0099794_10012216 3300007265 Bacteria 3697
200 Ga0099794_10122337 3300007265 Bacteria 1310
201 Ga0105245_10012765 3300009098 Bacteria 7317
202 Ga0105247_10135110 3300009101 Bacteria 1611
203 Ga0105247_10135194 3300009101 Bacteria 1610
204 Ga0114129_10013562 3300009147 Bacteria 11612
205 Ga0114129_10062995 3300009147 Bacteria 5180
206 Ga0105242_10236799 3300009176 Bacteria 1639
207 Ga0105239_10167392 3300010375 Bacteria 2458
208 Ga0105239_10567461 3300010375 Bacteria 1293
209 Ga0157373_10080573 3300013100 Bacteria 2296
210 Ga0157371_10022047 3300013102 Bacteria 4672
211 Ga0157370_10301642 3300013104 Bacteria 1479
212 Ga0157370_10316285 3300013104 Bacteria 1440
213 Ga0157369_10048055 3300013105 Bacteria 4631
214 Ga0157374_10181041 3300013296 Unclassified 2059
215 Ga0157378_10325233 3300013297 Bacteria 1495
216 Ga0163162_10016697 3300013306 Bacteria 7177
217 Ga0157372_10176314 3300013307 Bacteria 2474
218 Ga0157375_10152772 3300013308 Bacteria 2445
219 Ga0157375_10827628 3300013308 Bacteria 1073
220 Ga0163163_10003082 3300014325 Bacteria 14117
221 Ga0163163_10307297 3300014325 Bacteria 1638
222 Ga0157380_10137709 3300014326 Bacteria 2092
223 Ga0157377_10036716 3300014745 Bacteria 2697
224 Ga0157379_10041374 3300014968 Bacteria 4114
225 Ga0157376_10095356 3300014969 Bacteria 2587
226 Ga0163161_10173006 3300017792 Bacteria 1652
227 Ga0206356_11116159 3300020070 Bacteria 1781
228 Ga0206353_10175466 3300020082 Bacteria 1021
229 Ga0206353_11014567 3300020082 Bacteria 2320
230 Ga0213875_10024827 3300021388 Bacteria 2857
231 Ga0213875_10114743 3300021388 Bacteria 1259
232 Ga0207653_10002482 3300025885 Bacteria 5857
233 Ga0207692_10001185 3300025898 Bacteria 9666
234 Ga0207692_10132444 3300025898 Bacteria 1409
235 Ga0207692_10133582 3300025898 Bacteria 1404
236 Ga0207692_10175693 3300025898 Bacteria 1244
237 Ga0207710_10040187 3300025900 Bacteria 2072
238 Ga0207710_10118632 3300025900 Bacteria 1262
239 Ga0207688_10046378 3300025901 Bacteria 2426
240 Ga0207647_10140735 3300025904 Bacteria 1414
241 Ga0207685_10000523 3300025905 Bacteria 6593
242 Ga0207685_10011371 3300025905 Bacteria 2673
243 Ga0207685_10018863 3300025905 Bacteria 2261
244 Ga0207685_10045513 3300025905 Bacteria 1664
245 Ga0207699_10000881 3300025906 Bacteria 14338
246 Ga0207699_10006793 3300025906 Bacteria 5564
247 Ga0207699_10015662 3300025906 Bacteria 3944
248 Ga0207699_10083188 3300025906 Bacteria 1990
249 Ga0207645_10249672 3300025907 Bacteria 1174
250 Ga0207684_10000005 3300025910 Bacteria 736617
251 Ga0207684_10000021 3300025910 Bacteria 340887
252 Ga0207684_10000521 3300025910 Bacteria 47624
253 Ga0207684_10004719 3300025910 Bacteria 12781
254 Ga0207684_10008648 3300025910 Bacteria 9041
255 Ga0207684_10011857 3300025910 Bacteria 7596
256 Ga0207684_10015090 3300025910 Bacteria 6651
257 Ga0207684_10035162 3300025910 Bacteria 4255
258 Ga0207684_10213846 3300025910 Unclassified 1663
259 Ga0207684_10267777 3300025910 Bacteria 1474
260 Ga0207684_10316781 3300025910 Unclassified 1345
261 Ga0207684_10340416 3300025910 Bacteria 1292
262 Ga0207707_10064762 3300025912 Bacteria 3182
263 Ga0207707_10229952 3300025912 Bacteria 1613
264 Ga0207695_10127436 3300025913 Bacteria 2506
265 Ga0207693_10004497 3300025915 Bacteria 11796
266 Ga0207693_10029117 3300025915 Bacteria 4365
267 Ga0207693_10067118 3300025915 Bacteria 2808
268 Ga0207693_10201374 3300025915 Unclassified 1566
269 Ga0207663_10001904 3300025916 Bacteria 9872
270 Ga0207663_10012230 3300025916 Bacteria 4633
271 Ga0207663_10143315 3300025916 Bacteria 1667
272 Ga0207663_10185309 3300025916 Bacteria 1490
273 Ga0207662_10023045 3300025918 Bacteria 3574
274 Ga0207657_10005492 3300025919 Bacteria 13239
275 Ga0207649_10033352 3300025920 Bacteria 3076
276 Ga0207652_10002601 3300025921 Bacteria 15145
277 Ga0207646_10000573 3300025922 Bacteria 48191
278 Ga0207646_10000775 3300025922 Bacteria 41389
279 Ga0207646_10001077 3300025922 Bacteria 34782
280 Ga0207646_10001361 3300025922 Bacteria 30276
281 Ga0207646_10002160 3300025922 Bacteria 23490
282 Ga0207646_10003315 3300025922 Bacteria 18311
283 Ga0207646_10005491 3300025922 Bacteria 13325
284 Ga0207646_10008920 3300025922 Bacteria 9987
285 Ga0207646_10010332 3300025922 Bacteria 9133
286 Ga0207646_10025734 3300025922 Bacteria 5381
287 Ga0207646_10029022 3300025922 Bacteria 5030
288 Ga0207646_10048011 3300025922 Bacteria 3827
289 Ga0207646_10083948 3300025922 Bacteria 2849
290 Ga0207646_10085078 3300025922 Unclassified 2829
291 Ga0207646_10095647 3300025922 Bacteria 2661
292 Ga0207646_10222997 3300025922 Bacteria 1703
293 Ga0207646_10250452 3300025922 Bacteria 1600
294 Ga0207646_10340745 3300025922 Bacteria 1355
295 Ga0207646_10465231 3300025922 Bacteria 1140
296 Ga0207694_10146029 3300025924 Bacteria 1904
297 Ga0207687_10306416 3300025927 Bacteria 1281
298 Ga0207700_10000054 3300025928 Bacteria 72974
299 Ga0207700_10012086 3300025928 Bacteria 5547
300 Ga0207700_10020732 3300025928 Bacteria 4472
