F471440

General Info

Members Datasets Scaffolds Average Seq Length
637 228 1274 106

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10151664|Ga0265314_101516642
Length 117
Sequence MQVPHVSECSYEAHVKVPLSQIAHTRSGDKGDTCNIGVIALDPRDYPVLVREVTAERVRRHFGDLVKGPVERYELPNLGALNFLLHQALGGGGTVSLRTDAQGKTFGAALLALEIEV

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.1
Rhizosphere 97.96
Stem 0
Stem Tuber 0
Unclassified 28.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10151664 3300031711 Bacteria 1420
2 Ga0070658_10742741 3300005327 Bacteria 852
3 Ga0070658_10864183 3300005327 Bacteria 786
4 Ga0070676_10941466 3300005328 Unclassified 645
5 Ga0070676_11464178 3300005328 Unclassified 525
6 Ga0070683_100000497 3300005329 Bacteria 27743
7 Ga0070683_100100401 3300005329 Bacteria 2724
8 Ga0070683_100172677 3300005329 Unclassified 2052
9 Ga0070683_100358292 3300005329 Bacteria 1389
10 Ga0070683_101083319 3300005329 Unclassified 770
11 Ga0070683_101474208 3300005329 Unclassified 654
12 Ga0070683_101657070 3300005329 Unclassified 615
13 Ga0070690_101529916 3300005330 Bacteria 539
14 Ga0070670_100893401 3300005331 Bacteria 805
15 Ga0070670_101320430 3300005331 Unclassified 660
16 Ga0068869_100980979 3300005334 Bacteria 735
17 Ga0070666_10323448 3300005335 Bacteria 1100
18 Ga0070666_10710801 3300005335 Bacteria 737
19 Ga0070666_10869472 3300005335 Bacteria 666
20 Ga0070680_100003800 3300005336 Bacteria 11292
21 Ga0070682_100061009 3300005337 Bacteria 2386
22 Ga0070682_101729898 3300005337 Bacteria 544
23 Ga0068868_100074348 3300005338 Bacteria 2714
24 Ga0068868_100122075 3300005338 Unclassified 2126
25 Ga0068868_100729074 3300005338 Unclassified 889
26 Ga0070660_100059129 3300005339 Bacteria 2972
27 Ga0070660_100427750 3300005339 Bacteria 1097
28 Ga0070660_100901746 3300005339 Bacteria 745
29 Ga0070689_100162242 3300005340 Bacteria 1807
30 Ga0070689_101004883 3300005340 Bacteria 742
31 Ga0070691_10001259 3300005341 Bacteria 10690
32 Ga0070687_101266598 3300005343 Bacteria 546
33 Ga0070661_100039205 3300005344 Unclassified 3452
34 Ga0070692_11412092 3300005345 Bacteria 503
35 Ga0070671_100208533 3300005355 Unclassified 1657
36 Ga0070674_101906446 3300005356 Bacteria 540
37 Ga0070673_100081542 3300005364 Bacteria 2624
38 Ga0070688_100060318 3300005365 Bacteria 2395
39 Ga0070667_101419831 3300005367 Bacteria 651
40 Ga0070709_10180816 3300005434 Bacteria 1481
41 Ga0070709_10197378 3300005434 Bacteria 1423
42 Ga0070714_100032417 3300005435 Bacteria 4361
43 Ga0070714_100135373 3300005435 Bacteria 2206
44 Ga0070713_100022680 3300005436 Bacteria 4855
45 Ga0070713_100334447 3300005436 Bacteria 1402
46 Ga0070713_101708355 3300005436 Bacteria 611
47 Ga0070710_10742643 3300005437 Unclassified 696
48 Ga0070711_100056027 3300005439 Bacteria 2725
49 Ga0070711_101497112 3300005439 Bacteria 589
50 Ga0070662_100039883 3300005457 Unclassified 3342
51 Ga0070681_10007276 3300005458 Bacteria 10807
52 Ga0070681_10208431 3300005458 Bacteria 1871
53 Ga0070681_11762657 3300005458 Unclassified 546
54 Ga0068867_101191933 3300005459 Bacteria 699
55 Ga0070707_101155601 3300005468 Bacteria 740
56 Ga0070698_100872766 3300005471 Archaea 845
57 Ga0070679_100001789 3300005530 Bacteria 19379
58 Ga0070679_100404890 3300005530 Unclassified 1310
59 Ga0070679_100957199 3300005530 Bacteria 800
60 Ga0070684_100002783 3300005535 Bacteria 12956
61 Ga0070684_100179844 3300005535 Bacteria 1923
62 Ga0070684_100307615 3300005535 Bacteria 1455
63 Ga0070684_100866838 3300005535 Unclassified 845
64 Ga0070697_100316313 3300005536 Bacteria 1344
65 Ga0068853_100200237 3300005539 Unclassified 1817
66 Ga0068853_100481261 3300005539 Bacteria 1170
67 Ga0070686_100335649 3300005544 Unclassified 1131
68 Ga0070686_100349292 3300005544 Bacteria 1111
69 Ga0070686_100913855 3300005544 Bacteria 715
70 Ga0070686_100955136 3300005544 Bacteria 700
71 Ga0070695_100104208 3300005545 Bacteria 1915
72 Ga0070696_100557007 3300005546 Bacteria 919
73 Ga0070693_100061059 3300005547 Bacteria 2190
74 Ga0070693_100242164 3300005547 Bacteria 1192
75 Ga0070665_101720413 3300005548 Unclassified 634
76 Ga0070665_101779905 3300005548 Unclassified 623
77 Ga0068855_100004869 3300005563 Bacteria 16391
78 Ga0068855_100023679 3300005563 Bacteria 7353
79 Ga0068855_100026535 3300005563 Bacteria 6930
80 Ga0068855_100360759 3300005563 Bacteria 1599
81 Ga0070664_100282152 3300005564 Bacteria 1498
82 Ga0068857_100001612 3300005577 Bacteria 18104
83 Ga0068857_100009382 3300005577 Bacteria 8494
84 Ga0068857_100676920 3300005577 Bacteria 979
85 Ga0068857_101146378 3300005577 Bacteria 752
86 Ga0068854_102005828 3300005578 Bacteria 533
87 Ga0068856_100012289 3300005614 Bacteria 8292
88 Ga0068856_100019017 3300005614 Bacteria 6665
89 Ga0068856_100728386 3300005614 Unclassified 1012
90 Ga0068856_100774912 3300005614 Bacteria 979
91 Ga0068856_101220833 3300005614 Bacteria 768
92 Ga0070702_100094529 3300005615 Unclassified 1820
93 Ga0068852_100004525 3300005616 Bacteria 9836
94 Ga0068852_100168015 3300005616 Bacteria 2054
95 Ga0068852_100292318 3300005616 Bacteria 1574
96 Ga0068859_100027428 3300005617 Bacteria 5712
97 Ga0068859_100145442 3300005617 Bacteria 2445
98 Ga0068859_100526900 3300005617 Unclassified 1276
99 Ga0068859_101243976 3300005617 Unclassified 820
100 Ga0068859_101271773 3300005617 Bacteria 811
101 Ga0068859_101940320 3300005617 Bacteria 650
102 Ga0068864_100318632 3300005618 Unclassified 1460
103 Ga0068864_100333418 3300005618 Unclassified 1428
104 Ga0068864_100435805 3300005618 Unclassified 1251
105 Ga0068864_101445179 3300005618 Bacteria 690
106 Ga0068866_10324807 3300005718 Bacteria 969
107 Ga0068866_10776610 3300005718 Unclassified 664
108 Ga0068851_10195082 3300005834 Unclassified 1128
109 Ga0068870_10038276 3300005840 Bacteria 2476
110 Ga0068863_100044516 3300005841 Unclassified 4213
111 Ga0068863_100160229 3300005841 Bacteria 2155
112 Ga0068863_100442137 3300005841 Bacteria 1275
113 Ga0068863_101320735 3300005841 Unclassified 728
