F471440
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 637 | 228 | 1274 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300031711|Ga0265314_10151664|Ga0265314_101516642 |
| Length | 117 |
| Sequence | MQVPHVSECSYEAHVKVPLSQIAHTRSGDKGDTCNIGVIALDPRDYPVLVREVTAERVRRHFGDLVKGPVERYELPNLGALNFLLHQALGGGGTVSLRTDAQGKTFGAALLALEIEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 142 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 143 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 148 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 160 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 173 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 174 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.84 |
| Metatranscriptomes | 0.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.1 |
| Rhizosphere | 97.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 28.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265314_10151664 | 3300031711 | Bacteria | 1420 |
| 2 | Ga0070658_10742741 | 3300005327 | Bacteria | 852 |
| 3 | Ga0070658_10864183 | 3300005327 | Bacteria | 786 |
| 4 | Ga0070676_10941466 | 3300005328 | Unclassified | 645 |
| 5 | Ga0070676_11464178 | 3300005328 | Unclassified | 525 |
| 6 | Ga0070683_100000497 | 3300005329 | Bacteria | 27743 |
| 7 | Ga0070683_100100401 | 3300005329 | Bacteria | 2724 |
| 8 | Ga0070683_100172677 | 3300005329 | Unclassified | 2052 |
| 9 | Ga0070683_100358292 | 3300005329 | Bacteria | 1389 |
| 10 | Ga0070683_101083319 | 3300005329 | Unclassified | 770 |
| 11 | Ga0070683_101474208 | 3300005329 | Unclassified | 654 |
| 12 | Ga0070683_101657070 | 3300005329 | Unclassified | 615 |
| 13 | Ga0070690_101529916 | 3300005330 | Bacteria | 539 |
| 14 | Ga0070670_100893401 | 3300005331 | Bacteria | 805 |
| 15 | Ga0070670_101320430 | 3300005331 | Unclassified | 660 |
| 16 | Ga0068869_100980979 | 3300005334 | Bacteria | 735 |
| 17 | Ga0070666_10323448 | 3300005335 | Bacteria | 1100 |
| 18 | Ga0070666_10710801 | 3300005335 | Bacteria | 737 |
| 19 | Ga0070666_10869472 | 3300005335 | Bacteria | 666 |
| 20 | Ga0070680_100003800 | 3300005336 | Bacteria | 11292 |
| 21 | Ga0070682_100061009 | 3300005337 | Bacteria | 2386 |
| 22 | Ga0070682_101729898 | 3300005337 | Bacteria | 544 |
| 23 | Ga0068868_100074348 | 3300005338 | Bacteria | 2714 |
| 24 | Ga0068868_100122075 | 3300005338 | Unclassified | 2126 |
| 25 | Ga0068868_100729074 | 3300005338 | Unclassified | 889 |
| 26 | Ga0070660_100059129 | 3300005339 | Bacteria | 2972 |
| 27 | Ga0070660_100427750 | 3300005339 | Bacteria | 1097 |
| 28 | Ga0070660_100901746 | 3300005339 | Bacteria | 745 |
| 29 | Ga0070689_100162242 | 3300005340 | Bacteria | 1807 |
| 30 | Ga0070689_101004883 | 3300005340 | Bacteria | 742 |
| 31 | Ga0070691_10001259 | 3300005341 | Bacteria | 10690 |
| 32 | Ga0070687_101266598 | 3300005343 | Bacteria | 546 |
| 33 | Ga0070661_100039205 | 3300005344 | Unclassified | 3452 |
| 34 | Ga0070692_11412092 | 3300005345 | Bacteria | 503 |
| 35 | Ga0070671_100208533 | 3300005355 | Unclassified | 1657 |
| 36 | Ga0070674_101906446 | 3300005356 | Bacteria | 540 |
| 37 | Ga0070673_100081542 | 3300005364 | Bacteria | 2624 |
| 38 | Ga0070688_100060318 | 3300005365 | Bacteria | 2395 |
| 39 | Ga0070667_101419831 | 3300005367 | Bacteria | 651 |
| 40 | Ga0070709_10180816 | 3300005434 | Bacteria | 1481 |
| 41 | Ga0070709_10197378 | 3300005434 | Bacteria | 1423 |
| 42 | Ga0070714_100032417 | 3300005435 | Bacteria | 4361 |
| 43 | Ga0070714_100135373 | 3300005435 | Bacteria | 2206 |
| 44 | Ga0070713_100022680 | 3300005436 | Bacteria | 4855 |
| 45 | Ga0070713_100334447 | 3300005436 | Bacteria | 1402 |
| 46 | Ga0070713_101708355 | 3300005436 | Bacteria | 611 |
| 47 | Ga0070710_10742643 | 3300005437 | Unclassified | 696 |
| 48 | Ga0070711_100056027 | 3300005439 | Bacteria | 2725 |
| 49 | Ga0070711_101497112 | 3300005439 | Bacteria | 589 |
| 50 | Ga0070662_100039883 | 3300005457 | Unclassified | 3342 |
| 51 | Ga0070681_10007276 | 3300005458 | Bacteria | 10807 |
| 52 | Ga0070681_10208431 | 3300005458 | Bacteria | 1871 |
| 53 | Ga0070681_11762657 | 3300005458 | Unclassified | 546 |
| 54 | Ga0068867_101191933 | 3300005459 | Bacteria | 699 |
| 55 | Ga0070707_101155601 | 3300005468 | Bacteria | 740 |
| 56 | Ga0070698_100872766 | 3300005471 | Archaea | 845 |
| 57 | Ga0070679_100001789 | 3300005530 | Bacteria | 19379 |
| 58 | Ga0070679_100404890 | 3300005530 | Unclassified | 1310 |
| 59 | Ga0070679_100957199 | 3300005530 | Bacteria | 800 |