301 Ga0207700_10031015 3300025928 Bacteria 3792
302 Ga0207700_10088483 3300025928 Bacteria 2438
303 Ga0207700_10117812 3300025928 Bacteria 2148
304 Ga0207700_10145983 3300025928 Bacteria 1950
305 Ga0207700_10149247 3300025928 Bacteria 1930
306 Ga0207700_10426323 3300025928 Bacteria 1166
307 Ga0207664_10000137 3300025929 Bacteria 62759
308 Ga0207664_10000221 3300025929 Bacteria 42973
309 Ga0207664_10003813 3300025929 Bacteria 10118
310 Ga0207664_10003844 3300025929 Bacteria 10087
311 Ga0207664_10038778 3300025929 Bacteria 3695
312 Ga0207664_10060234 3300025929 Bacteria 3025
313 Ga0207664_10118338 3300025929 Bacteria 2213
314 Ga0207664_10149734 3300025929 Bacteria 1981
315 Ga0207664_10289430 3300025929 Bacteria 1439
316 Ga0207644_10195726 3300025931 Bacteria 1592
317 Ga0207706_10174703 3300025933 Bacteria 1887
318 Ga0207665_10000519 3300025939 Bacteria 26075
319 Ga0207665_10002106 3300025939 Bacteria 13453
320 Ga0207665_10005359 3300025939 Bacteria 8564
321 Ga0207665_10016367 3300025939 Bacteria 4868
322 Ga0207665_10227525 3300025939 Bacteria 1369
323 Ga0207665_10293049 3300025939 Bacteria 1214
324 Ga0207689_10002639 3300025942 Bacteria 16600
325 Ga0207651_10291648 3300025960 Bacteria 1353
326 Ga0207678_10023752 3300026067 Bacteria 5361
327 Ga0207708_10036096 3300026075 Bacteria 3762
328 Ga0207702_10106697 3300026078 Bacteria 2482
329 Ga0207641_10124413 3300026088 Bacteria 2306
330 Ga0207674_10007988 3300026116 Bacteria 12280
331 Ga0207675_100010943 3300026118 Bacteria 8499
332 Ga0207683_10018791 3300026121 Bacteria 5897
333 Ga0207683_10120147 3300026121 Bacteria 2358
334 Ga0209588_1000117 3300027671 Bacteria 23398
335 Ga0268266_10551793 3300028379 Bacteria 1104
336 Ga0268265_10137446 3300028380 Bacteria 2041
337 Ga0265338_10001516 3300028800 Bacteria 37500
338 Ga0265338_10002616 3300028800 Bacteria 26585
339 Ga0265338_10003431 3300028800 Bacteria 22333
340 Ga0307508_10212876 3300031616 Bacteria 1533
341 Ga0373959_0013232 3300034820 Bacteria 1485
342 Ga0373926_0000311 3300035083 Bacteria 12034
343 Ga0373926_0065587 3300035083 Bacteria 1328
344 Ga0373928_0009672 3300035084 Bacteria 1885
345 Ga0373929_0003678 3300035085 Bacteria 2754
346 Ga0373929_0049567 3300035085 Bacteria 956
347 Ga0373934_0000788 3300035086 Bacteria 11392
348 Ga0373934_0019950 3300035086 Bacteria 2576
349 Ga0373934_0134298 3300035086 Bacteria 1010
350 Ga0373940_0032617 3300035088 Bacteria 1396
351 Ga0373949_0006266 3300035090 Bacteria 2625
352 Ga0373923_0005338 3300035111 Bacteria 4361
353 Ga0373923_0012401 3300035111 Bacteria 3149
354 Ga0373923_0014047 3300035111 Bacteria 2999
355 Ga0373923_0026306 3300035111 Bacteria 2314
356 Ga0373923_0050533 3300035111 Bacteria 1742
357 Ga0373932_0021489 3300035112 Bacteria 1704
358 Ga0373936_0004189 3300035113 Bacteria 5436
359 Ga0373936_0005561 3300035113 Bacteria 4756
360 Ga0373941_0012748 3300035115 Bacteria 2206
361 Ga0373941_0045239 3300035115 Bacteria 1377
362 Ga0373953_0000140 3300035117 Bacteria 18157
363 Ga0373953_0014944 3300035117 Bacteria 2802
364 Ga0373953_0084765 3300035117 Bacteria 1321
365 Ga0373954_0000724 3300035118 Bacteria 12718
366 Ga0373954_0010817 3300035118 Bacteria 4034
367 Ga0373954_0045169 3300035118 Bacteria 2057
368 Ga0373954_0077549 3300035118 Bacteria 1585
369 Ga0373954_0137648 3300035118 Bacteria 1190
370 Ga0373956_0001420 3300035119 Bacteria 9896
371 Ga0373956_0031976 3300035119 Bacteria 2308
372 Ga0373956_0091695 3300035119 Bacteria 1402
373 Ga0373957_0000138 3300035120 Bacteria 18132
374 Ga0373957_0001134 3300035120 Bacteria 7054
375 Ga0373957_0032654 3300035120 Bacteria 1918
376 Ga0373957_0055174 3300035120 Bacteria 1527
377 Ga0373957_0055686 3300035120 Bacteria 1521
378 Ga0373957_0065189 3300035120 Bacteria 1417
379 Ga0373943_0089149 3300035170 Bacteria 1595
380 Ga0373946_0004460 3300035171 Bacteria 5014
381 Ga0373946_0069389 3300035171 Bacteria 1518
382 Ga0373955_0000415 3300035172 Bacteria 18168
383 Ga0373955_0010112 3300035172 Bacteria 4443
384 Ga0373955_0010342 3300035172 Bacteria 4401
385 Ga0373955_0111496 3300035172 Bacteria 1582
386 Ga0373942_0012787 3300035207 Bacteria 2010
387 Ga0373961_0043919 3300035241 Bacteria 1301
388 Ga0373924_0001053 3300035410 Bacteria 8786
389 Ga0373924_0015054 3300035410 Bacteria 2932
390 Ga0373924_0021424 3300035410 Bacteria 2520
391 Ga0373931_0377523 3300035691 Bacteria 893
392 Ga0373935_0043472 3300035692 Bacteria 2827
393 Ga0373935_0131946 3300035692 Bacteria 1679
394 Ga0373935_0208123 3300035692 Bacteria 1354
395 Ga0373927_0033818 3300035695 Bacteria 3326
396 Ga0373933_0000901 3300035724 Bacteria 18165
397 Ga0373933_0002010 3300035724 Bacteria 11730
398 Ga0373933_0006977 3300035724 Bacteria 6156
399 Ga0373933_0009261 3300035724 Bacteria 5377
400 Ga0373933_0013189 3300035724 Bacteria 4577
401 Ga0373933_0051706 3300035724 Bacteria 2456
402 Ga0373933_0070720 3300035724 Bacteria 2123
403 Ga0373947_0000015 3300035725 Bacteria 129181