114 Ga0068863_101636479 3300005841 Unclassified 653
115 Ga0068863_101870258 3300005841 Bacteria 610
116 Ga0068858_100009783 3300005842 Bacteria 9128
117 Ga0068858_100108173 3300005842 Bacteria 2596
118 Ga0068858_100192373 3300005842 Unclassified 1928
119 Ga0068858_100279010 3300005842 Bacteria 1591
120 Ga0068858_100571508 3300005842 Bacteria 1095
121 Ga0068858_100665248 3300005842 Unclassified 1012
122 Ga0068858_100919776 3300005842 Bacteria 856
123 Ga0068860_100129395 3300005843 Bacteria 2422
124 Ga0068860_100487708 3300005843 Bacteria 1229
125 Ga0068860_101680370 3300005843 Bacteria 657
126 Ga0070717_10040840 3300006028 Unclassified 3781
127 Ga0070717_10150053 3300006028 Bacteria 2016
128 Ga0070717_10487923 3300006028 Bacteria 1113
129 Ga0070717_10841074 3300006028 Unclassified 835
130 Ga0070717_10962933 3300006028 Bacteria 777
131 Ga0070712_100470575 3300006175 Unclassified 1049
132 Ga0097621_100015235 3300006237 Bacteria 5779
133 Ga0097621_100029068 3300006237 Bacteria 4363
134 Ga0097621_100201250 3300006237 Bacteria 1729
135 Ga0097621_100337440 3300006237 Archaea 1338
136 Ga0097621_100911060 3300006237 Unclassified 819
137 Ga0097621_101046822 3300006237 Bacteria 765
138 Ga0097621_101218312 3300006237 Bacteria 709
139 Ga0097621_101315306 3300006237 Unclassified 683
140 Ga0068871_100011639 3300006358 Bacteria 6459
141 Ga0068871_100026768 3300006358 Bacteria 4503
142 Ga0068871_100185595 3300006358 Archaea 1789
143 Ga0068871_100197482 3300006358 Unclassified 1736
144 Ga0068871_100353211 3300006358 Bacteria 1301
145 Ga0068871_100519838 3300006358 Bacteria 1075
146 Ga0068871_100605282 3300006358 Bacteria 997
147 Ga0075431_100002512 3300006847 Bacteria 17688
148 Ga0075434_100834704 3300006871 Bacteria 937
149 Ga0068865_100057083 3300006881 Bacteria 2722
150 Ga0068865_100063642 3300006881 Bacteria 2594
151 Ga0068865_101066788 3300006881 Bacteria 710
152 Ga0068865_101878591 3300006881 Unclassified 542
153 Ga0068865_102054500 3300006881 Unclassified 519
154 Ga0097620_100027428 3300006931 Bacteria 5712
155 Ga0097620_100145440 3300006931 Bacteria 2445
156 Ga0097620_100526956 3300006931 Unclassified 1276
157 Ga0097620_101243522 3300006931 Unclassified 820
158 Ga0097620_101271477 3300006931 Bacteria 811
159 Ga0097620_101939982 3300006931 Bacteria 650
160 Ga0105250_10511649 3300009092 Bacteria 546
161 Ga0105240_10003870 3300009093 Bacteria 23121
162 Ga0105240_10010503 3300009093 Bacteria 13014
163 Ga0105240_10027576 3300009093 Bacteria 7435
164 Ga0105240_10052210 3300009093 Bacteria 5140
165 Ga0105240_10083955 3300009093 Bacteria 3907
166 Ga0105240_10196374 3300009093 Bacteria 2369
167 Ga0105240_10341100 3300009093 Bacteria 1702
168 Ga0105240_10590999 3300009093 Bacteria 1223
169 Ga0105240_10620795 3300009093 Bacteria 1188
170 Ga0105240_12205025 3300009093 Bacteria 571
171 Ga0105245_10003881 3300009098 Bacteria 13299
172 Ga0105245_10004978 3300009098 Bacteria 11682
173 Ga0105245_10030136 3300009098 Bacteria 4796
174 Ga0105245_10083978 3300009098 Unclassified 2916
175 Ga0105245_10239033 3300009098 Bacteria 1760
176 Ga0105245_10322605 3300009098 Unclassified 1522
177 Ga0105245_11299414 3300009098 Unclassified 776
178 Ga0105245_12039189 3300009098 Unclassified 627
179 Ga0105247_10732893 3300009101 Bacteria 747
180 Ga0105247_10799340 3300009101 Bacteria 719
181 Ga0105243_10579780 3300009148 Bacteria 1077
182 Ga0105243_10629477 3300009148 Bacteria 1037
183 Ga0105243_11370321 3300009148 Bacteria 727
184 Ga0105241_10002492 3300009174 Bacteria 13839
185 Ga0105241_10137159 3300009174 Unclassified 1988
186 Ga0105241_10404678 3300009174 Bacteria 1198
187 Ga0105241_10514868 3300009174 Bacteria 1069
188 Ga0105241_10765011 3300009174 Unclassified 887
189 Ga0105241_11545024 3300009174 Bacteria 640
190 Ga0105242_10010023 3300009176 Bacteria 7255
191 Ga0105242_10084466 3300009176 Bacteria 2660
192 Ga0105242_10090563 3300009176 Unclassified 2573
193 Ga0105242_10375259 3300009176 Bacteria 1320
194 Ga0105242_10510581 3300009176 Bacteria 1145
195 Ga0105242_10515963 3300009176 Bacteria 1139
196 Ga0105242_10845468 3300009176 Bacteria 910
197 Ga0105242_11059402 3300009176 Bacteria 822
198 Ga0105242_11427112 3300009176 Bacteria 720
199 Ga0105242_12768378 3300009176 Bacteria 541
200 Ga0105248_10018110 3300009177 Bacteria 7777
201 Ga0105248_10023469 3300009177 Bacteria 6852
202 Ga0105248_10061312 3300009177 Bacteria 4223
203 Ga0105248_10114265 3300009177 Bacteria 3045
204 Ga0105248_10636445 3300009177 Unclassified 1203
205 Ga0105248_11192244 3300009177 Bacteria 861
206 Ga0105248_11909055 3300009177 Unclassified 674
207 Ga0105248_12651213 3300009177 Bacteria 571
208 Ga0105237_10024427 3300009545 Bacteria 6182
209 Ga0105237_10054043 3300009545 Bacteria 4025
210 Ga0105237_10174413 3300009545 Bacteria 2150
211 Ga0105237_10832498 3300009545 Bacteria 929
212 Ga0105237_11477522 3300009545 Bacteria 686
213 Ga0105237_11619610 3300009545 Bacteria 654
214 Ga0105237_12175149 3300009545 Unclassified 564
215 Ga0105238_10008917 3300009551 Bacteria 10039
216 Ga0105238_10016712 3300009551 Bacteria 7435
217 Ga0105238_10025381 3300009551 Bacteria 6041
218 Ga0105238_10026524 3300009551 Bacteria 5908
219 Ga0105238_10089653 3300009551 Unclassified 3062
220 Ga0105238_10107885 3300009551 Bacteria 2765
221 Ga0105238_10332648 3300009551 Bacteria 1506
222 Ga0105238_11246701 3300009551 Unclassified 769
223 Ga0105249_10028818 3300009553 Bacteria 5012
224 Ga0105249_10287542 3300009553 Bacteria 1644
225 Ga0105249_10819880 3300009553 Unclassified 995
226 Ga0105249_11573700 3300009553 Unclassified 730
227 Ga0105239_10006055 3300010375 Bacteria 14080
228 Ga0105239_10019753 3300010375 Bacteria 7436
229 Ga0105239_10091500 3300010375 Bacteria 3357
230 Ga0105239_11351404 3300010375 Unclassified 822
231 Ga0105246_10009670 3300011119 Bacteria 5943
232 Ga0105246_10299447 3300011119 Bacteria 1298
233 Ga0105246_11139919 3300011119 Unclassified 714
234 Ga0105246_11737218 3300011119 Archaea 594
235 Ga0157373_10517935 3300013100 Bacteria 863