| 60 | Ga0070684_100002783 | 3300005535 | Bacteria | 12956 |
| 61 | Ga0070684_100179844 | 3300005535 | Bacteria | 1923 |
| 62 | Ga0070684_100307615 | 3300005535 | Bacteria | 1455 |
| 63 | Ga0070684_100866838 | 3300005535 | Unclassified | 845 |
| 64 | Ga0070697_100316313 | 3300005536 | Bacteria | 1344 |
| 65 | Ga0068853_100200237 | 3300005539 | Unclassified | 1817 |
| 66 | Ga0068853_100481261 | 3300005539 | Bacteria | 1170 |
| 67 | Ga0070686_100335649 | 3300005544 | Unclassified | 1131 |
| 68 | Ga0070686_100349292 | 3300005544 | Bacteria | 1111 |
| 69 | Ga0070686_100913855 | 3300005544 | Bacteria | 715 |
| 70 | Ga0070686_100955136 | 3300005544 | Bacteria | 700 |
| 71 | Ga0070695_100104208 | 3300005545 | Bacteria | 1915 |
| 72 | Ga0070696_100557007 | 3300005546 | Bacteria | 919 |
| 73 | Ga0070693_100061059 | 3300005547 | Bacteria | 2190 |
| 74 | Ga0070693_100242164 | 3300005547 | Bacteria | 1192 |
| 75 | Ga0070665_101720413 | 3300005548 | Unclassified | 634 |
| 76 | Ga0070665_101779905 | 3300005548 | Unclassified | 623 |
| 77 | Ga0068855_100004869 | 3300005563 | Bacteria | 16391 |
| 78 | Ga0068855_100023679 | 3300005563 | Bacteria | 7353 |
| 79 | Ga0068855_100026535 | 3300005563 | Bacteria | 6930 |
| 80 | Ga0068855_100360759 | 3300005563 | Bacteria | 1599 |
| 81 | Ga0070664_100282152 | 3300005564 | Bacteria | 1498 |
| 82 | Ga0068857_100001612 | 3300005577 | Bacteria | 18104 |
| 83 | Ga0068857_100009382 | 3300005577 | Bacteria | 8494 |
| 84 | Ga0068857_100676920 | 3300005577 | Bacteria | 979 |
| 85 | Ga0068857_101146378 | 3300005577 | Bacteria | 752 |
| 86 | Ga0068854_102005828 | 3300005578 | Bacteria | 533 |
| 87 | Ga0068856_100012289 | 3300005614 | Bacteria | 8292 |
| 88 | Ga0068856_100019017 | 3300005614 | Bacteria | 6665 |
| 89 | Ga0068856_100728386 | 3300005614 | Unclassified | 1012 |
| 90 | Ga0068856_100774912 | 3300005614 | Bacteria | 979 |
| 91 | Ga0068856_101220833 | 3300005614 | Bacteria | 768 |
| 92 | Ga0070702_100094529 | 3300005615 | Unclassified | 1820 |
| 93 | Ga0068852_100004525 | 3300005616 | Bacteria | 9836 |
| 94 | Ga0068852_100168015 | 3300005616 | Bacteria | 2054 |
| 95 | Ga0068852_100292318 | 3300005616 | Bacteria | 1574 |
| 96 | Ga0068859_100027428 | 3300005617 | Bacteria | 5712 |
| 97 | Ga0068859_100145442 | 3300005617 | Bacteria | 2445 |
| 98 | Ga0068859_100526900 | 3300005617 | Unclassified | 1276 |
| 99 | Ga0068859_101243976 | 3300005617 | Unclassified | 820 |
| 100 | Ga0068859_101271773 | 3300005617 | Bacteria | 811 |
| 101 | Ga0068859_101940320 | 3300005617 | Bacteria | 650 |
| 102 | Ga0068864_100318632 | 3300005618 | Unclassified | 1460 |
| 103 | Ga0068864_100333418 | 3300005618 | Unclassified | 1428 |
| 104 | Ga0068864_100435805 | 3300005618 | Unclassified | 1251 |
| 105 | Ga0068864_101445179 | 3300005618 | Bacteria | 690 |
| 106 | Ga0068866_10324807 | 3300005718 | Bacteria | 969 |
| 107 | Ga0068866_10776610 | 3300005718 | Unclassified | 664 |
| 108 | Ga0068851_10195082 | 3300005834 | Unclassified | 1128 |
| 109 | Ga0068870_10038276 | 3300005840 | Bacteria | 2476 |
| 110 | Ga0068863_100044516 | 3300005841 | Unclassified | 4213 |
| 111 | Ga0068863_100160229 | 3300005841 | Bacteria | 2155 |
| 112 | Ga0068863_100442137 | 3300005841 | Bacteria | 1275 |
| 113 | Ga0068863_101320735 | 3300005841 | Unclassified | 728 |
| 114 | Ga0068863_101636479 | 3300005841 | Unclassified | 653 |
| 115 | Ga0068863_101870258 | 3300005841 | Bacteria | 610 |
| 116 | Ga0068858_100009783 | 3300005842 | Bacteria | 9128 |
| 117 | Ga0068858_100108173 | 3300005842 | Bacteria | 2596 |
| 118 | Ga0068858_100192373 | 3300005842 | Unclassified | 1928 |
| 119 | Ga0068858_100279010 | 3300005842 | Bacteria | 1591 |
| 120 | Ga0068858_100571508 | 3300005842 | Bacteria | 1095 |
| 121 | Ga0068858_100665248 | 3300005842 | Unclassified | 1012 |
| 122 | Ga0068858_100919776 | 3300005842 | Bacteria | 856 |
| 123 | Ga0068860_100129395 | 3300005843 | Bacteria | 2422 |
| 124 | Ga0068860_100487708 | 3300005843 | Bacteria | 1229 |
| 125 | Ga0068860_101680370 | 3300005843 | Bacteria | 657 |
| 126 | Ga0070717_10040840 | 3300006028 | Unclassified | 3781 |
| 127 | Ga0070717_10150053 | 3300006028 | Bacteria | 2016 |
| 128 | Ga0070717_10487923 | 3300006028 | Bacteria | 1113 |
| 129 | Ga0070717_10841074 | 3300006028 | Unclassified | 835 |
| 130 | Ga0070717_10962933 | 3300006028 | Bacteria | 777 |
| 131 | Ga0070712_100470575 | 3300006175 | Unclassified | 1049 |
| 132 | Ga0097621_100015235 | 3300006237 | Bacteria | 5779 |