404 Ga0373947_0019844 3300035725 Bacteria 3880
405 Ga0373947_0024487 3300035725 Bacteria 3517
406 Ga0373947_0183416 3300035725 Bacteria 1363
407 Ga0373947_0331767 3300035725 Bacteria 1018
408 Ga0373937_0003579 3300036401 Bacteria 13095
409 Ga0373937_0007911 3300036401 Bacteria 9213
410 Ga0373937_0042382 3300036401 Bacteria 4152
411 Ga0373937_0066500 3300036401 Bacteria 3319
412 Ga0373937_0134887 3300036401 Bacteria 2307
413 Ga0373925_0003970 3300037068 Bacteria 11280
414 Ga0373925_0014784 3300037068 Bacteria 5641
415 Ga0373925_0019869 3300037068 Bacteria 4886
416 Ga0373925_0059835 3300037068 Bacteria 2858
417 Ga0373925_0085815 3300037068 Bacteria 2400
418 Ga0436364_0223502 3300037853 Bacteria 1241
419 Ga0436364_0513116 3300037853 Bacteria 1558
420 Ga0436364_0979419 3300037853 Bacteria 3911
421 Ga0436365_0145543 3300039437 Bacteria 915
422 Ga0436365_1935218 3300039437 Bacteria 1013
423 Ga0436363_0157713 3300039450 Bacteria 1004
424 Ga0436362_0310521 3300039453 Bacteria 1366
425 Ga0466959_0110585 3300045049 Bacteria 1961
426 Ga0466967_0000940 3300045976 Bacteria 15693
427 Ga0466967_0029848 3300045976 Bacteria 4569
428 Ga0466967_0062210 3300045976 Bacteria 3313
429 Ga0466967_0218465 3300045976 Bacteria 1810
430 Ga0466967_0291449 3300045976 Bacteria 1568
431 Ga0466967_0596394 3300045976 Bacteria 1090
432 Ga0495592_0002459 3300046454 Bacteria 13075
433 Ga0495592_0027590 3300046454 Bacteria 4303
434 Ga0495592_0064030 3300046454 Bacteria 2696
435 Ga0495592_0067324 3300046454 Bacteria 2617
436 Ga0495592_0113229 3300046454 Bacteria 1917
437 Ga0495603_0005856 3300046455 Bacteria 7350
438 Ga0495629_0002084 3300046459 Bacteria 15511
439 Ga0495629_0023831 3300046459 Bacteria 4358
440 Ga0495651_0001480 3300046462 Bacteria 18165
441 Ga0495651_0004464 3300046462 Bacteria 10716
442 Ga0495651_0010247 3300046462 Bacteria 7196
443 Ga0495651_0034023 3300046462 Bacteria 3973
444 Ga0495651_0067180 3300046462 Bacteria 2735
445 Ga0495651_0116115 3300046462 Bacteria 1972
446 Ga0495651_0180503 3300046462 Bacteria 1494
447 Ga0495651_0212145 3300046462 Bacteria 1346
448 Ga0495653_0003655 3300046463 Bacteria 12418
449 Ga0495653_0005439 3300046463 Bacteria 10375
450 Ga0495653_0023575 3300046463 Bacteria 4968
451 Ga0495653_0043289 3300046463 Bacteria 3502
452 Ga0495653_0052412 3300046463 Bacteria 3127
453 Ga0495653_0070650 3300046463 Bacteria 2613
454 Ga0495580_0027363 3300046472 Bacteria 4149
455 Ga0495582_0001253 3300046473 Bacteria 14257
456 Ga0495582_0004581 3300046473 Bacteria 7764
457 Ga0495582_0005125 3300046473 Bacteria 7340
458 Ga0495639_0001266 3300046475 Bacteria 11377
459 Ga0495639_0038986 3300046475 Bacteria 2135
460 Ga0495662_0004810 3300046476 Bacteria 6768
461 Ga0495664_0039347 3300046477 Bacteria 2793
462 Ga0495664_0051642 3300046477 Bacteria 2441
463 Ga0495664_0060517 3300046477 Bacteria 2254
464 Ga0495664_0064209 3300046477 Bacteria 2188
465 Ga0495664_0097862 3300046477 Bacteria 1766
466 Ga0495594_0014701 3300046499 Bacteria 4107
467 Ga0495608_0001229 3300046511 Bacteria 18165
468 Ga0495608_0001472 3300046511 Bacteria 16727
469 Ga0495608_0002707 3300046511 Bacteria 12728
470 Ga0495608_0046010 3300046511 Bacteria 2905
471 Ga0495608_0075945 3300046511 Bacteria 2189
472 Ga0495608_0116172 3300046511 Bacteria 1717
473 Ga0495618_0027460 3300046514 Bacteria 3542
474 Ga0495618_0050922 3300046514 Bacteria 2616
475 Ga0495618_0089235 3300046514 Bacteria 1971
476 Ga0495628_0002081 3300046516 Bacteria 18158
477 Ga0495628_0037920 3300046516 Bacteria 3861
478 Ga0495628_0073565 3300046516 Bacteria 2662
479 Ga0495628_0093175 3300046516 Bacteria 2330
480 Ga0495628_0151381 3300046516 Bacteria 1767
481 Ga0495628_0163403 3300046516 Bacteria 1691
482 Ga0495630_0035107 3300046517 Bacteria 3747
483 Ga0495630_0040591 3300046517 Bacteria 3479
484 Ga0495630_0141642 3300046517 Bacteria 1828
485 Ga0495666_0000699 3300046526 Bacteria 15230
486 Ga0495666_0019074 3300046526 Bacteria 3407
487 Ga0495666_0023251 3300046526 Bacteria 3065
488 Ga0495666_0136771 3300046526 Bacteria 1144
489 Ga0495652_0002697 3300046529 Bacteria 18037
490 Ga0495652_0003303 3300046529 Bacteria 16046
491 Ga0495652_0021324 3300046529 Bacteria 5761
492 Ga0495652_0030056 3300046529 Bacteria 4767
493 Ga0495652_0132027 3300046529 Bacteria 1975
494 Ga0495652_0173286 3300046529 Bacteria 1663
495 Ga0495665_0018953 3300046531 Bacteria 3698
496 Ga0495665_0045145 3300046531 Bacteria 2340
497 Ga0495665_0052580 3300046531 Bacteria 2156
498 Ga0495640_0019684 3300046533 Bacteria 4978
499 Ga0495640_0047603 3300046533 Bacteria 2967
500 Ga0495640_0081712 3300046533 Bacteria 2147
501 Ga0495586_0021496 3300046535 Bacteria 3440
502 Ga0495586_0045684 3300046535 Bacteria 2360
503 Ga0495587_0001054 3300046536 Bacteria 18152
504 Ga0495587_0002552 3300046536 Bacteria 12167
505 Ga0495587_0002981 3300046536 Bacteria 11316
506 Ga0495587_0018936 3300046536 Bacteria 4266
507 Ga0495587_0022026 3300046536 Bacteria 3926