236 Ga0157370_10001341 3300013104 Bacteria 30545
237 Ga0157370_10009436 3300013104 Bacteria 10426
238 Ga0157370_10021566 3300013104 Bacteria 6418
239 Ga0157370_10993657 3300013104 Unclassified 760
240 Ga0157370_11165626 3300013104 Bacteria 696
241 Ga0157369_10007122 3300013105 Bacteria 12895
242 Ga0157369_10023682 3300013105 Bacteria 6838
243 Ga0157369_10089316 3300013105 Bacteria 3290
244 Ga0157374_10292627 3300013296 Bacteria 1610
245 Ga0157374_10500019 3300013296 Bacteria 1220
246 Ga0157374_11101472 3300013296 Viruses 815
247 Ga0157374_11143856 3300013296 Unclassified 799
248 Ga0157374_11206929 3300013296 Bacteria 778
249 Ga0157374_11576739 3300013296 Unclassified 680
250 Ga0157378_10509096 3300013297 Archaea 1204
251 Ga0157378_10661803 3300013297 Bacteria 1061
252 Ga0163162_10154092 3300013306 Bacteria 2417
253 Ga0163162_10158510 3300013306 Bacteria 2384
254 Ga0163162_10578578 3300013306 Bacteria 1250
255 Ga0163162_11281107 3300013306 Bacteria 832
256 Ga0163162_12946955 3300013306 Unclassified 547
257 Ga0157372_10010533 3300013307 Bacteria 9837
258 Ga0157372_10316516 3300013307 Bacteria 1817
259 Ga0157372_10590181 3300013307 Unclassified 1295
260 Ga0157372_11241732 3300013307 Unclassified 861
261 Ga0157372_11537859 3300013307 Bacteria 766
262 Ga0157375_10008109 3300013308 Bacteria 9191
263 Ga0157375_10615720 3300013308 Unclassified 1244
264 Ga0157375_11513848 3300013308 Unclassified 792
265 Ga0157375_12343138 3300013308 Bacteria 637
266 Ga0157375_12670088 3300013308 Unclassified 597
267 Ga0157375_12845779 3300013308 Bacteria 578
268 Ga0163163_10029227 3300014325 Bacteria 5301
269 Ga0163163_10235639 3300014325 Unclassified 1880
270 Ga0163163_10474372 3300014325 Unclassified 1312
271 Ga0163163_10919231 3300014325 Unclassified 938
272 Ga0157380_11528279 3300014326 Unclassified 721
273 Ga0157380_12849176 3300014326 Unclassified 550
274 Ga0157379_10039223 3300014968 Bacteria 4226
275 Ga0157379_10109053 3300014968 Bacteria 2486
276 Ga0157379_11581951 3300014968 Bacteria 640
277 Ga0157379_11754689 3300014968 Unclassified 609
278 Ga0157376_10147744 3300014969 Unclassified 2116
279 Ga0157376_10369617 3300014969 Bacteria 1378
280 Ga0157376_10457491 3300014969 Bacteria 1246
281 Ga0157376_11065804 3300014969 Bacteria 833
282 Ga0157376_11169784 3300014969 Unclassified 797
283 Ga0157376_11334009 3300014969 Unclassified 748
284 Ga0157376_11452333 3300014969 Bacteria 718
285 Ga0157376_12259284 3300014969 Bacteria 583
286 Ga0157376_12315753 3300014969 Unclassified 576
287 Ga0213876_10473410 3300021384 Unclassified 666
288 Ga0213875_10325466 3300021388 Unclassified 729
289 Ga0207656_10174965 3300025321 Unclassified 1028
290 Ga0207642_10116173 3300025899 Bacteria 1371
291 Ga0207642_10251009 3300025899 Bacteria 1004
292 Ga0207680_10329756 3300025903 Bacteria 1069
293 Ga0207699_10416266 3300025906 Bacteria 959
294 Ga0207699_10523621 3300025906 Bacteria 858
295 Ga0207645_10119948 3300025907 Unclassified 1707
296 Ga0207645_10505496 3300025907 Bacteria 818
297 Ga0207654_10002572 3300025911 Bacteria 9211
298 Ga0207654_10023078 3300025911 Bacteria 3329
299 Ga0207654_10245452 3300025911 Bacteria 1198
300 Ga0207654_10893132 3300025911 Bacteria 644
301 Ga0207707_10002413 3300025912 Bacteria 16808
302 Ga0207695_10003003 3300025913 Bacteria 24250
303 Ga0207695_10003666 3300025913 Bacteria 21419
304 Ga0207695_10031742 3300025913 Bacteria 5788
305 Ga0207695_10087451 3300025913 Bacteria 3139
306 Ga0207695_10443646 3300025913 Bacteria 1181
307 Ga0207695_10681209 3300025913 Unclassified 909
308 Ga0207695_11259396 3300025913 Unclassified 620
309 Ga0207695_11753020 3300025913 Bacteria 502
310 Ga0207671_10016255 3300025914 Bacteria 5789
311 Ga0207671_10433821 3300025914 Unclassified 1046
312 Ga0207663_11471102 3300025916 Bacteria 549
313 Ga0207660_10006741 3300025917 Bacteria 7436
314 Ga0207657_10069153 3300025919 Bacteria 2997
315 Ga0207657_10361457 3300025919 Unclassified 1144
316 Ga0207649_10251985 3300025920 Bacteria 1272
317 Ga0207652_10007211 3300025921 Bacteria 8969
318 Ga0207694_10001140 3300025924 Bacteria 23033
319 Ga0207694_10014490 3300025924 Bacteria 5944
320 Ga0207694_10033238 3300025924 Bacteria 3951
321 Ga0207694_10133369 3300025924 Unclassified 1992
322 Ga0207694_10436933 3300025924 Unclassified 1091
323 Ga0207694_10723215 3300025924 Unclassified 840
324 Ga0207650_11113870 3300025925 Bacteria 672
325 Ga0207659_11780957 3300025926 Unclassified 523
326 Ga0207687_10001618 3300025927 Bacteria 15513
327 Ga0207687_10004164 3300025927 Bacteria 9686
328 Ga0207687_10079039 3300025927 Unclassified 2370
329 Ga0207687_10103748 3300025927 Bacteria 2097
330 Ga0207687_10143448 3300025927 Bacteria 1814
331 Ga0207687_10158611 3300025927 Bacteria 1734
332 Ga0207687_11184702 3300025927 Bacteria 656
333 Ga0207700_10001426 3300025928 Bacteria 13542
334 Ga0207700_10073664 3300025928 Bacteria 2638
335 Ga0207700_10187819 3300025928 Bacteria 1735
336 Ga0207700_10989185 3300025928 Bacteria 753
337 Ga0207664_10109035 3300025929 Unclassified 2300
338 Ga0207644_10013017 3300025931 Bacteria 5536
339 Ga0207706_10089073 3300025933 Unclassified 2713
340 Ga0207686_10005228 3300025934 Bacteria 6969
341 Ga0207686_10027819 3300025934 Bacteria 3315
342 Ga0207686_10138239 3300025934 Bacteria 1680
343 Ga0207686_10459630 3300025934 Bacteria 981
344 Ga0207686_11217806 3300025934 Bacteria 617
345 Ga0207709_10924961 3300025935 Bacteria 710
346 Ga0207670_10282510 3300025936 Bacteria 1294
347 Ga0207670_11030223 3300025936 Bacteria 693
348 Ga0207669_10477747 3300025937 Bacteria 993
349 Ga0207704_10071640 3300025938 Bacteria 2200
350 Ga0207704_10101730 3300025938 Bacteria 1917
351 Ga0207704_11644444 3300025938 Unclassified 552
352 Ga0207691_10390052 3300025940 Bacteria 1188
353 Ga0207711_10001497 3300025941 Bacteria 21763
354 Ga0207711_10140324 3300025941 Bacteria 2174
355 Ga0207711_10184377 3300025941 Unclassified 1899
356 Ga0207711_10914893 3300025941 Bacteria 815
357 Ga0207711_10915945 3300025941 Unclassified 815