| 133 | Ga0097621_100029068 | 3300006237 | Bacteria | 4363 |
| 134 | Ga0097621_100201250 | 3300006237 | Bacteria | 1729 |
| 135 | Ga0097621_100337440 | 3300006237 | Archaea | 1338 |
| 136 | Ga0097621_100911060 | 3300006237 | Unclassified | 819 |
| 137 | Ga0097621_101046822 | 3300006237 | Bacteria | 765 |
| 138 | Ga0097621_101218312 | 3300006237 | Bacteria | 709 |
| 139 | Ga0097621_101315306 | 3300006237 | Unclassified | 683 |
| 140 | Ga0068871_100011639 | 3300006358 | Bacteria | 6459 |
| 141 | Ga0068871_100026768 | 3300006358 | Bacteria | 4503 |
| 142 | Ga0068871_100185595 | 3300006358 | Archaea | 1789 |
| 143 | Ga0068871_100197482 | 3300006358 | Unclassified | 1736 |
| 144 | Ga0068871_100353211 | 3300006358 | Bacteria | 1301 |
| 145 | Ga0068871_100519838 | 3300006358 | Bacteria | 1075 |
| 146 | Ga0068871_100605282 | 3300006358 | Bacteria | 997 |
| 147 | Ga0075431_100002512 | 3300006847 | Bacteria | 17688 |
| 148 | Ga0075434_100834704 | 3300006871 | Bacteria | 937 |
| 149 | Ga0068865_100057083 | 3300006881 | Bacteria | 2722 |
| 150 | Ga0068865_100063642 | 3300006881 | Bacteria | 2594 |
| 151 | Ga0068865_101066788 | 3300006881 | Bacteria | 710 |
| 152 | Ga0068865_101878591 | 3300006881 | Unclassified | 542 |
| 153 | Ga0068865_102054500 | 3300006881 | Unclassified | 519 |
| 154 | Ga0097620_100027428 | 3300006931 | Bacteria | 5712 |
| 155 | Ga0097620_100145440 | 3300006931 | Bacteria | 2445 |
| 156 | Ga0097620_100526956 | 3300006931 | Unclassified | 1276 |
| 157 | Ga0097620_101243522 | 3300006931 | Unclassified | 820 |
| 158 | Ga0097620_101271477 | 3300006931 | Bacteria | 811 |
| 159 | Ga0097620_101939982 | 3300006931 | Bacteria | 650 |
| 160 | Ga0105250_10511649 | 3300009092 | Bacteria | 546 |
| 161 | Ga0105240_10003870 | 3300009093 | Bacteria | 23121 |
| 162 | Ga0105240_10010503 | 3300009093 | Bacteria | 13014 |
| 163 | Ga0105240_10027576 | 3300009093 | Bacteria | 7435 |
| 164 | Ga0105240_10052210 | 3300009093 | Bacteria | 5140 |
| 165 | Ga0105240_10083955 | 3300009093 | Bacteria | 3907 |
| 166 | Ga0105240_10196374 | 3300009093 | Bacteria | 2369 |
| 167 | Ga0105240_10341100 | 3300009093 | Bacteria | 1702 |
| 168 | Ga0105240_10590999 | 3300009093 | Bacteria | 1223 |
| 169 | Ga0105240_10620795 | 3300009093 | Bacteria | 1188 |
| 170 | Ga0105240_12205025 | 3300009093 | Bacteria | 571 |
| 171 | Ga0105245_10003881 | 3300009098 | Bacteria | 13299 |
| 172 | Ga0105245_10004978 | 3300009098 | Bacteria | 11682 |
| 173 | Ga0105245_10030136 | 3300009098 | Bacteria | 4796 |
| 174 | Ga0105245_10083978 | 3300009098 | Unclassified | 2916 |
| 175 | Ga0105245_10239033 | 3300009098 | Bacteria | 1760 |
| 176 | Ga0105245_10322605 | 3300009098 | Unclassified | 1522 |
| 177 | Ga0105245_11299414 | 3300009098 | Unclassified | 776 |
| 178 | Ga0105245_12039189 | 3300009098 | Unclassified | 627 |
| 179 | Ga0105247_10732893 | 3300009101 | Bacteria | 747 |
| 180 | Ga0105247_10799340 | 3300009101 | Bacteria | 719 |
| 181 | Ga0105243_10579780 | 3300009148 | Bacteria | 1077 |
| 182 | Ga0105243_10629477 | 3300009148 | Bacteria | 1037 |
| 183 | Ga0105243_11370321 | 3300009148 | Bacteria | 727 |
| 184 | Ga0105241_10002492 | 3300009174 | Bacteria | 13839 |
| 185 | Ga0105241_10137159 | 3300009174 | Unclassified | 1988 |
| 186 | Ga0105241_10404678 | 3300009174 | Bacteria | 1198 |
| 187 | Ga0105241_10514868 | 3300009174 | Bacteria | 1069 |
| 188 | Ga0105241_10765011 | 3300009174 | Unclassified | 887 |
| 189 | Ga0105241_11545024 | 3300009174 | Bacteria | 640 |
| 190 | Ga0105242_10010023 | 3300009176 | Bacteria | 7255 |
| 191 | Ga0105242_10084466 | 3300009176 | Bacteria | 2660 |
| 192 | Ga0105242_10090563 | 3300009176 | Unclassified | 2573 |
| 193 | Ga0105242_10375259 | 3300009176 | Bacteria | 1320 |
| 194 | Ga0105242_10510581 | 3300009176 | Bacteria | 1145 |
| 195 | Ga0105242_10515963 | 3300009176 | Bacteria | 1139 |
| 196 | Ga0105242_10845468 | 3300009176 | Bacteria | 910 |
| 197 | Ga0105242_11059402 | 3300009176 | Bacteria | 822 |
| 198 | Ga0105242_11427112 | 3300009176 | Bacteria | 720 |
| 199 | Ga0105242_12768378 | 3300009176 | Bacteria | 541 |
| 200 | Ga0105248_10018110 | 3300009177 | Bacteria | 7777 |
| 201 | Ga0105248_10023469 | 3300009177 | Bacteria | 6852 |
| 202 | Ga0105248_10061312 | 3300009177 | Bacteria | 4223 |
| 203 | Ga0105248_10114265 | 3300009177 | Bacteria | 3045 |
| 204 | Ga0105248_10636445 | 3300009177 | Unclassified | 1203 |
| 205 | Ga0105248_11192244 | 3300009177 | Bacteria | 861 |
| 206 | Ga0105248_11909055 | 3300009177 | Unclassified | 674 |