508 Ga0495587_0033273 3300046536 Bacteria 3113
509 Ga0495645_0046333 3300046543 Bacteria 3169
510 Ga0495645_0079237 3300046543 Bacteria 2359
511 Ga0495645_0083677 3300046543 Bacteria 2286
512 Ga0495645_0167027 3300046543 Bacteria 1517
513 Ga0495645_0173370 3300046543 Bacteria 1483
514 Ga0495645_0187290 3300046543 Bacteria 1413
515 Ga0495667_0000901 3300046559 Bacteria 19170
516 Ga0495667_0003357 3300046559 Bacteria 10715
517 Ga0495667_0005191 3300046559 Bacteria 8805
518 Ga0495667_0042485 3300046559 Bacteria 3014
519 Ga0495667_0099687 3300046559 Bacteria 1880
520 Ga0495634_0005036 3300046642 Bacteria 10200
521 Ga0495634_0012418 3300046642 Bacteria 6165
522 Ga0495634_0043848 3300046642 Bacteria 3030
523 Ga0495634_0073333 3300046642 Bacteria 2250
524 Ga0495634_0110432 3300046642 Bacteria 1768
525 Ga0495634_0227017 3300046642 Bacteria 1150
526 Ga0495635_0002259 3300046663 Bacteria 13096
527 Ga0495635_0033715 3300046663 Bacteria 3552
528 Ga0495635_0143755 3300046663 Bacteria 1624
529 Ga0495635_0289013 3300046663 Bacteria 1100
530 Ga0495588_0085619 3300046674 Bacteria 1648
531 Ga0495657_0001832 3300046675 Bacteria 18165
532 Ga0495657_0002443 3300046675 Bacteria 15633
533 Ga0495657_0008081 3300046675 Bacteria 8068
534 Ga0495657_0016818 3300046675 Bacteria 5319
535 Ga0495657_0112406 3300046675 Bacteria 1724
536 Ga0495599_0000769 3300046678 Bacteria 18045
537 Ga0495599_0014909 3300046678 Bacteria 4815
538 Ga0495599_0027154 3300046678 Bacteria 3588
539 Ga0495599_0054327 3300046678 Bacteria 2509
540 Ga0495599_0105513 3300046678 Bacteria 1755
541 Ga0495623_0001121 3300046679 Bacteria 18078
542 Ga0495623_0021226 3300046679 Bacteria 4195
543 Ga0495623_0021681 3300046679 Bacteria 4150
544 Ga0495623_0083119 3300046679 Bacteria 1978
545 Ga0495623_0135302 3300046679 Bacteria 1471
546 Ga0495646_0035222 3300046680 Bacteria 3105
547 Ga0495646_0037791 3300046680 Bacteria 2984
548 Ga0495646_0047387 3300046680 Bacteria 2616
549 Ga0495646_0128867 3300046680 Bacteria 1426
550 Ga0495647_0012050 3300046681 Bacteria 2972
551 Ga0495658_0002071 3300046683 Bacteria 10162
552 Ga0495658_0056185 3300046683 Bacteria 2244
553 Ga0495613_0026838 3300046689 Bacteria 4288
554 Ga0495613_0031792 3300046689 Bacteria 3920
555 Ga0495613_0082527 3300046689 Bacteria 2334
556 Ga0495613_0239694 3300046689 Bacteria 1268
557 Ga0495624_0005950 3300046690 Bacteria 8720
558 Ga0495624_0028898 3300046690 Bacteria 3618
559 Ga0495624_0081799 3300046690 Bacteria 2000
560 Ga0495600_0002981 3300046809 Bacteria 9880
561 Ga0495600_0003873 3300046809 Bacteria 8878
562 Ga0495600_0011342 3300046809 Bacteria 5552
563 Ga0495600_0027002 3300046809 Bacteria 3709
564 Ga0495600_0085090 3300046809 Bacteria 2063
565 Ga0495600_0277481 3300046809 Bacteria 1061
566 Ga0495581_0000013 3300047315 Bacteria 62822
567 Ga0495581_0007748 3300047315 Bacteria 6214
568 Ga0495581_0011327 3300047315 Bacteria 5159
569 Ga0495581_0014170 3300047315 Bacteria 4621
570 Ga0495604_0001688 3300047317 Bacteria 18161
571 Ga0495604_0011447 3300047317 Bacteria 7044
572 Ga0495604_0034772 3300047317 Bacteria 3984
573 Ga0495604_0045531 3300047317 Bacteria 3423
574 Ga0495604_0062635 3300047317 Bacteria 2840
575 Ga0495604_0091273 3300047317 Bacteria 2260
576 Ga0495604_0101358 3300047317 Bacteria 2115
577 Ga0495674_0002438 3300047319 Bacteria 18172
578 Ga0495674_0020386 3300047319 Bacteria 6138
579 Ga0495674_0034406 3300047319 Bacteria 4583
580 Ga0495674_0038279 3300047319 Bacteria 4306
581 Ga0495674_0066413 3300047319 Bacteria 3129
582 Ga0495674_0076653 3300047319 Bacteria 2875
583 Ga0495676_0018649 3300047321 Bacteria 6120
584 Ga0495676_0066508 3300047321 Unclassified 2793
585 Ga0495676_0271933 3300047321 Bacteria 1149
586 Ga0495680_0002643 3300047322 Bacteria 18163
587 Ga0495680_0009363 3300047322 Bacteria 8817
588 Ga0495680_0017837 3300047322 Bacteria 6042
589 Ga0495680_0020585 3300047322 Bacteria 5545
590 Ga0495680_0058700 3300047322 Bacteria 2972
591 Ga0495680_0061256 3300047322 Bacteria 2895
592 Ga0495680_0089440 3300047322 Bacteria 2311
593 Ga0495675_0011168 3300047444 Bacteria 5632
594 Ga0495675_0013618 3300047444 Bacteria 5139
595 Ga0495675_0018733 3300047444 Bacteria 4396
596 Ga0495675_0025520 3300047444 Bacteria 3767
597 Ga0495675_0031009 3300047444 Bacteria 3412
598 Ga0495675_0045763 3300047444 Bacteria 2787
599 Ga0495684_0007665 3300047471 Bacteria 8352
600 Ga0495684_0011400 3300047471 Bacteria 6862
601 Ga0495684_0012750 3300047471 Bacteria 6489
602 Ga0495684_0037203 3300047471 Bacteria 3732
603 Ga0495684_0125941 3300047471 Bacteria 1927
604 Ga0495593_0004351 3300047673 Bacteria 8429
605 Ga0495593_0015930 3300047673 Bacteria 4246
606 Ga0495602_0002692 3300048088 Bacteria 18152
607 Ga0495602_0009753 3300048088 Bacteria 9975
608 Ga0495602_0023324 3300048088 Bacteria 6031
609 Ga0495614_0060637 3300048089 Bacteria 1625
610 Ga0496102_0058854 3300048905 Bacteria 3512
611 Ga0496103_0130370 3300048906 Bacteria 1605