358 Ga0207689_11069811 3300025942 Bacteria 680
359 Ga0207661_10002033 3300025944 Bacteria 13949
360 Ga0207661_10019538 3300025944 Bacteria 5054
361 Ga0207661_10344501 3300025944 Bacteria 1343
362 Ga0207661_10830515 3300025944 Unclassified 851
363 Ga0207661_11090269 3300025944 Unclassified 735
364 Ga0207661_11212694 3300025944 Unclassified 694
365 Ga0207661_11858497 3300025944 Bacteria 548
366 Ga0207679_10812984 3300025945 Bacteria 852
367 Ga0207679_11029749 3300025945 Bacteria 755
368 Ga0207667_10003900 3300025949 Bacteria 18344
369 Ga0207667_10007597 3300025949 Bacteria 13003
370 Ga0207651_10877455 3300025960 Bacteria 798
371 Ga0207712_10018854 3300025961 Bacteria 4499
372 Ga0207712_10750989 3300025961 Unclassified 855
373 Ga0207712_10982677 3300025961 Bacteria 748
374 Ga0207640_10660257 3300025981 Unclassified 892
375 Ga0207658_11272531 3300025986 Bacteria 673
376 Ga0207658_11859687 3300025986 Bacteria 549
377 Ga0207677_10181296 3300026023 Bacteria 1657
378 Ga0207677_10300557 3300026023 Unclassified 1326
379 Ga0207677_10426984 3300026023 Unclassified 1130
380 Ga0207677_11384146 3300026023 Unclassified 648
381 Ga0207703_10002747 3300026035 Bacteria 15075
382 Ga0207703_10318925 3300026035 Bacteria 1423
383 Ga0207703_10824866 3300026035 Bacteria 886
384 Ga0207703_10949003 3300026035 Bacteria 824
385 Ga0207703_11138154 3300026035 Bacteria 750
386 Ga0207639_10036659 3300026041 Bacteria 3636
387 Ga0207639_10048845 3300026041 Bacteria 3205
388 Ga0207639_10671455 3300026041 Unclassified 960
389 Ga0207639_10949566 3300026041 Unclassified 804
390 Ga0207702_10018859 3300026078 Bacteria 5707
391 Ga0207702_10022844 3300026078 Bacteria 5189
392 Ga0207702_10185034 3300026078 Bacteria 1921
393 Ga0207702_11448905 3300026078 Unclassified 680
394 Ga0207702_11700750 3300026078 Bacteria 624
395 Ga0207641_10818446 3300026088 Unclassified 922
396 Ga0207648_10202954 3300026089 Bacteria 1759
397 Ga0207648_11400895 3300026089 Unclassified 657
398 Ga0207648_11432465 3300026089 Unclassified 649
399 Ga0207676_10488840 3300026095 Unclassified 1167
400 Ga0207676_11995360 3300026095 Unclassified 579
401 Ga0207674_10000300 3300026116 Bacteria 62723
402 Ga0207674_10002379 3300026116 Bacteria 23783
403 Ga0207674_10911198 3300026116 Bacteria 847
404 Ga0207698_10072225 3300026142 Bacteria 2742
405 Ga0207698_11422082 3300026142 Bacteria 709
406 Ga0268266_10206708 3300028379 Bacteria 1799
407 Ga0268266_11962408 3300028379 Unclassified 559
408 Ga0268264_10055308 3300028381 Bacteria 3316
409 Ga0268264_10378264 3300028381 Bacteria 1355
410 Ga0268264_12563544 3300028381 Unclassified 515
411 Ga0265338_10281528 3300028800 Bacteria 1215
412 Ga0265338_10411772 3300028800 Bacteria 962
413 Ga0265325_10077738 3300031241 Bacteria 1654
414 Ga0265325_10237697 3300031241 Bacteria 829
415 Ga0265340_10018852 3300031247 Bacteria 3556
416 Ga0265331_10233266 3300031250 Unclassified 826
417 Ga0265331_10504216 3300031250 Bacteria 545
418 Ga0265316_10011521 3300031344 Bacteria 7964
419 Ga0265313_10056102 3300031595 Bacteria 1863
420 Ga0265314_10002094 3300031711 Bacteria 21003
421 Ga0265314_10463125 3300031711 Bacteria 673
422 Ga0265342_10233930 3300031712 Bacteria 986
423 Ga0373926_0273313 3300035083 Unclassified 657
424 Ga0373934_0000593 3300035086 Bacteria 12788
425 Ga0373934_0008662 3300035086 Bacteria 3796
426 Ga0373940_0089370 3300035088 Bacteria 921
427 Ga0373923_0081737 3300035111 Bacteria 1402
428 Ga0373923_0081910 3300035111 Unclassified 1401
429 Ga0373923_0575699 3300035111 Unclassified 553
430 Ga0373953_0049137 3300035117 Unclassified 1701
431 Ga0373953_0115137 3300035117 Bacteria 1139
432 Ga0373953_0375032 3300035117 Unclassified 625
433 Ga0373954_0002654 3300035118 Bacteria 7525
434 Ga0373954_0005175 3300035118 Bacteria 5633
435 Ga0373954_0047780 3300035118 Bacteria 2004
436 Ga0373956_0041371 3300035119 Unclassified 2046
437 Ga0373956_0143868 3300035119 Bacteria 1120
438 Ga0373956_0157268 3300035119 Bacteria 1070
439 Ga0373956_0334748 3300035119 Bacteria 721
440 Ga0373957_0021796 3300035120 Bacteria 2278
441 Ga0373957_0218462 3300035120 Unclassified 797
442 Ga0373957_0286150 3300035120 Bacteria 697
443 Ga0373943_0004839 3300035170 Bacteria 6087
444 Ga0373946_0020333 3300035171 Bacteria 2565
445 Ga0373946_0372364 3300035171 Bacteria 717
446 Ga0373955_0013233 3300035172 Bacteria 3983
447 Ga0373955_0025591 3300035172 Bacteria 3033
448 Ga0373955_0043896 3300035172 Bacteria 2406
449 Ga0373955_0141247 3300035172 Bacteria 1412
450 Ga0373961_0301422 3300035241 Bacteria 593
451 Ga0373924_0250443 3300035410 Bacteria 784
452 Ga0373931_0672211 3300035691 Bacteria 682
453 Ga0373935_0359346 3300035692 Bacteria 1039
454 Ga0373927_0002053 3300035695 Bacteria 14853
455 Ga0373927_0076234 3300035695 Bacteria 2172
456 Ga0373927_0583468 3300035695 Unclassified 739
457 Ga0373927_0707226 3300035695 Unclassified 666
458 Ga0373927_0822356 3300035695 Bacteria 613
459 Ga0373927_0889444 3300035695 Unclassified 588
460 Ga0373933_0028567 3300035724 Bacteria 3219
461 Ga0373933_0034293 3300035724 Bacteria 2957
462 Ga0373933_0135407 3300035724 Bacteria 1552
463 Ga0373933_0329803 3300035724 Bacteria 990
464 Ga0373933_0496015 3300035724 Bacteria 800
465 Ga0373933_0586800 3300035724 Bacteria 732
466 Ga0373933_1041464 3300035724 Unclassified 539
467 Ga0373947_0388954 3300035725 Bacteria 939
468 Ga0373947_0605447 3300035725 Unclassified 747
469 Ga0373947_0633977 3300035725 Bacteria 729
470 Ga0373947_0960738 3300035725 Bacteria 583
471 Ga0373937_0013144 3300036401 Bacteria 7290
472 Ga0373937_0013794 3300036401 Bacteria 7121
473 Ga0373937_0033752 3300036401 Bacteria 4650
474 Ga0373937_0069874 3300036401 Bacteria 3238
475 Ga0373937_0335267 3300036401 Unclassified 1432
476 Ga0373937_0415962 3300036401 Unclassified 1276
477 Ga0373937_0522120 3300036401 Bacteria 1128
478 Ga0373937_0888920 3300036401 Bacteria 840
479 Ga0373937_1108141 3300036401 Unclassified 740
480 Ga0373937_1125740 3300036401 Bacteria 734
481 Ga0373925_0009106 3300037068 Bacteria 7225