| 207 | Ga0105248_12651213 | 3300009177 | Bacteria | 571 |
| 208 | Ga0105237_10024427 | 3300009545 | Bacteria | 6182 |
| 209 | Ga0105237_10054043 | 3300009545 | Bacteria | 4025 |
| 210 | Ga0105237_10174413 | 3300009545 | Bacteria | 2150 |
| 211 | Ga0105237_10832498 | 3300009545 | Bacteria | 929 |
| 212 | Ga0105237_11477522 | 3300009545 | Bacteria | 686 |
| 213 | Ga0105237_11619610 | 3300009545 | Bacteria | 654 |
| 214 | Ga0105237_12175149 | 3300009545 | Unclassified | 564 |
| 215 | Ga0105238_10008917 | 3300009551 | Bacteria | 10039 |
| 216 | Ga0105238_10016712 | 3300009551 | Bacteria | 7435 |
| 217 | Ga0105238_10025381 | 3300009551 | Bacteria | 6041 |
| 218 | Ga0105238_10026524 | 3300009551 | Bacteria | 5908 |
| 219 | Ga0105238_10089653 | 3300009551 | Unclassified | 3062 |
| 220 | Ga0105238_10107885 | 3300009551 | Bacteria | 2765 |
| 221 | Ga0105238_10332648 | 3300009551 | Bacteria | 1506 |
| 222 | Ga0105238_11246701 | 3300009551 | Unclassified | 769 |
| 223 | Ga0105249_10028818 | 3300009553 | Bacteria | 5012 |
| 224 | Ga0105249_10287542 | 3300009553 | Bacteria | 1644 |
| 225 | Ga0105249_10819880 | 3300009553 | Unclassified | 995 |
| 226 | Ga0105249_11573700 | 3300009553 | Unclassified | 730 |
| 227 | Ga0105239_10006055 | 3300010375 | Bacteria | 14080 |
| 228 | Ga0105239_10019753 | 3300010375 | Bacteria | 7436 |
| 229 | Ga0105239_10091500 | 3300010375 | Bacteria | 3357 |
| 230 | Ga0105239_11351404 | 3300010375 | Unclassified | 822 |
| 231 | Ga0105246_10009670 | 3300011119 | Bacteria | 5943 |
| 232 | Ga0105246_10299447 | 3300011119 | Bacteria | 1298 |
| 233 | Ga0105246_11139919 | 3300011119 | Unclassified | 714 |
| 234 | Ga0105246_11737218 | 3300011119 | Archaea | 594 |
| 235 | Ga0157373_10517935 | 3300013100 | Bacteria | 863 |
| 236 | Ga0157370_10001341 | 3300013104 | Bacteria | 30545 |
| 237 | Ga0157370_10009436 | 3300013104 | Bacteria | 10426 |
| 238 | Ga0157370_10021566 | 3300013104 | Bacteria | 6418 |
| 239 | Ga0157370_10993657 | 3300013104 | Unclassified | 760 |
| 240 | Ga0157370_11165626 | 3300013104 | Bacteria | 696 |
| 241 | Ga0157369_10007122 | 3300013105 | Bacteria | 12895 |
| 242 | Ga0157369_10023682 | 3300013105 | Bacteria | 6838 |
| 243 | Ga0157369_10089316 | 3300013105 | Bacteria | 3290 |
| 244 | Ga0157374_10292627 | 3300013296 | Bacteria | 1610 |
| 245 | Ga0157374_10500019 | 3300013296 | Bacteria | 1220 |
| 246 | Ga0157374_11101472 | 3300013296 | Viruses | 815 |
| 247 | Ga0157374_11143856 | 3300013296 | Unclassified | 799 |
| 248 | Ga0157374_11206929 | 3300013296 | Bacteria | 778 |
| 249 | Ga0157374_11576739 | 3300013296 | Unclassified | 680 |
| 250 | Ga0157378_10509096 | 3300013297 | Archaea | 1204 |
| 251 | Ga0157378_10661803 | 3300013297 | Bacteria | 1061 |
| 252 | Ga0163162_10154092 | 3300013306 | Bacteria | 2417 |
| 253 | Ga0163162_10158510 | 3300013306 | Bacteria | 2384 |
| 254 | Ga0163162_10578578 | 3300013306 | Bacteria | 1250 |
| 255 | Ga0163162_11281107 | 3300013306 | Bacteria | 832 |
| 256 | Ga0163162_12946955 | 3300013306 | Unclassified | 547 |
| 257 | Ga0157372_10010533 | 3300013307 | Bacteria | 9837 |
| 258 | Ga0157372_10316516 | 3300013307 | Bacteria | 1817 |
| 259 | Ga0157372_10590181 | 3300013307 | Unclassified | 1295 |
| 260 | Ga0157372_11241732 | 3300013307 | Unclassified | 861 |
| 261 | Ga0157372_11537859 | 3300013307 | Bacteria | 766 |
| 262 | Ga0157375_10008109 | 3300013308 | Bacteria | 9191 |
| 263 | Ga0157375_10615720 | 3300013308 | Unclassified | 1244 |
| 264 | Ga0157375_11513848 | 3300013308 | Unclassified | 792 |
| 265 | Ga0157375_12343138 | 3300013308 | Bacteria | 637 |
| 266 | Ga0157375_12670088 | 3300013308 | Unclassified | 597 |
| 267 | Ga0157375_12845779 | 3300013308 | Bacteria | 578 |
| 268 | Ga0163163_10029227 | 3300014325 | Bacteria | 5301 |
| 269 | Ga0163163_10235639 | 3300014325 | Unclassified | 1880 |
| 270 | Ga0163163_10474372 | 3300014325 | Unclassified | 1312 |
| 271 | Ga0163163_10919231 | 3300014325 | Unclassified | 938 |
| 272 | Ga0157380_11528279 | 3300014326 | Unclassified | 721 |
| 273 | Ga0157380_12849176 | 3300014326 | Unclassified | 550 |
| 274 | Ga0157379_10039223 | 3300014968 | Bacteria | 4226 |
| 275 | Ga0157379_10109053 | 3300014968 | Bacteria | 2486 |
| 276 | Ga0157379_11581951 | 3300014968 | Bacteria | 640 |
| 277 | Ga0157379_11754689 | 3300014968 | Unclassified | 609 |
| 278 | Ga0157376_10147744 | 3300014969 | Unclassified | 2116 |
| 279 | Ga0157376_10369617 | 3300014969 | Bacteria | 1378 |
| 280 | Ga0157376_10457491 | 3300014969 | Bacteria | 1246 |