612 Ga0496104_0005292 3300048907 Bacteria 11284
613 Ga0496104_0121979 3300048907 Bacteria 2502
614 Ga0496104_0500278 3300048907 Bacteria 1126
615 Ga0496105_0013091 3300048908 Bacteria 6577
616 Ga0496105_0172169 3300048908 Bacteria 1774
617 Ga0496107_0064952 3300048910 Bacteria 2645
618 Ga0496107_0096058 3300048910 Bacteria 2168
619 Ga0496108_0072431 3300048911 Bacteria 2908
620 Ga0496109_0035090 3300048912 Bacteria 4522
621 Ga0496109_0081889 3300048912 Bacteria 2974
622 Ga0496109_0538873 3300048912 Bacteria 1101
623 Ga0496110_0007004 3300048913 Bacteria 8969
624 Ga0496111_0085050 3300048914 Bacteria 2312
625 Ga0496113_0030178 3300048916 Bacteria 3922
626 Ga0496114_0045777 3300048917 Bacteria 3635
627 Ga0496115_0009280 3300048918 Bacteria 7311
628 Ga0496115_0039559 3300048918 Bacteria 3745
629 Ga0496126_0188531 3300048929 Bacteria 1748
630 nmdc:mga05p37_36017_c1 3300050507 Bacteria 6072
631 nmdc:mga0n895_177534_c1 3300050512 Bacteria 2161
632 nmdc:mga0n895_48520_c1 3300050512 Bacteria 4157
633 nmdc:mga0rr50_103025_c1 3300050513 Unclassified 2246
634 nmdc:mga0rr50_129079_c1 3300050513 Unclassified 2022
635 nmdc:mga0rr50_267517_c1 3300050513 Bacteria 1424
636 nmdc:mga0rr50_5006_c1 3300050513 Bacteria 7850
637 nmdc:mga08x19_12417_c1 3300050514 Bacteria 5132
638 nmdc:mga08x19_159241_c1 3300050514 Bacteria 1533
639 nmdc:mga08x19_212950_c1 3300050514 Unclassified 1327
640 nmdc:mga08x19_507712_c1 3300050514 Unclassified 852
641 nmdc:mga08x19_62711_c1 3300050514 Bacteria 2411
642 nmdc:mga08x19_84030_c1 3300050514 Bacteria 2094
643 nmdc:mga08x19_90216_c1 3300050514 Bacteria 2022
644 nmdc:mga08x19_94793_c1 3300050514 Bacteria 1974
645 nmdc:mga0a205_107459_c1 3300050515 Unclassified 2688
646 nmdc:mga0a205_22836_c1 3300050515 Bacteria 5931
647 nmdc:mga0a205_27258_c1 3300050515 Bacteria 5456
648 nmdc:mga0a205_5120_c1 3300050515 Bacteria 11788
649 Ga0495601_0039538 3300053077 Bacteria 2954
650 Ga0495601_0057061 3300053077 Bacteria 2473
651 Ga0495601_0244562 3300053077 Bacteria 1171
652 Ga0495601_0416366 3300053077 Bacteria 870
653 Ga0495612_0012846 3300053078 Bacteria 3375
654 Ga0495595_0010455 3300053084 Bacteria 3856
655 Ga0495595_0020906 3300053084 Bacteria 2853
656 Ga0495595_0025427 3300053084 Bacteria 2624
657 Ga0495595_0054030 3300053084 Bacteria 1867
658 Ga0495595_0111095 3300053084 Bacteria 1329
659 Ga0495595_0115875 3300053084 Bacteria 1302
660 Ga0495619_0016428 3300053085 Bacteria 4685
661 Ga0495619_0021538 3300053085 Bacteria 4116
662 Ga0495619_0068994 3300053085 Bacteria 2362
663 Ga0495619_0087396 3300053085 Bacteria 2107
664 Ga0373935_0248896
665 JGI25407J50210_10004829
666 JGI25407J50210_10012278
667 Ga0070658_10115026
668 Ga0070683_100148020
669 Ga0070690_100149004
670 Ga0068869_100382039
671 Ga0070666_10105895
672 Ga0070682_100099519
673 Ga0070682_100326176
674 Ga0068868_100249768
675 Ga0070660_100109481
676 Ga0070691_10013756
677 Ga0070687_100057324
678 Ga0070661_100025073
679 Ga0070692_10092218
680 Ga0070671_100225826
681 Ga0070673_100184054
682 Ga0070659_100116332
683 Ga0070667_100285325
684 Ga0070709_10001274
685 Ga0070709_10001449
686 Ga0070709_10023539
687 Ga0070714_100000143
688 Ga0070714_100001490
689 Ga0070714_100002815
690 Ga0070714_100010943
691 Ga0070714_100129111
692 Ga0070714_100162968
693 Ga0070714_100169698
694 Ga0070714_100225511
695 Ga0070714_100236555
696 Ga0070713_100007522
697 Ga0070713_100016247
698 Ga0070713_100054442
699 Ga0070713_100096406
700 Ga0070713_100569748
701 Ga0070710_10000036
702 Ga0070710_10004042
703 Ga0070710_10026807
704 Ga0070710_10241937
705 Ga0070711_100001614
706 Ga0070711_100010311
707 Ga0070711_100043529
708 Ga0070711_100046889
709 Ga0070711_100172704
710 Ga0070711_100183165
711 Ga0070705_100051015
712 Ga0070705_100065783
713 Ga0070700_100117572
714 Ga0070708_100001904
715 Ga0070708_100002732
716 Ga0070708_100004260
717 Ga0070708_100012877
718 Ga0070708_100103114
719 Ga0070708_100284781
720 Ga0070663_100064924
721 Ga0070662_100279349
722 Ga0070681_10034293
723 Ga0070681_10221649
724 Ga0070706_100000279
725 Ga0070706_100000502
726 Ga0070706_100003771
727 Ga0070706_100008106
728 Ga0070706_100012264
729 Ga0070706_100014354
730 Ga0070706_100031977
731 Ga0070706_100040206
732 Ga0070706_100114309
733 Ga0070706_100283411
734 Ga0070706_100297030
735 Ga0070706_100477754
736 Ga0070706_100526722
737 Ga0070707_100000340
738 Ga0070707_100001105
739 Ga0070707_100008544
740 Ga0070707_100012266
741 Ga0070707_100012547
742 Ga0070707_100015356
743 Ga0070707_100017140
744 Ga0070707_100020448
745 Ga0070707_100030107
746 Ga0070707_100049120
747 Ga0070707_100054759
748 Ga0070707_100074513
749 Ga0070707_100086133
750 Ga0070707_100087006
751 Ga0070707_100110462
752 Ga0070707_100192169
753 Ga0070707_100438614
754 Ga0070698_100000534
755 Ga0070698_100010857
756 Ga0070698_100011092
757 Ga0070698_100014380
758 Ga0070698_100014913
759 Ga0070698_100015773
760 Ga0070698_100042717
761 Ga0070698_100063868