482 Ga0373925_0080542 3300037068 Bacteria 2475
483 Ga0373925_0128274 3300037068 Bacteria 1975
484 Ga0373925_1309696 3300037068 Unclassified 594
485 Ga0395899_0422637 3300037312 Bacteria 878
486 Ga0395900_0627616 3300037418 Bacteria 1013
487 Ga0395898_0609929 3300037466 Bacteria 1034
488 Ga0436364_0427996 3300037853 Unclassified 1241
489 Ga0436364_0998116 3300037853 Bacteria 16565
490 Ga0436364_1301028 3300037853 Unclassified 1162
491 Ga0436365_1919844 3300039437 Bacteria 4388
492 Ga0451807_1889015 3300041486 Bacteria 711
493 Ga0466963_1210767 3300044694 Unclassified 530
494 Ga0466971_0212521 3300044719 Bacteria 915
495 Ga0466959_0136127 3300045049 Bacteria 1739
496 Ga0466959_0907137 3300045049 Bacteria 588
497 Ga0451576_0070512 3300045051 Bacteria 3638
498 Ga0451576_0564616 3300045051 Bacteria 1196
499 Ga0451576_0596920 3300045051 Unclassified 1160
500 Ga0451576_1023639 3300045051 Unclassified 865
501 Ga0451576_2200864 3300045051 Bacteria 566
502 Ga0466958_0205148 3300045836 Bacteria 1255
503 Ga0466967_2266286 3300045976 Unclassified 539
504 Ga0495592_0103667 3300046454 Bacteria 2023
505 Ga0495629_0524543 3300046459 Unclassified 797
506 Ga0495651_0038251 3300046462 Bacteria 3736
507 Ga0495651_0038407 3300046462 Bacteria 3728
508 Ga0495651_0141809 3300046462 Unclassified 1742
509 Ga0495651_0728589 3300046462 Unclassified 616
510 Ga0495653_0173846 3300046463 Bacteria 1484
511 Ga0495580_0004434 3300046472 Bacteria 11794
512 Ga0495580_0021508 3300046472 Bacteria 4758
513 Ga0495580_0034704 3300046472 Bacteria 3630
514 Ga0495580_0055520 3300046472 Unclassified 2791
515 Ga0495580_0183736 3300046472 Bacteria 1443
516 Ga0495580_0309620 3300046472 Bacteria 1074
517 Ga0495580_0319339 3300046472 Bacteria 1056
518 Ga0495580_0838780 3300046472 Unclassified 594
519 Ga0495582_0056650 3300046473 Bacteria 2160
520 Ga0495582_0315743 3300046473 Unclassified 899
521 Ga0495582_0599680 3300046473 Bacteria 637
522 Ga0495639_0412778 3300046475 Unclassified 683
523 Ga0495639_0424142 3300046475 Unclassified 674
524 Ga0495662_0088750 3300046476 Bacteria 1506
525 Ga0495664_0002552 3300046477 Bacteria 9792
526 Ga0495664_0284274 3300046477 Bacteria 999
527 Ga0495594_0083946 3300046499 Bacteria 1781
528 Ga0495608_0060792 3300046511 Bacteria 2486
529 Ga0495608_0664261 3300046511 Bacteria 622
530 Ga0495608_0844791 3300046511 Bacteria 538
531 Ga0495618_0213644 3300046514 Bacteria 1219
532 Ga0495628_0119419 3300046516 Bacteria 2023
533 Ga0495628_0301970 3300046516 Bacteria 1185
534 Ga0495628_0455094 3300046516 Unclassified 929
535 Ga0495628_0932289 3300046516 Bacteria 601
536 Ga0495630_0054348 3300046517 Bacteria 3000
537 Ga0495630_0115696 3300046517 Bacteria 2032
538 Ga0495666_0188398 3300046526 Unclassified 951
539 Ga0495652_0015778 3300046529 Bacteria 6762
540 Ga0495652_0081207 3300046529 Bacteria 2675
541 Ga0495652_0432084 3300046529 Unclassified 926
542 Ga0495665_0155696 3300046531 Bacteria 1192
543 Ga0495665_0505447 3300046531 Unclassified 609
544 Ga0495640_0098796 3300046533 Bacteria 1918
545 Ga0495640_0601490 3300046533 Bacteria 664
546 Ga0495640_0822335 3300046533 Unclassified 553
547 Ga0495586_0189219 3300046535 Bacteria 1166
548 Ga0495586_0317621 3300046535 Bacteria 893
549 Ga0495586_0590331 3300046535 Bacteria 642
550 Ga0495587_0063820 3300046536 Bacteria 2153
551 Ga0495587_0087280 3300046536 Bacteria 1805
552 Ga0495587_0089389 3300046536 Bacteria 1780
553 Ga0495587_0253134 3300046536 Unclassified 990
554 Ga0495587_0352128 3300046536 Bacteria 821
555 Ga0495587_0453024 3300046536 Unclassified 711
556 Ga0495645_0010566 3300046543 Bacteria 6479
557 Ga0495645_0021394 3300046543 Bacteria 4675
558 Ga0495645_0035507 3300046543 Bacteria 3634
559 Ga0495645_0066864 3300046543 Unclassified 2596
560 Ga0495645_0341636 3300046543 Bacteria 967
561 Ga0495645_0660257 3300046543 Unclassified 638
562 Ga0495645_0692388 3300046543 Unclassified 619
563 Ga0495667_0052338 3300046559 Bacteria 2690
564 Ga0495667_0054850 3300046559 Bacteria 2622
565 Ga0495667_0228164 3300046559 Bacteria 1187
566 Ga0495667_0348296 3300046559 Unclassified 936
567 Ga0495667_0377310 3300046559 Unclassified 894
568 Ga0495667_0846018 3300046559 Bacteria 563
569 Ga0495634_0100680 3300046642 Bacteria 1867
570 Ga0495635_0179125 3300046663 Bacteria 1441
571 Ga0495635_0989214 3300046663 Unclassified 536
572 Ga0495588_0371599 3300046674 Bacteria 751
573 Ga0495657_0181226 3300046675 Bacteria 1293
574 Ga0495657_0763942 3300046675 Bacteria 554
575 Ga0495599_0002944 3300046678 Bacteria 9901
576 Ga0495599_0041869 3300046678 Bacteria 2875
577 Ga0495599_0069354 3300046678 Unclassified 2200
578 Ga0495599_0276718 3300046678 Bacteria 1017
579 Ga0495599_0402035 3300046678 Unclassified 816
580 Ga0495599_0435012 3300046678 Unclassified 778
581 Ga0495623_0077659 3300046679 Bacteria 2058
582 Ga0495623_0153177 3300046679 Bacteria 1361
583 Ga0495623_0167740 3300046679 Bacteria 1285
584 Ga0495623_0184520 3300046679 Bacteria 1209
585 Ga0495623_0265205 3300046679 Bacteria 961
586 Ga0495623_0356940 3300046679 Unclassified 795
587 Ga0495646_0015014 3300046680 Bacteria 4919
588 Ga0495646_0600178 3300046680 Unclassified 559
589 Ga0495613_0109394 3300046689 Bacteria 1993
590 Ga0495613_0288216 3300046689 Unclassified 1139
591 Ga0495624_0619751 3300046690 Unclassified 644
592 Ga0495600_0150840 3300046809 Bacteria 1505
593 Ga0495600_0300293 3300046809 Unclassified 1013
594 Ga0495604_0068721 3300047317 Bacteria 2688
595 Ga0495604_0356168 3300047317 Unclassified 971
596 Ga0495604_1036058 3300047317 Bacteria 506
597 Ga0495674_0014673 3300047319 Bacteria 7331
598 Ga0495674_0090870 3300047319 Bacteria 2608
599 Ga0495674_0129028 3300047319 Bacteria 2131
600 Ga0495674_0254111 3300047319 Bacteria 1446
601 Ga0495674_0689391 3300047319 Bacteria 803
602 Ga0495674_0775361 3300047319 Unclassified 747
603 Ga0495674_0793335 3300047319 Bacteria 737
604 Ga0495680_0048536 3300047322 Bacteria 3333
605 Ga0495680_0398818 3300047322 Unclassified 950
606 Ga0495675_0017626 3300047444 Bacteria 4528