| 281 | Ga0157376_11065804 | 3300014969 | Bacteria | 833 |
| 282 | Ga0157376_11169784 | 3300014969 | Unclassified | 797 |
| 283 | Ga0157376_11334009 | 3300014969 | Unclassified | 748 |
| 284 | Ga0157376_11452333 | 3300014969 | Bacteria | 718 |
| 285 | Ga0157376_12259284 | 3300014969 | Bacteria | 583 |
| 286 | Ga0157376_12315753 | 3300014969 | Unclassified | 576 |
| 287 | Ga0213876_10473410 | 3300021384 | Unclassified | 666 |
| 288 | Ga0213875_10325466 | 3300021388 | Unclassified | 729 |
| 289 | Ga0207656_10174965 | 3300025321 | Unclassified | 1028 |
| 290 | Ga0207642_10116173 | 3300025899 | Bacteria | 1371 |
| 291 | Ga0207642_10251009 | 3300025899 | Bacteria | 1004 |
| 292 | Ga0207680_10329756 | 3300025903 | Bacteria | 1069 |
| 293 | Ga0207699_10416266 | 3300025906 | Bacteria | 959 |
| 294 | Ga0207699_10523621 | 3300025906 | Bacteria | 858 |
| 295 | Ga0207645_10119948 | 3300025907 | Unclassified | 1707 |
| 296 | Ga0207645_10505496 | 3300025907 | Bacteria | 818 |
| 297 | Ga0207654_10002572 | 3300025911 | Bacteria | 9211 |
| 298 | Ga0207654_10023078 | 3300025911 | Bacteria | 3329 |
| 299 | Ga0207654_10245452 | 3300025911 | Bacteria | 1198 |
| 300 | Ga0207654_10893132 | 3300025911 | Bacteria | 644 |
| 301 | Ga0207707_10002413 | 3300025912 | Bacteria | 16808 |
| 302 | Ga0207695_10003003 | 3300025913 | Bacteria | 24250 |
| 303 | Ga0207695_10003666 | 3300025913 | Bacteria | 21419 |
| 304 | Ga0207695_10031742 | 3300025913 | Bacteria | 5788 |
| 305 | Ga0207695_10087451 | 3300025913 | Bacteria | 3139 |
| 306 | Ga0207695_10443646 | 3300025913 | Bacteria | 1181 |
| 307 | Ga0207695_10681209 | 3300025913 | Unclassified | 909 |
| 308 | Ga0207695_11259396 | 3300025913 | Unclassified | 620 |
| 309 | Ga0207695_11753020 | 3300025913 | Bacteria | 502 |
| 310 | Ga0207671_10016255 | 3300025914 | Bacteria | 5789 |
| 311 | Ga0207671_10433821 | 3300025914 | Unclassified | 1046 |
| 312 | Ga0207663_11471102 | 3300025916 | Bacteria | 549 |
| 313 | Ga0207660_10006741 | 3300025917 | Bacteria | 7436 |
| 314 | Ga0207657_10069153 | 3300025919 | Bacteria | 2997 |
| 315 | Ga0207657_10361457 | 3300025919 | Unclassified | 1144 |
| 316 | Ga0207649_10251985 | 3300025920 | Bacteria | 1272 |
| 317 | Ga0207652_10007211 | 3300025921 | Bacteria | 8969 |
| 318 | Ga0207694_10001140 | 3300025924 | Bacteria | 23033 |
| 319 | Ga0207694_10014490 | 3300025924 | Bacteria | 5944 |
| 320 | Ga0207694_10033238 | 3300025924 | Bacteria | 3951 |
| 321 | Ga0207694_10133369 | 3300025924 | Unclassified | 1992 |
| 322 | Ga0207694_10436933 | 3300025924 | Unclassified | 1091 |
| 323 | Ga0207694_10723215 | 3300025924 | Unclassified | 840 |
| 324 | Ga0207650_11113870 | 3300025925 | Bacteria | 672 |
| 325 | Ga0207659_11780957 | 3300025926 | Unclassified | 523 |
| 326 | Ga0207687_10001618 | 3300025927 | Bacteria | 15513 |
| 327 | Ga0207687_10004164 | 3300025927 | Bacteria | 9686 |
| 328 | Ga0207687_10079039 | 3300025927 | Unclassified | 2370 |
| 329 | Ga0207687_10103748 | 3300025927 | Bacteria | 2097 |
| 330 | Ga0207687_10143448 | 3300025927 | Bacteria | 1814 |
| 331 | Ga0207687_10158611 | 3300025927 | Bacteria | 1734 |
| 332 | Ga0207687_11184702 | 3300025927 | Bacteria | 656 |
| 333 | Ga0207700_10001426 | 3300025928 | Bacteria | 13542 |
| 334 | Ga0207700_10073664 | 3300025928 | Bacteria | 2638 |
| 335 | Ga0207700_10187819 | 3300025928 | Bacteria | 1735 |
| 336 | Ga0207700_10989185 | 3300025928 | Bacteria | 753 |
| 337 | Ga0207664_10109035 | 3300025929 | Unclassified | 2300 |
| 338 | Ga0207644_10013017 | 3300025931 | Bacteria | 5536 |
| 339 | Ga0207706_10089073 | 3300025933 | Unclassified | 2713 |
| 340 | Ga0207686_10005228 | 3300025934 | Bacteria | 6969 |
| 341 | Ga0207686_10027819 | 3300025934 | Bacteria | 3315 |
| 342 | Ga0207686_10138239 | 3300025934 | Bacteria | 1680 |
| 343 | Ga0207686_10459630 | 3300025934 | Bacteria | 981 |
| 344 | Ga0207686_11217806 | 3300025934 | Bacteria | 617 |
| 345 | Ga0207709_10924961 | 3300025935 | Bacteria | 710 |
| 346 | Ga0207670_10282510 | 3300025936 | Bacteria | 1294 |
| 347 | Ga0207670_11030223 | 3300025936 | Bacteria | 693 |
| 348 | Ga0207669_10477747 | 3300025937 | Bacteria | 993 |
| 349 | Ga0207704_10071640 | 3300025938 | Bacteria | 2200 |
| 350 | Ga0207704_10101730 | 3300025938 | Bacteria | 1917 |
| 351 | Ga0207704_11644444 | 3300025938 | Unclassified | 552 |
| 352 | Ga0207691_10390052 | 3300025940 | Bacteria | 1188 |
| 353 | Ga0207711_10001497 | 3300025941 | Bacteria | 21763 |
| 354 | Ga0207711_10140324 | 3300025941 | Bacteria | 2174 |