762 Ga0070698_100108000
763 Ga0070698_100119727
764 Ga0070698_100215638
765 Ga0070698_100221100
766 Ga0070698_100314234
767 Ga0070698_100432010
768 Ga0070698_100441310
769 Ga0070699_100000329
770 Ga0070699_100000431
771 Ga0070699_100001089
772 Ga0070699_100122780
773 Ga0070699_100220160
774 Ga0070699_100411335
775 Ga0070679_100004220
776 Ga0070679_100194797
777 Ga0070684_100020441
778 Ga0070697_100000026
779 Ga0070697_100000929
780 Ga0070697_100016128
781 Ga0070697_100029276
782 Ga0070697_100045485
783 Ga0070697_100164125
784 Ga0070697_100176568
785 Ga0070697_100195075
786 Ga0070697_100458224
787 Ga0070672_100469589
788 Ga0070695_100003515
789 Ga0070695_100034344
790 Ga0070695_100135109
791 Ga0070695_100263482
792 Ga0070696_100048211
793 Ga0070696_100148392
794 Ga0070693_100132031
795 Ga0070665_100514608
796 Ga0070704_100005853
797 Ga0068855_100201406
798 Ga0070664_100115255
799 Ga0068857_100324497
800 Ga0068856_100329025
801 Ga0070702_100071857
802 Ga0068859_100126926
803 Ga0068864_100143172
804 Ga0068864_100229919
805 Ga0068861_100456117
806 Ga0068870_10095819
807 Ga0068863_100116636
808 Ga0068863_100268564
809 Ga0068863_100289550
810 Ga0068860_100269460
811 Ga0081538_10004627
812 Ga0081538_10007541
813 Ga0081538_10011641
814 Ga0081538_10030568
815 Ga0081540_1000070
816 Ga0081540_1000680
817 Ga0081539_10009328
818 Ga0070717_10001367
819 Ga0070717_10009035
820 Ga0070717_10040491
821 Ga0070717_10062041
822 Ga0070717_10099162
823 Ga0070717_10113713
824 Ga0070717_10133954
825 Ga0070717_10203435
826 Ga0075432_10080426
827 Ga0070715_10001982
828 Ga0070715_10007382
829 Ga0070715_10024155
830 Ga0070715_10025092
831 Ga0070715_10066943
832 Ga0070716_100000168
833 Ga0070716_100002131
834 Ga0070716_100015263
835 Ga0070716_100194506
836 Ga0070716_100232902
837 Ga0070712_100017132
838 Ga0070712_100019233
839 Ga0070712_100047071
840 Ga0097621_100207742
841 Ga0068871_100044997
842 Ga0075433_10007041
843 Ga0075433_10026971
844 Ga0075433_10067252
845 Ga0075433_10106303
846 Ga0075433_10213046
847 Ga0075434_100036206
848 Ga0075434_100100976
849 Ga0075434_100132593
850 Ga0075434_100315369
851 Ga0075434_100588874
852 Ga0068865_100331903
853 Ga0075436_100011093
854 Ga0075436_100046683
855 Ga0075436_100062847
856 Ga0075436_100077904
857 Ga0075436_100214017
858 Ga0075436_100342949
859 Ga0097620_100126930
860 Ga0075435_100006737
861 Ga0075435_100069429
862 Ga0099794_10012216
863 Ga0099794_10122337
864 Ga0105245_10012765
865 Ga0105247_10135110
866 Ga0105247_10135194
867 Ga0114129_10013562
868 Ga0114129_10062995
869 Ga0105242_10236799
870 Ga0105239_10167392
871 Ga0105239_10567461
872 Ga0157373_10080573
873 Ga0157371_10022047
874 Ga0157370_10301642
875 Ga0157370_10316285
876 Ga0157369_10048055
877 Ga0157374_10181041
878 Ga0157378_10325233
879 Ga0163162_10016697
880 Ga0157372_10176314
881 Ga0157375_10152772
882 Ga0157375_10827628
883 Ga0163163_10003082
884 Ga0163163_10307297
885 Ga0157380_10137709
886 Ga0157377_10036716
887 Ga0157379_10041374
888 Ga0157376_10095356
889 Ga0163161_10173006
890 Ga0206356_11116159
891 Ga0206353_10175466
892 Ga0206353_11014567
893 Ga0213875_10024827
894 Ga0213875_10114743
895 Ga0207653_10002482
896 Ga0207692_10001185
897 Ga0207692_10132444
898 Ga0207692_10133582
899 Ga0207692_10175693
900 Ga0207710_10040187
901 Ga0207710_10118632
902 Ga0207688_10046378
903 Ga0207647_10140735
904 Ga0207685_10000523
905 Ga0207685_10011371
906 Ga0207685_10018863
907 Ga0207685_10045513
908 Ga0207699_10000881
909 Ga0207699_10006793
910 Ga0207699_10015662
911 Ga0207699_10083188
912 Ga0207645_10249672
913 Ga0207684_10000005
914 Ga0207684_10000021
915 Ga0207684_10000521
916 Ga0207684_10004719
917 Ga0207684_10008648
918 Ga0207684_10011857
919 Ga0207684_10015090
920 Ga0207684_10035162
921 Ga0207684_10213846
922 Ga0207684_10267777
923 Ga0207684_10316781
924 Ga0207684_10340416
925 Ga0207707_10064762
926 Ga0207707_10229952
927 Ga0207695_10127436
928 Ga0207693_10004497
929 Ga0207693_10029117
930 Ga0207693_10067118
931 Ga0207693_10201374
932 Ga0207663_10001904
933 Ga0207663_10012230
934 Ga0207663_10143315
935 Ga0207663_10185309
936 Ga0207662_10023045
937 Ga0207657_10005492
938 Ga0207649_10033352
939 Ga0207652_10002601
940 Ga0207646_10000573
941 Ga0207646_10000775
942 Ga0207646_10001077
943 Ga0207646_10001361
944 Ga0207646_10002160
945 Ga0207646_10003315
946 Ga0207646_10005491
947 Ga0207646_10008920
948 Ga0207646_10010332
949 Ga0207646_10025734
950 Ga0207646_10029022
951 Ga0207646_10048011
952 Ga0207646_10083948
953 Ga0207646_10085078
954 Ga0207646_10095647
955 Ga0207646_10222997
956 Ga0207646_10250452
957 Ga0207646_10340745
958 Ga0207646_10465231
959 Ga0207694_10146029
960 Ga0207687_10306416
961 Ga0207700_10000054
962 Ga0207700_10012086
963 Ga0207700_10020732
964 Ga0207700_10031015
965 Ga0207700_10088483
966 Ga0207700_10117812
967 Ga0207700_10145983
968 Ga0207700_10149247
969 Ga0207700_10426323
970 Ga0207664_10000137
971 Ga0207664_10000221
972 Ga0207664_10003813