607 Ga0495675_0184983 3300047444 Bacteria 1274
608 Ga0495675_0201953 3300047444 Bacteria 1210
609 Ga0495675_0321929 3300047444 Bacteria 914
610 Ga0495677_0415099 3300047445 Bacteria 533
611 Ga0495684_0004174 3300047471 Bacteria 11280
612 Ga0495684_0004482 3300047471 Bacteria 10910
613 Ga0495684_0160909 3300047471 Bacteria 1674
614 Ga0495684_0176220 3300047471 Bacteria 1587
615 Ga0495684_0185886 3300047471 Bacteria 1538
616 Ga0495684_0286722 3300047471 Bacteria 1186
617 Ga0495684_0512369 3300047471 Bacteria 823
618 Ga0495684_0622303 3300047471 Unclassified 726
619 Ga0495684_0930771 3300047471 Unclassified 557
620 Ga0495593_0246976 3300047673 Unclassified 894
621 Ga0495602_0019321 3300048088 Bacteria 6769
622 Ga0495602_0094336 3300048088 Bacteria 2473
623 Ga0495602_0155955 3300048088 Bacteria 1788
624 Ga0495602_0336489 3300048088 Unclassified 1093
625 Ga0495602_0357629 3300048088 Bacteria 1052
626 Ga0496104_0015651 3300048907 Bacteria 6878
627 Ga0496106_0900336 3300048909 Unclassified 699
628 Ga0496108_0809983 3300048911 Unclassified 808
629 Ga0496110_1806671 3300048913 Bacteria 521
630 Ga0496112_0145535 3300048915 Unclassified 2338
631 Ga0496112_0165719 3300048915 Unclassified 2176
632 nmdc:mga06r32_133004_c1 3300050510 Unclassified 2461
633 nmdc:mga0n895_761281_c1 3300050512 Bacteria 961
634 Ga0495601_0139198 3300053077 Bacteria 1583
635 Ga0495601_0568805 3300053077 Bacteria 728
636 Ga0495619_0657688 3300053085 Bacteria 714
637 Ga0587111_0089888 3300060346 Unclassified 748
638 Ga0265314_10151664
639 Ga0070658_10742741
640 Ga0070658_10864183
641 Ga0070676_10941466
642 Ga0070676_11464178
643 Ga0070683_100000497
644 Ga0070683_100100401
645 Ga0070683_100172677
646 Ga0070683_100358292
647 Ga0070683_101083319
648 Ga0070683_101474208
649 Ga0070683_101657070
650 Ga0070690_101529916
651 Ga0070670_100893401
652 Ga0070670_101320430
653 Ga0068869_100980979
654 Ga0070666_10323448
655 Ga0070666_10710801
656 Ga0070666_10869472
657 Ga0070680_100003800
658 Ga0070682_100061009
659 Ga0070682_101729898
660 Ga0068868_100074348
661 Ga0068868_100122075
662 Ga0068868_100729074
663 Ga0070660_100059129
664 Ga0070660_100427750
665 Ga0070660_100901746
666 Ga0070689_100162242
667 Ga0070689_101004883
668 Ga0070691_10001259
669 Ga0070687_101266598
670 Ga0070661_100039205
671 Ga0070692_11412092
672 Ga0070671_100208533
673 Ga0070674_101906446
674 Ga0070673_100081542
675 Ga0070688_100060318
676 Ga0070667_101419831
677 Ga0070709_10180816
678 Ga0070709_10197378
679 Ga0070714_100032417
680 Ga0070714_100135373
681 Ga0070713_100022680
682 Ga0070713_100334447
683 Ga0070713_101708355
684 Ga0070710_10742643
685 Ga0070711_100056027
686 Ga0070711_101497112
687 Ga0070662_100039883
688 Ga0070681_10007276
689 Ga0070681_10208431
690 Ga0070681_11762657
691 Ga0068867_101191933
692 Ga0070707_101155601
693 Ga0070698_100872766
694 Ga0070679_100001789
695 Ga0070679_100404890
696 Ga0070679_100957199
697 Ga0070684_100002783
698 Ga0070684_100179844
699 Ga0070684_100307615
700 Ga0070684_100866838
701 Ga0070697_100316313
702 Ga0068853_100200237
703 Ga0068853_100481261
704 Ga0070686_100335649
705 Ga0070686_100349292
706 Ga0070686_100913855
707 Ga0070686_100955136
708 Ga0070695_100104208
709 Ga0070696_100557007
710 Ga0070693_100061059
711 Ga0070693_100242164
712 Ga0070665_101720413
713 Ga0070665_101779905
714 Ga0068855_100004869
715 Ga0068855_100023679
716 Ga0068855_100026535
717 Ga0068855_100360759
718 Ga0070664_100282152
719 Ga0068857_100001612
720 Ga0068857_100009382
721 Ga0068857_100676920
722 Ga0068857_101146378
723 Ga0068854_102005828
724 Ga0068856_100012289
725 Ga0068856_100019017
726 Ga0068856_100728386
727 Ga0068856_100774912
728 Ga0068856_101220833
729 Ga0070702_100094529
730 Ga0068852_100004525
731 Ga0068852_100168015
732 Ga0068852_100292318
733 Ga0068859_100027428
734 Ga0068859_100145442
735 Ga0068859_100526900
736 Ga0068859_101243976
737 Ga0068859_101271773
738 Ga0068859_101940320
739 Ga0068864_100318632
740 Ga0068864_100333418
741 Ga0068864_100435805
742 Ga0068864_101445179
743 Ga0068866_10324807
744 Ga0068866_10776610
745 Ga0068851_10195082
746 Ga0068870_10038276
747 Ga0068863_100044516
748 Ga0068863_100160229
749 Ga0068863_100442137
750 Ga0068863_101320735
751 Ga0068863_101636479
752 Ga0068863_101870258
753 Ga0068858_100009783
754 Ga0068858_100108173
755 Ga0068858_100192373
756 Ga0068858_100279010
757 Ga0068858_100571508
758 Ga0068858_100665248
759 Ga0068858_100919776
760 Ga0068860_100129395
761 Ga0068860_100487708
762 Ga0068860_101680370
763 Ga0070717_10040840
764 Ga0070717_10150053
765 Ga0070717_10487923
766 Ga0070717_10841074
767 Ga0070717_10962933
768 Ga0070712_100470575
769 Ga0097621_100015235
770 Ga0097621_100029068
771 Ga0097621_100201250
772 Ga0097621_100337440
773 Ga0097621_100911060
774 Ga0097621_101046822
775 Ga0097621_101218312
776 Ga0097621_101315306
777 Ga0068871_100011639
778 Ga0068871_100026768
779 Ga0068871_100185595
780 Ga0068871_100197482
781 Ga0068871_100353211
782 Ga0068871_100519838
783 Ga0068871_100605282
784 Ga0075431_100002512
785 Ga0075434_100834704
786 Ga0068865_100057083
787 Ga0068865_100063642
788 Ga0068865_101066788
789 Ga0068865_101878591
790 Ga0068865_102054500
791 Ga0097620_100027428
792 Ga0097620_100145440
793 Ga0097620_100526956
794 Ga0097620_101243522
795 Ga0097620_101271477
796 Ga0097620_101939982
797 Ga0105250_10511649
798 Ga0105240_10003870
799 Ga0105240_10010503
800 Ga0105240_10027576
801 Ga0105240_10052210
802 Ga0105240_10083955
803 Ga0105240_10196374
804 Ga0105240_10341100
805 Ga0105240_10590999
806 Ga0105240_10620795
807 Ga0105240_12205025
808 Ga0105245_10003881
809 Ga0105245_10004978
810 Ga0105245_10030136
811 Ga0105245_10083978
812 Ga0105245_10239033
813 Ga0105245_10322605
814 Ga0105245_11299414
815 Ga0105245_12039189
816 Ga0105247_10732893
817 Ga0105247_10799340
818 Ga0105243_10579780
819 Ga0105243_10629477
820 Ga0105243_11370321
821 Ga0105241_10002492
822 Ga0105241_10137159
823 Ga0105241_10404678
824 Ga0105241_10514868
825 Ga0105241_10765011