| 355 | Ga0207711_10184377 | 3300025941 | Unclassified | 1899 |
| 356 | Ga0207711_10914893 | 3300025941 | Bacteria | 815 |
| 357 | Ga0207711_10915945 | 3300025941 | Unclassified | 815 |
| 358 | Ga0207689_11069811 | 3300025942 | Bacteria | 680 |
| 359 | Ga0207661_10002033 | 3300025944 | Bacteria | 13949 |
| 360 | Ga0207661_10019538 | 3300025944 | Bacteria | 5054 |
| 361 | Ga0207661_10344501 | 3300025944 | Bacteria | 1343 |
| 362 | Ga0207661_10830515 | 3300025944 | Unclassified | 851 |
| 363 | Ga0207661_11090269 | 3300025944 | Unclassified | 735 |
| 364 | Ga0207661_11212694 | 3300025944 | Unclassified | 694 |
| 365 | Ga0207661_11858497 | 3300025944 | Bacteria | 548 |
| 366 | Ga0207679_10812984 | 3300025945 | Bacteria | 852 |
| 367 | Ga0207679_11029749 | 3300025945 | Bacteria | 755 |
| 368 | Ga0207667_10003900 | 3300025949 | Bacteria | 18344 |
| 369 | Ga0207667_10007597 | 3300025949 | Bacteria | 13003 |
| 370 | Ga0207651_10877455 | 3300025960 | Bacteria | 798 |
| 371 | Ga0207712_10018854 | 3300025961 | Bacteria | 4499 |
| 372 | Ga0207712_10750989 | 3300025961 | Unclassified | 855 |
| 373 | Ga0207712_10982677 | 3300025961 | Bacteria | 748 |
| 374 | Ga0207640_10660257 | 3300025981 | Unclassified | 892 |
| 375 | Ga0207658_11272531 | 3300025986 | Bacteria | 673 |
| 376 | Ga0207658_11859687 | 3300025986 | Bacteria | 549 |
| 377 | Ga0207677_10181296 | 3300026023 | Bacteria | 1657 |
| 378 | Ga0207677_10300557 | 3300026023 | Unclassified | 1326 |
| 379 | Ga0207677_10426984 | 3300026023 | Unclassified | 1130 |
| 380 | Ga0207677_11384146 | 3300026023 | Unclassified | 648 |
| 381 | Ga0207703_10002747 | 3300026035 | Bacteria | 15075 |
| 382 | Ga0207703_10318925 | 3300026035 | Bacteria | 1423 |
| 383 | Ga0207703_10824866 | 3300026035 | Bacteria | 886 |
| 384 | Ga0207703_10949003 | 3300026035 | Bacteria | 824 |
| 385 | Ga0207703_11138154 | 3300026035 | Bacteria | 750 |
| 386 | Ga0207639_10036659 | 3300026041 | Bacteria | 3636 |
| 387 | Ga0207639_10048845 | 3300026041 | Bacteria | 3205 |
| 388 | Ga0207639_10671455 | 3300026041 | Unclassified | 960 |
| 389 | Ga0207639_10949566 | 3300026041 | Unclassified | 804 |
| 390 | Ga0207702_10018859 | 3300026078 | Bacteria | 5707 |
| 391 | Ga0207702_10022844 | 3300026078 | Bacteria | 5189 |
| 392 | Ga0207702_10185034 | 3300026078 | Bacteria | 1921 |
| 393 | Ga0207702_11448905 | 3300026078 | Unclassified | 680 |
| 394 | Ga0207702_11700750 | 3300026078 | Bacteria | 624 |
| 395 | Ga0207641_10818446 | 3300026088 | Unclassified | 922 |
| 396 | Ga0207648_10202954 | 3300026089 | Bacteria | 1759 |
| 397 | Ga0207648_11400895 | 3300026089 | Unclassified | 657 |
| 398 | Ga0207648_11432465 | 3300026089 | Unclassified | 649 |
| 399 | Ga0207676_10488840 | 3300026095 | Unclassified | 1167 |
| 400 | Ga0207676_11995360 | 3300026095 | Unclassified | 579 |
| 401 | Ga0207674_10000300 | 3300026116 | Bacteria | 62723 |
| 402 | Ga0207674_10002379 | 3300026116 | Bacteria | 23783 |
| 403 | Ga0207674_10911198 | 3300026116 | Bacteria | 847 |
| 404 | Ga0207698_10072225 | 3300026142 | Bacteria | 2742 |
| 405 | Ga0207698_11422082 | 3300026142 | Bacteria | 709 |
| 406 | Ga0268266_10206708 | 3300028379 | Bacteria | 1799 |
| 407 | Ga0268266_11962408 | 3300028379 | Unclassified | 559 |
| 408 | Ga0268264_10055308 | 3300028381 | Bacteria | 3316 |
| 409 | Ga0268264_10378264 | 3300028381 | Bacteria | 1355 |
| 410 | Ga0268264_12563544 | 3300028381 | Unclassified | 515 |
| 411 | Ga0265338_10281528 | 3300028800 | Bacteria | 1215 |
| 412 | Ga0265338_10411772 | 3300028800 | Bacteria | 962 |
| 413 | Ga0265325_10077738 | 3300031241 | Bacteria | 1654 |
| 414 | Ga0265325_10237697 | 3300031241 | Bacteria | 829 |
| 415 | Ga0265340_10018852 | 3300031247 | Bacteria | 3556 |
| 416 | Ga0265331_10233266 | 3300031250 | Unclassified | 826 |
| 417 | Ga0265331_10504216 | 3300031250 | Bacteria | 545 |
| 418 | Ga0265316_10011521 | 3300031344 | Bacteria | 7964 |
| 419 | Ga0265313_10056102 | 3300031595 | Bacteria | 1863 |
| 420 | Ga0265314_10002094 | 3300031711 | Bacteria | 21003 |
| 421 | Ga0265314_10463125 | 3300031711 | Bacteria | 673 |
| 422 | Ga0265342_10233930 | 3300031712 | Bacteria | 986 |
| 423 | Ga0373926_0273313 | 3300035083 | Unclassified | 657 |
| 424 | Ga0373934_0000593 | 3300035086 | Bacteria | 12788 |
| 425 | Ga0373934_0008662 | 3300035086 | Bacteria | 3796 |
| 426 | Ga0373940_0089370 | 3300035088 | Bacteria | 921 |
| 427 | Ga0373923_0081737 | 3300035111 | Bacteria | 1402 |
| 428 | Ga0373923_0081910 | 3300035111 | Unclassified | 1401 |