973 Ga0207664_10003844
974 Ga0207664_10038778
975 Ga0207664_10060234
976 Ga0207664_10118338
977 Ga0207664_10149734
978 Ga0207664_10289430
979 Ga0207644_10195726
980 Ga0207706_10174703
981 Ga0207665_10000519
982 Ga0207665_10002106
983 Ga0207665_10005359
984 Ga0207665_10016367
985 Ga0207665_10227525
986 Ga0207665_10293049
987 Ga0207689_10002639
988 Ga0207651_10291648
989 Ga0207678_10023752
990 Ga0207708_10036096
991 Ga0207702_10106697
992 Ga0207641_10124413
993 Ga0207674_10007988
994 Ga0207675_100010943
995 Ga0207683_10018791
996 Ga0207683_10120147
997 Ga0209588_1000117
998 Ga0268266_10551793
999 Ga0268265_10137446
1000 Ga0265338_10001516
1001 Ga0265338_10002616
1002 Ga0265338_10003431
1003 Ga0307508_10212876
1004 Ga0373959_0013232
1005 Ga0373926_0000311
1006 Ga0373926_0065587
1007 Ga0373928_0009672
1008 Ga0373929_0003678
1009 Ga0373929_0049567
1010 Ga0373934_0000788
1011 Ga0373934_0019950
1012 Ga0373934_0134298
1013 Ga0373940_0032617
1014 Ga0373949_0006266
1015 Ga0373923_0005338
1016 Ga0373923_0012401
1017 Ga0373923_0014047
1018 Ga0373923_0026306
1019 Ga0373923_0050533
1020 Ga0373932_0021489
1021 Ga0373936_0004189
1022 Ga0373936_0005561
1023 Ga0373941_0012748
1024 Ga0373941_0045239
1025 Ga0373953_0000140
1026 Ga0373953_0014944
1027 Ga0373953_0084765
1028 Ga0373954_0000724
1029 Ga0373954_0010817
1030 Ga0373954_0045169
1031 Ga0373954_0077549
1032 Ga0373954_0137648
1033 Ga0373956_0001420
1034 Ga0373956_0031976
1035 Ga0373956_0091695
1036 Ga0373957_0000138
1037 Ga0373957_0001134
1038 Ga0373957_0032654
1039 Ga0373957_0055174
1040 Ga0373957_0055686
1041 Ga0373957_0065189
1042 Ga0373943_0089149
1043 Ga0373946_0004460
1044 Ga0373946_0069389
1045 Ga0373955_0000415
1046 Ga0373955_0010112
1047 Ga0373955_0010342
1048 Ga0373955_0111496
1049 Ga0373942_0012787
1050 Ga0373961_0043919
1051 Ga0373924_0001053
1052 Ga0373924_0015054
1053 Ga0373924_0021424
1054 Ga0373931_0377523
1055 Ga0373935_0043472
1056 Ga0373935_0131946
1057 Ga0373935_0208123
1058 Ga0373927_0033818
1059 Ga0373933_0000901
1060 Ga0373933_0002010
1061 Ga0373933_0006977
1062 Ga0373933_0009261
1063 Ga0373933_0013189
1064 Ga0373933_0051706
1065 Ga0373933_0070720
1066 Ga0373947_0000015
1067 Ga0373947_0019844
1068 Ga0373947_0024487
1069 Ga0373947_0183416
1070 Ga0373947_0331767
1071 Ga0373937_0003579
1072 Ga0373937_0007911
1073 Ga0373937_0042382
1074 Ga0373937_0066500
1075 Ga0373937_0134887
1076 Ga0373925_0003970
1077 Ga0373925_0014784
1078 Ga0373925_0019869
1079 Ga0373925_0059835
1080 Ga0373925_0085815
1081 Ga0436364_0223502
1082 Ga0436364_0513116
1083 Ga0436364_0979419
1084 Ga0436365_0145543
1085 Ga0436365_1935218
1086 Ga0436363_0157713
1087 Ga0436362_0310521
1088 Ga0466959_0110585
1089 Ga0466967_0000940
1090 Ga0466967_0029848
1091 Ga0466967_0062210
1092 Ga0466967_0218465
1093 Ga0466967_0291449
1094 Ga0466967_0596394
1095 Ga0495592_0002459
1096 Ga0495592_0027590
1097 Ga0495592_0064030
1098 Ga0495592_0067324
1099 Ga0495592_0113229
1100 Ga0495603_0005856
1101 Ga0495629_0002084
1102 Ga0495629_0023831
1103 Ga0495651_0001480
1104 Ga0495651_0004464
1105 Ga0495651_0010247
1106 Ga0495651_0034023
1107 Ga0495651_0067180
1108 Ga0495651_0116115
1109 Ga0495651_0180503
1110 Ga0495651_0212145
1111 Ga0495653_0003655
1112 Ga0495653_0005439
1113 Ga0495653_0023575
1114 Ga0495653_0043289
1115 Ga0495653_0052412
1116 Ga0495653_0070650
1117 Ga0495580_0027363
1118 Ga0495582_0001253
1119 Ga0495582_0004581
1120 Ga0495582_0005125
1121 Ga0495639_0001266
1122 Ga0495639_0038986
1123 Ga0495662_0004810
1124 Ga0495664_0039347
1125 Ga0495664_0051642
1126 Ga0495664_0060517
1127 Ga0495664_0064209
1128 Ga0495664_0097862
1129 Ga0495594_0014701
1130 Ga0495608_0001229
1131 Ga0495608_0001472
1132 Ga0495608_0002707
1133 Ga0495608_0046010
1134 Ga0495608_0075945
1135 Ga0495608_0116172
1136 Ga0495618_0027460
1137 Ga0495618_0050922
1138 Ga0495618_0089235
1139 Ga0495628_0002081
1140 Ga0495628_0037920
1141 Ga0495628_0073565
1142 Ga0495628_0093175
1143 Ga0495628_0151381
1144 Ga0495628_0163403
1145 Ga0495630_0035107
1146 Ga0495630_0040591
1147 Ga0495630_0141642
1148 Ga0495666_0000699
1149 Ga0495666_0019074
1150 Ga0495666_0023251
1151 Ga0495666_0136771
1152 Ga0495652_0002697
1153 Ga0495652_0003303
1154 Ga0495652_0021324
1155 Ga0495652_0030056
1156 Ga0495652_0132027
1157 Ga0495652_0173286
1158 Ga0495665_0018953
1159 Ga0495665_0045145
1160 Ga0495665_0052580
1161 Ga0495640_0019684
1162 Ga0495640_0047603
1163 Ga0495640_0081712
1164 Ga0495586_0021496
1165 Ga0495586_0045684
1166 Ga0495587_0001054
1167 Ga0495587_0002552
1168 Ga0495587_0002981
1169 Ga0495587_0018936
1170 Ga0495587_0022026
1171 Ga0495587_0033273
1172 Ga0495645_0046333
1173 Ga0495645_0079237
1174 Ga0495645_0083677
1175 Ga0495645_0167027
1176 Ga0495645_0173370
1177 Ga0495645_0187290
1178 Ga0495667_0000901
1179 Ga0495667_0003357
1180 Ga0495667_0005191
1181 Ga0495667_0042485
1182 Ga0495667_0099687
1183 Ga0495634_0005036
1184 Ga0495634_0012418
1185 Ga0495634_0043848