826 Ga0105241_11545024
827 Ga0105242_10010023
828 Ga0105242_10084466
829 Ga0105242_10090563
830 Ga0105242_10375259
831 Ga0105242_10510581
832 Ga0105242_10515963
833 Ga0105242_10845468
834 Ga0105242_11059402
835 Ga0105242_11427112
836 Ga0105242_12768378
837 Ga0105248_10018110
838 Ga0105248_10023469
839 Ga0105248_10061312
840 Ga0105248_10114265
841 Ga0105248_10636445
842 Ga0105248_11192244
843 Ga0105248_11909055
844 Ga0105248_12651213
845 Ga0105237_10024427
846 Ga0105237_10054043
847 Ga0105237_10174413
848 Ga0105237_10832498
849 Ga0105237_11477522
850 Ga0105237_11619610
851 Ga0105237_12175149
852 Ga0105238_10008917
853 Ga0105238_10016712
854 Ga0105238_10025381
855 Ga0105238_10026524
856 Ga0105238_10089653
857 Ga0105238_10107885
858 Ga0105238_10332648
859 Ga0105238_11246701
860 Ga0105249_10028818
861 Ga0105249_10287542
862 Ga0105249_10819880
863 Ga0105249_11573700
864 Ga0105239_10006055
865 Ga0105239_10019753
866 Ga0105239_10091500
867 Ga0105239_11351404
868 Ga0105246_10009670
869 Ga0105246_10299447
870 Ga0105246_11139919
871 Ga0105246_11737218
872 Ga0157373_10517935
873 Ga0157370_10001341
874 Ga0157370_10009436
875 Ga0157370_10021566
876 Ga0157370_10993657
877 Ga0157370_11165626
878 Ga0157369_10007122
879 Ga0157369_10023682
880 Ga0157369_10089316
881 Ga0157374_10292627
882 Ga0157374_10500019
883 Ga0157374_11101472
884 Ga0157374_11143856
885 Ga0157374_11206929
886 Ga0157374_11576739
887 Ga0157378_10509096
888 Ga0157378_10661803
889 Ga0163162_10154092
890 Ga0163162_10158510
891 Ga0163162_10578578
892 Ga0163162_11281107
893 Ga0163162_12946955
894 Ga0157372_10010533
895 Ga0157372_10316516
896 Ga0157372_10590181
897 Ga0157372_11241732
898 Ga0157372_11537859
899 Ga0157375_10008109
900 Ga0157375_10615720
901 Ga0157375_11513848
902 Ga0157375_12343138
903 Ga0157375_12670088
904 Ga0157375_12845779
905 Ga0163163_10029227
906 Ga0163163_10235639
907 Ga0163163_10474372
908 Ga0163163_10919231
909 Ga0157380_11528279
910 Ga0157380_12849176
911 Ga0157379_10039223
912 Ga0157379_10109053
913 Ga0157379_11581951
914 Ga0157379_11754689
915 Ga0157376_10147744
916 Ga0157376_10369617
917 Ga0157376_10457491
918 Ga0157376_11065804
919 Ga0157376_11169784
920 Ga0157376_11334009
921 Ga0157376_11452333
922 Ga0157376_12259284
923 Ga0157376_12315753
924 Ga0213876_10473410
925 Ga0213875_10325466
926 Ga0207656_10174965
927 Ga0207642_10116173
928 Ga0207642_10251009
929 Ga0207680_10329756
930 Ga0207699_10416266
931 Ga0207699_10523621
932 Ga0207645_10119948
933 Ga0207645_10505496
934 Ga0207654_10002572
935 Ga0207654_10023078
936 Ga0207654_10245452
937 Ga0207654_10893132
938 Ga0207707_10002413
939 Ga0207695_10003003
940 Ga0207695_10003666
941 Ga0207695_10031742
942 Ga0207695_10087451
943 Ga0207695_10443646
944 Ga0207695_10681209
945 Ga0207695_11259396
946 Ga0207695_11753020
947 Ga0207671_10016255
948 Ga0207671_10433821
949 Ga0207663_11471102
950 Ga0207660_10006741
951 Ga0207657_10069153
952 Ga0207657_10361457
953 Ga0207649_10251985
954 Ga0207652_10007211
955 Ga0207694_10001140
956 Ga0207694_10014490
957 Ga0207694_10033238
958 Ga0207694_10133369
959 Ga0207694_10436933
960 Ga0207694_10723215
961 Ga0207650_11113870
962 Ga0207659_11780957
963 Ga0207687_10001618
964 Ga0207687_10004164
965 Ga0207687_10079039
966 Ga0207687_10103748
967 Ga0207687_10143448
968 Ga0207687_10158611
969 Ga0207687_11184702
970 Ga0207700_10001426
971 Ga0207700_10073664
972 Ga0207700_10187819
973 Ga0207700_10989185
974 Ga0207664_10109035
975 Ga0207644_10013017
976 Ga0207706_10089073
977 Ga0207686_10005228
978 Ga0207686_10027819
979 Ga0207686_10138239
980 Ga0207686_10459630
981 Ga0207686_11217806
982 Ga0207709_10924961
983 Ga0207670_10282510
984 Ga0207670_11030223
985 Ga0207669_10477747
986 Ga0207704_10071640
987 Ga0207704_10101730
988 Ga0207704_11644444
989 Ga0207691_10390052
990 Ga0207711_10001497
991 Ga0207711_10140324
992 Ga0207711_10184377
993 Ga0207711_10914893
994 Ga0207711_10915945
995 Ga0207689_11069811
996 Ga0207661_10002033
997 Ga0207661_10019538
998 Ga0207661_10344501
999 Ga0207661_10830515
1000 Ga0207661_11090269
1001 Ga0207661_11212694
1002 Ga0207661_11858497
1003 Ga0207679_10812984
1004 Ga0207679_11029749
1005 Ga0207667_10003900
1006 Ga0207667_10007597
1007 Ga0207651_10877455
1008 Ga0207712_10018854
1009 Ga0207712_10750989
1010 Ga0207712_10982677
1011 Ga0207640_10660257
1012 Ga0207658_11272531
1013 Ga0207658_11859687
1014 Ga0207677_10181296
1015 Ga0207677_10300557
1016 Ga0207677_10426984
1017 Ga0207677_11384146
1018 Ga0207703_10002747
1019 Ga0207703_10318925
1020 Ga0207703_10824866
1021 Ga0207703_10949003
1022 Ga0207703_11138154
1023 Ga0207639_10036659
1024 Ga0207639_10048845
1025 Ga0207639_10671455
1026 Ga0207639_10949566
1027 Ga0207702_10018859
1028 Ga0207702_10022844
1029 Ga0207702_10185034
1030 Ga0207702_11448905
1031 Ga0207702_11700750
1032 Ga0207641_10818446
1033 Ga0207648_10202954
1034 Ga0207648_11400895
1035 Ga0207648_11432465
1036 Ga0207676_10488840
1037 Ga0207676_11995360
1038 Ga0207674_10000300
1039 Ga0207674_10002379
1040 Ga0207674_10911198
1041 Ga0207698_10072225
1042 Ga0207698_11422082
1043 Ga0268266_10206708
1044 Ga0268266_11962408
1045 Ga0268264_10055308
1046 Ga0268264_10378264
1047 Ga0268264_12563544
1048 Ga0265338_10281528
1049 Ga0265338_10411772
1050 Ga0265325_10077738
1051 Ga0265325_10237697
1052 Ga0265340_10018852
1053 Ga0265331_10233266
1054 Ga0265331_10504216
1055 Ga0265316_10011521
1056 Ga0265313_10056102
1057 Ga0265314_10002094
1058 Ga0265314_10463125
1059 Ga0265342_10233930
1060 Ga0373926_0273313
1061 Ga0373934_0000593
1062 Ga0373934_0008662
1063 Ga0373940_0089370
1064 Ga0373923_0081737
1065 Ga0373923_0081910
1066 Ga0373923_0575699
1067 Ga0373953_0049137
1068 Ga0373953_0115137
1069 Ga0373953_0375032
1070 Ga0373954_0002654
1071 Ga0373954_0005175
1072 Ga0373954_0047780
1073 Ga0373956_0041371
1074 Ga0373956_0143868
1075 Ga0373956_0157268
1076 Ga0373956_0334748
1077 Ga0373957_0021796
1078 Ga0373957_0218462
1079 Ga0373957_0286150
1080 Ga0373943_0004839
1081 Ga0373946_0020333
1082 Ga0373946_0372364