| 429 | Ga0373923_0575699 | 3300035111 | Unclassified | 553 |
| 430 | Ga0373953_0049137 | 3300035117 | Unclassified | 1701 |
| 431 | Ga0373953_0115137 | 3300035117 | Bacteria | 1139 |
| 432 | Ga0373953_0375032 | 3300035117 | Unclassified | 625 |
| 433 | Ga0373954_0002654 | 3300035118 | Bacteria | 7525 |
| 434 | Ga0373954_0005175 | 3300035118 | Bacteria | 5633 |
| 435 | Ga0373954_0047780 | 3300035118 | Bacteria | 2004 |
| 436 | Ga0373956_0041371 | 3300035119 | Unclassified | 2046 |
| 437 | Ga0373956_0143868 | 3300035119 | Bacteria | 1120 |
| 438 | Ga0373956_0157268 | 3300035119 | Bacteria | 1070 |
| 439 | Ga0373956_0334748 | 3300035119 | Bacteria | 721 |
| 440 | Ga0373957_0021796 | 3300035120 | Bacteria | 2278 |
| 441 | Ga0373957_0218462 | 3300035120 | Unclassified | 797 |
| 442 | Ga0373957_0286150 | 3300035120 | Bacteria | 697 |
| 443 | Ga0373943_0004839 | 3300035170 | Bacteria | 6087 |
| 444 | Ga0373946_0020333 | 3300035171 | Bacteria | 2565 |
| 445 | Ga0373946_0372364 | 3300035171 | Bacteria | 717 |
| 446 | Ga0373955_0013233 | 3300035172 | Bacteria | 3983 |
| 447 | Ga0373955_0025591 | 3300035172 | Bacteria | 3033 |
| 448 | Ga0373955_0043896 | 3300035172 | Bacteria | 2406 |
| 449 | Ga0373955_0141247 | 3300035172 | Bacteria | 1412 |
| 450 | Ga0373961_0301422 | 3300035241 | Bacteria | 593 |
| 451 | Ga0373924_0250443 | 3300035410 | Bacteria | 784 |
| 452 | Ga0373931_0672211 | 3300035691 | Bacteria | 682 |
| 453 | Ga0373935_0359346 | 3300035692 | Bacteria | 1039 |
| 454 | Ga0373927_0002053 | 3300035695 | Bacteria | 14853 |
| 455 | Ga0373927_0076234 | 3300035695 | Bacteria | 2172 |
| 456 | Ga0373927_0583468 | 3300035695 | Unclassified | 739 |
| 457 | Ga0373927_0707226 | 3300035695 | Unclassified | 666 |
| 458 | Ga0373927_0822356 | 3300035695 | Bacteria | 613 |
| 459 | Ga0373927_0889444 | 3300035695 | Unclassified | 588 |
| 460 | Ga0373933_0028567 | 3300035724 | Bacteria | 3219 |
| 461 | Ga0373933_0034293 | 3300035724 | Bacteria | 2957 |
| 462 | Ga0373933_0135407 | 3300035724 | Bacteria | 1552 |
| 463 | Ga0373933_0329803 | 3300035724 | Bacteria | 990 |
| 464 | Ga0373933_0496015 | 3300035724 | Bacteria | 800 |
| 465 | Ga0373933_0586800 | 3300035724 | Bacteria | 732 |
| 466 | Ga0373933_1041464 | 3300035724 | Unclassified | 539 |
| 467 | Ga0373947_0388954 | 3300035725 | Bacteria | 939 |
| 468 | Ga0373947_0605447 | 3300035725 | Unclassified | 747 |
| 469 | Ga0373947_0633977 | 3300035725 | Bacteria | 729 |
| 470 | Ga0373947_0960738 | 3300035725 | Bacteria | 583 |
| 471 | Ga0373937_0013144 | 3300036401 | Bacteria | 7290 |
| 472 | Ga0373937_0013794 | 3300036401 | Bacteria | 7121 |
| 473 | Ga0373937_0033752 | 3300036401 | Bacteria | 4650 |
| 474 | Ga0373937_0069874 | 3300036401 | Bacteria | 3238 |
| 475 | Ga0373937_0335267 | 3300036401 | Unclassified | 1432 |
| 476 | Ga0373937_0415962 | 3300036401 | Unclassified | 1276 |
| 477 | Ga0373937_0522120 | 3300036401 | Bacteria | 1128 |
| 478 | Ga0373937_0888920 | 3300036401 | Bacteria | 840 |
| 479 | Ga0373937_1108141 | 3300036401 | Unclassified | 740 |
| 480 | Ga0373937_1125740 | 3300036401 | Bacteria | 734 |
| 481 | Ga0373925_0009106 | 3300037068 | Bacteria | 7225 |
| 482 | Ga0373925_0080542 | 3300037068 | Bacteria | 2475 |
| 483 | Ga0373925_0128274 | 3300037068 | Bacteria | 1975 |
| 484 | Ga0373925_1309696 | 3300037068 | Unclassified | 594 |
| 485 | Ga0395899_0422637 | 3300037312 | Bacteria | 878 |
| 486 | Ga0395900_0627616 | 3300037418 | Bacteria | 1013 |
| 487 | Ga0395898_0609929 | 3300037466 | Bacteria | 1034 |
| 488 | Ga0436364_0427996 | 3300037853 | Unclassified | 1241 |
| 489 | Ga0436364_0998116 | 3300037853 | Bacteria | 16565 |
| 490 | Ga0436364_1301028 | 3300037853 | Unclassified | 1162 |
| 491 | Ga0436365_1919844 | 3300039437 | Bacteria | 4388 |
| 492 | Ga0451807_1889015 | 3300041486 | Bacteria | 711 |
| 493 | Ga0466963_1210767 | 3300044694 | Unclassified | 530 |
| 494 | Ga0466971_0212521 | 3300044719 | Bacteria | 915 |
| 495 | Ga0466959_0136127 | 3300045049 | Bacteria | 1739 |
| 496 | Ga0466959_0907137 | 3300045049 | Bacteria | 588 |
| 497 | Ga0451576_0070512 | 3300045051 | Bacteria | 3638 |
| 498 | Ga0451576_0564616 | 3300045051 | Bacteria | 1196 |
| 499 | Ga0451576_0596920 | 3300045051 | Unclassified | 1160 |
| 500 | Ga0451576_1023639 | 3300045051 | Unclassified | 865 |
| 501 | Ga0451576_2200864 | 3300045051 | Bacteria | 566 |
| 502 | Ga0466958_0205148 | 3300045836 | Bacteria | 1255 |
| 503 | Ga0466967_2266286 | 3300045976 | Unclassified | 539 |