1186 Ga0495634_0073333
1187 Ga0495634_0110432
1188 Ga0495634_0227017
1189 Ga0495635_0002259
1190 Ga0495635_0033715
1191 Ga0495635_0143755
1192 Ga0495635_0289013
1193 Ga0495588_0085619
1194 Ga0495657_0001832
1195 Ga0495657_0002443
1196 Ga0495657_0008081
1197 Ga0495657_0016818
1198 Ga0495657_0112406
1199 Ga0495599_0000769
1200 Ga0495599_0014909
1201 Ga0495599_0027154
1202 Ga0495599_0054327
1203 Ga0495599_0105513
1204 Ga0495623_0001121
1205 Ga0495623_0021226
1206 Ga0495623_0021681
1207 Ga0495623_0083119
1208 Ga0495623_0135302
1209 Ga0495646_0035222
1210 Ga0495646_0037791
1211 Ga0495646_0047387
1212 Ga0495646_0128867
1213 Ga0495647_0012050
1214 Ga0495658_0002071
1215 Ga0495658_0056185
1216 Ga0495613_0026838
1217 Ga0495613_0031792
1218 Ga0495613_0082527
1219 Ga0495613_0239694
1220 Ga0495624_0005950
1221 Ga0495624_0028898
1222 Ga0495624_0081799
1223 Ga0495600_0002981
1224 Ga0495600_0003873
1225 Ga0495600_0011342
1226 Ga0495600_0027002
1227 Ga0495600_0085090
1228 Ga0495600_0277481
1229 Ga0495581_0000013
1230 Ga0495581_0007748
1231 Ga0495581_0011327
1232 Ga0495581_0014170
1233 Ga0495604_0001688
1234 Ga0495604_0011447
1235 Ga0495604_0034772
1236 Ga0495604_0045531
1237 Ga0495604_0062635
1238 Ga0495604_0091273
1239 Ga0495604_0101358
1240 Ga0495674_0002438
1241 Ga0495674_0020386
1242 Ga0495674_0034406
1243 Ga0495674_0038279
1244 Ga0495674_0066413
1245 Ga0495674_0076653
1246 Ga0495676_0018649
1247 Ga0495676_0066508
1248 Ga0495676_0271933
1249 Ga0495680_0002643
1250 Ga0495680_0009363
1251 Ga0495680_0017837
1252 Ga0495680_0020585
1253 Ga0495680_0058700
1254 Ga0495680_0061256
1255 Ga0495680_0089440
1256 Ga0495675_0011168
1257 Ga0495675_0013618
1258 Ga0495675_0018733
1259 Ga0495675_0025520
1260 Ga0495675_0031009
1261 Ga0495675_0045763
1262 Ga0495684_0007665
1263 Ga0495684_0011400
1264 Ga0495684_0012750
1265 Ga0495684_0037203
1266 Ga0495684_0125941
1267 Ga0495593_0004351
1268 Ga0495593_0015930
1269 Ga0495602_0002692
1270 Ga0495602_0009753
1271 Ga0495602_0023324
1272 Ga0495614_0060637
1273 Ga0496102_0058854
1274 Ga0496103_0130370
1275 Ga0496104_0005292
1276 Ga0496104_0121979
1277 Ga0496104_0500278
1278 Ga0496105_0013091
1279 Ga0496105_0172169
1280 Ga0496107_0064952
1281 Ga0496107_0096058
1282 Ga0496108_0072431
1283 Ga0496109_0035090
1284 Ga0496109_0081889
1285 Ga0496109_0538873
1286 Ga0496110_0007004
1287 Ga0496111_0085050
1288 Ga0496113_0030178
1289 Ga0496114_0045777
1290 Ga0496115_0009280
1291 Ga0496115_0039559
1292 Ga0496126_0188531
1293 nmdc:mga05p37_36017_c1
1294 nmdc:mga0n895_177534_c1
1295 nmdc:mga0n895_48520_c1
1296 nmdc:mga0rr50_103025_c1
1297 nmdc:mga0rr50_129079_c1
1298 nmdc:mga0rr50_267517_c1
1299 nmdc:mga0rr50_5006_c1
1300 nmdc:mga08x19_12417_c1
1301 nmdc:mga08x19_159241_c1
1302 nmdc:mga08x19_212950_c1
1303 nmdc:mga08x19_507712_c1
1304 nmdc:mga08x19_62711_c1
1305 nmdc:mga08x19_84030_c1
1306 nmdc:mga08x19_90216_c1
1307 nmdc:mga08x19_94793_c1
1308 nmdc:mga0a205_107459_c1
1309 nmdc:mga0a205_22836_c1
1310 nmdc:mga0a205_27258_c1
1311 nmdc:mga0a205_5120_c1
1312 Ga0495601_0039538
1313 Ga0495601_0057061
1314 Ga0495601_0244562
1315 Ga0495601_0416366
1316 Ga0495612_0012846
1317 Ga0495595_0010455
1318 Ga0495595_0020906
1319 Ga0495595_0025427
1320 Ga0495595_0054030
1321 Ga0495595_0111095
1322 Ga0495595_0115875
1323 Ga0495619_0016428
1324 Ga0495619_0021538
1325 Ga0495619_0068994
1326 Ga0495619_0087396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

6

281

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.8213 1 274
3irs-assembly1.cif.gz_B crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica 0.8051 1 274
4icm-assembly3.cif.gz_C crystal structure of 5-carboxyvanillate decarboxylase ligw from sphingomonas paucimobilis 0.7432 32 271
7bpc-assembly1.cif.gz_D crystal structure of 2, 3-dihydroxybenzoic acid decarboxylase from fusarium oxysporum in complex with 2,5-dhba 0.7426 33 271
3s4t-assembly1.cif.gz_A crystal structure of putative amidohydrolase-2 (efi-target 500288)from polaromonas sp. js666 0.7292 2 271
ID Description Score Start End Superfamily
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8957 2 274 3.20.20.140
af_I6Y3Q7_2_272_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.877 2 274 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.865 15 271 3.20.20.140
3k4wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8237 2 272 3.20.20.140
af_Q50662_37_305_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8104 15 271 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2W6A6R1-F1-model_v4 4-hydroxyphenyl-beta-ketoacyl-CoA hydrolase (Amidohydrolase) 0.9821 2 272 GO:0016787
GO:0016831
AF-A0A536KCL5-F1-model_v4 Amidohydrolase 0.9814 2 271 GO:0016787
GO:0016831
AF-A0A535UQB7-F1-model_v4 Amidohydrolase 0.9813 2 271 GO:0016787
GO:0016831
AF-A0A358SMU0-F1-model_v4 4-hydroxyphenyl-beta-ketoacyl-CoA hydrolase 0.981 2 271 GO:0016787
GO:0016831
AF-A0A536LAF9-F1-model_v4 Amidohydrolase 0.9809 2 272 GO:0016787
GO:0016831

Map