1083 Ga0373955_0013233
1084 Ga0373955_0025591
1085 Ga0373955_0043896
1086 Ga0373955_0141247
1087 Ga0373961_0301422
1088 Ga0373924_0250443
1089 Ga0373931_0672211
1090 Ga0373935_0359346
1091 Ga0373927_0002053
1092 Ga0373927_0076234
1093 Ga0373927_0583468
1094 Ga0373927_0707226
1095 Ga0373927_0822356
1096 Ga0373927_0889444
1097 Ga0373933_0028567
1098 Ga0373933_0034293
1099 Ga0373933_0135407
1100 Ga0373933_0329803
1101 Ga0373933_0496015
1102 Ga0373933_0586800
1103 Ga0373933_1041464
1104 Ga0373947_0388954
1105 Ga0373947_0605447
1106 Ga0373947_0633977
1107 Ga0373947_0960738
1108 Ga0373937_0013144
1109 Ga0373937_0013794
1110 Ga0373937_0033752
1111 Ga0373937_0069874
1112 Ga0373937_0335267
1113 Ga0373937_0415962
1114 Ga0373937_0522120
1115 Ga0373937_0888920
1116 Ga0373937_1108141
1117 Ga0373937_1125740
1118 Ga0373925_0009106
1119 Ga0373925_0080542
1120 Ga0373925_0128274
1121 Ga0373925_1309696
1122 Ga0395899_0422637
1123 Ga0395900_0627616
1124 Ga0395898_0609929
1125 Ga0436364_0427996
1126 Ga0436364_0998116
1127 Ga0436364_1301028
1128 Ga0436365_1919844
1129 Ga0451807_1889015
1130 Ga0466963_1210767
1131 Ga0466971_0212521
1132 Ga0466959_0136127
1133 Ga0466959_0907137
1134 Ga0451576_0070512
1135 Ga0451576_0564616
1136 Ga0451576_0596920
1137 Ga0451576_1023639
1138 Ga0451576_2200864
1139 Ga0466958_0205148
1140 Ga0466967_2266286
1141 Ga0495592_0103667
1142 Ga0495629_0524543
1143 Ga0495651_0038251
1144 Ga0495651_0038407
1145 Ga0495651_0141809
1146 Ga0495651_0728589
1147 Ga0495653_0173846
1148 Ga0495580_0004434
1149 Ga0495580_0021508
1150 Ga0495580_0034704
1151 Ga0495580_0055520
1152 Ga0495580_0183736
1153 Ga0495580_0309620
1154 Ga0495580_0319339
1155 Ga0495580_0838780
1156 Ga0495582_0056650
1157 Ga0495582_0315743
1158 Ga0495582_0599680
1159 Ga0495639_0412778
1160 Ga0495639_0424142
1161 Ga0495662_0088750
1162 Ga0495664_0002552
1163 Ga0495664_0284274
1164 Ga0495594_0083946
1165 Ga0495608_0060792
1166 Ga0495608_0664261
1167 Ga0495608_0844791
1168 Ga0495618_0213644
1169 Ga0495628_0119419
1170 Ga0495628_0301970
1171 Ga0495628_0455094
1172 Ga0495628_0932289
1173 Ga0495630_0054348
1174 Ga0495630_0115696
1175 Ga0495666_0188398
1176 Ga0495652_0015778
1177 Ga0495652_0081207
1178 Ga0495652_0432084
1179 Ga0495665_0155696
1180 Ga0495665_0505447
1181 Ga0495640_0098796
1182 Ga0495640_0601490
1183 Ga0495640_0822335
1184 Ga0495586_0189219
1185 Ga0495586_0317621
1186 Ga0495586_0590331
1187 Ga0495587_0063820
1188 Ga0495587_0087280
1189 Ga0495587_0089389
1190 Ga0495587_0253134
1191 Ga0495587_0352128
1192 Ga0495587_0453024
1193 Ga0495645_0010566
1194 Ga0495645_0021394
1195 Ga0495645_0035507
1196 Ga0495645_0066864
1197 Ga0495645_0341636
1198 Ga0495645_0660257
1199 Ga0495645_0692388
1200 Ga0495667_0052338
1201 Ga0495667_0054850
1202 Ga0495667_0228164
1203 Ga0495667_0348296
1204 Ga0495667_0377310
1205 Ga0495667_0846018
1206 Ga0495634_0100680
1207 Ga0495635_0179125
1208 Ga0495635_0989214
1209 Ga0495588_0371599
1210 Ga0495657_0181226
1211 Ga0495657_0763942
1212 Ga0495599_0002944
1213 Ga0495599_0041869
1214 Ga0495599_0069354
1215 Ga0495599_0276718
1216 Ga0495599_0402035
1217 Ga0495599_0435012
1218 Ga0495623_0077659
1219 Ga0495623_0153177
1220 Ga0495623_0167740
1221 Ga0495623_0184520
1222 Ga0495623_0265205
1223 Ga0495623_0356940
1224 Ga0495646_0015014
1225 Ga0495646_0600178
1226 Ga0495613_0109394
1227 Ga0495613_0288216
1228 Ga0495624_0619751
1229 Ga0495600_0150840
1230 Ga0495600_0300293
1231 Ga0495604_0068721
1232 Ga0495604_0356168
1233 Ga0495604_1036058
1234 Ga0495674_0014673
1235 Ga0495674_0090870
1236 Ga0495674_0129028
1237 Ga0495674_0254111
1238 Ga0495674_0689391
1239 Ga0495674_0775361
1240 Ga0495674_0793335
1241 Ga0495680_0048536
1242 Ga0495680_0398818
1243 Ga0495675_0017626
1244 Ga0495675_0184983
1245 Ga0495675_0201953
1246 Ga0495675_0321929
1247 Ga0495677_0415099
1248 Ga0495684_0004174
1249 Ga0495684_0004482
1250 Ga0495684_0160909
1251 Ga0495684_0176220
1252 Ga0495684_0185886
1253 Ga0495684_0286722
1254 Ga0495684_0512369
1255 Ga0495684_0622303
1256 Ga0495684_0930771
1257 Ga0495593_0246976
1258 Ga0495602_0019321
1259 Ga0495602_0094336
1260 Ga0495602_0155955
1261 Ga0495602_0336489
1262 Ga0495602_0357629
1263 Ga0496104_0015651
1264 Ga0496106_0900336
1265 Ga0496108_0809983
1266 Ga0496110_1806671
1267 Ga0496112_0145535
1268 Ga0496112_0165719
1269 nmdc:mga06r32_133004_c1
1270 nmdc:mga0n895_761281_c1
1271 Ga0495601_0139198
1272 Ga0495601_0568805
1273 Ga0495619_0657688
1274 Ga0587111_0089888

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23544

17

116

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t5j-assembly1.cif.gz_A crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella philomiragia 0.7075 5 28
8pii-assembly1.cif.gz_A vhh z70 mutant 3 in interaction with phf6 tau peptide 0.6532 49 73
6ca9-assembly2.cif.gz_D crystal structure of fab pct64_lmca (sar), the least mutated common ancestor of the hiv-1 broadly neutralizing antibody lineage pct64 0.5915 8 73
2v7n-assembly4.cif.gz_H unusual twinning in crystals of the cits binding antibody fab fragment f3p4 0.5906 8 73
2qr0-assembly1.cif.gz_B structure of vegf complexed to a fab containing tyr and ser in the cdrs 0.5895 8 73
ID Description Score Start End Superfamily
af_Q6P6T3_123_233_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8288 8 25 2.60.40.10
af_Q5RHK5_4_99_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8034 5 72 2.30.29.30
6gq8B00 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.7531 8 28 2.60.40.730
af_Q4TT88_528_617_2.60.40.1910 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7409 9 28 2.60.40.1910
af_I1MLI4_98_386_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7399 9 27 2.120.10.80
ID Description Score Start End GO Terms
AF-A0A351ZU22-F1-model_v4 Uncharacterized protein 0.973 1 71
AF-A0A351ZU22-F1-model_v4 Uncharacterized protein 0.9599 1 71
AF-A0A7J4GQY5-F1-model_v4 Terpene utilization protein AtuA 0.9592 3 69
AF-A0A3D3RUI2-F1-model_v4 deleted 0.9507 3 79
AF-A0A5C6XVF3-F1-model_v4 deleted 0.945 1 76

Map