| 504 | Ga0495592_0103667 | 3300046454 | Bacteria | 2023 |
| 505 | Ga0495629_0524543 | 3300046459 | Unclassified | 797 |
| 506 | Ga0495651_0038251 | 3300046462 | Bacteria | 3736 |
| 507 | Ga0495651_0038407 | 3300046462 | Bacteria | 3728 |
| 508 | Ga0495651_0141809 | 3300046462 | Unclassified | 1742 |
| 509 | Ga0495651_0728589 | 3300046462 | Unclassified | 616 |
| 510 | Ga0495653_0173846 | 3300046463 | Bacteria | 1484 |
| 511 | Ga0495580_0004434 | 3300046472 | Bacteria | 11794 |
| 512 | Ga0495580_0021508 | 3300046472 | Bacteria | 4758 |
| 513 | Ga0495580_0034704 | 3300046472 | Bacteria | 3630 |
| 514 | Ga0495580_0055520 | 3300046472 | Unclassified | 2791 |
| 515 | Ga0495580_0183736 | 3300046472 | Bacteria | 1443 |
| 516 | Ga0495580_0309620 | 3300046472 | Bacteria | 1074 |
| 517 | Ga0495580_0319339 | 3300046472 | Bacteria | 1056 |
| 518 | Ga0495580_0838780 | 3300046472 | Unclassified | 594 |
| 519 | Ga0495582_0056650 | 3300046473 | Bacteria | 2160 |
| 520 | Ga0495582_0315743 | 3300046473 | Unclassified | 899 |
| 521 | Ga0495582_0599680 | 3300046473 | Bacteria | 637 |
| 522 | Ga0495639_0412778 | 3300046475 | Unclassified | 683 |
| 523 | Ga0495639_0424142 | 3300046475 | Unclassified | 674 |
| 524 | Ga0495662_0088750 | 3300046476 | Bacteria | 1506 |
| 525 | Ga0495664_0002552 | 3300046477 | Bacteria | 9792 |
| 526 | Ga0495664_0284274 | 3300046477 | Bacteria | 999 |
| 527 | Ga0495594_0083946 | 3300046499 | Bacteria | 1781 |
| 528 | Ga0495608_0060792 | 3300046511 | Bacteria | 2486 |
| 529 | Ga0495608_0664261 | 3300046511 | Bacteria | 622 |
| 530 | Ga0495608_0844791 | 3300046511 | Bacteria | 538 |
| 531 | Ga0495618_0213644 | 3300046514 | Bacteria | 1219 |
| 532 | Ga0495628_0119419 | 3300046516 | Bacteria | 2023 |
| 533 | Ga0495628_0301970 | 3300046516 | Bacteria | 1185 |
| 534 | Ga0495628_0455094 | 3300046516 | Unclassified | 929 |
| 535 | Ga0495628_0932289 | 3300046516 | Bacteria | 601 |
| 536 | Ga0495630_0054348 | 3300046517 | Bacteria | 3000 |
| 537 | Ga0495630_0115696 | 3300046517 | Bacteria | 2032 |
| 538 | Ga0495666_0188398 | 3300046526 | Unclassified | 951 |
| 539 | Ga0495652_0015778 | 3300046529 | Bacteria | 6762 |
| 540 | Ga0495652_0081207 | 3300046529 | Bacteria | 2675 |
| 541 | Ga0495652_0432084 | 3300046529 | Unclassified | 926 |
| 542 | Ga0495665_0155696 | 3300046531 | Bacteria | 1192 |
| 543 | Ga0495665_0505447 | 3300046531 | Unclassified | 609 |
| 544 | Ga0495640_0098796 | 3300046533 | Bacteria | 1918 |
| 545 | Ga0495640_0601490 | 3300046533 | Bacteria | 664 |
| 546 | Ga0495640_0822335 | 3300046533 | Unclassified | 553 |
| 547 | Ga0495586_0189219 | 3300046535 | Bacteria | 1166 |
| 548 | Ga0495586_0317621 | 3300046535 | Bacteria | 893 |
| 549 | Ga0495586_0590331 | 3300046535 | Bacteria | 642 |
| 550 | Ga0495587_0063820 | 3300046536 | Bacteria | 2153 |
| 551 | Ga0495587_0087280 | 3300046536 | Bacteria | 1805 |
| 552 | Ga0495587_0089389 | 3300046536 | Bacteria | 1780 |
| 553 | Ga0495587_0253134 | 3300046536 | Unclassified | 990 |
| 554 | Ga0495587_0352128 | 3300046536 | Bacteria | 821 |
| 555 | Ga0495587_0453024 | 3300046536 | Unclassified | 711 |
| 556 | Ga0495645_0010566 | 3300046543 | Bacteria | 6479 |
| 557 | Ga0495645_0021394 | 3300046543 | Bacteria | 4675 |
| 558 | Ga0495645_0035507 | 3300046543 | Bacteria | 3634 |
| 559 | Ga0495645_0066864 | 3300046543 | Unclassified | 2596 |
| 560 | Ga0495645_0341636 | 3300046543 | Bacteria | 967 |
| 561 | Ga0495645_0660257 | 3300046543 | Unclassified | 638 |
| 562 | Ga0495645_0692388 | 3300046543 | Unclassified | 619 |
| 563 | Ga0495667_0052338 | 3300046559 | Bacteria | 2690 |
| 564 | Ga0495667_0054850 | 3300046559 | Bacteria | 2622 |
| 565 | Ga0495667_0228164 | 3300046559 | Bacteria | 1187 |
| 566 | Ga0495667_0348296 | 3300046559 | Unclassified | 936 |
| 567 | Ga0495667_0377310 | 3300046559 | Unclassified | 894 |
| 568 | Ga0495667_0846018 | 3300046559 | Bacteria | 563 |
| 569 | Ga0495634_0100680 | 3300046642 | Bacteria | 1867 |
| 570 | Ga0495635_0179125 | 3300046663 | Bacteria | 1441 |
| 571 | Ga0495635_0989214 | 3300046663 | Unclassified | 536 |
| 572 | Ga0495588_0371599 | 3300046674 | Bacteria | 751 |
| 573 | Ga0495657_0181226 | 3300046675 | Bacteria | 1293 |
| 574 | Ga0495657_0763942 | 3300046675 | Bacteria | 554 |
| 575 | Ga0495599_0002944 | 3300046678 | Bacteria | 9901 |
| 576 | Ga0495599_0041869 | 3300046678 | Bacteria | 2875 |
| 577 | Ga0495599_0069354 | 3300046678 | Unclassified | 2200 |
| 578 | Ga0495599_0276718 | 3300046678 | Bacteria | 1017 |
| 579 | Ga0495599_0402035 | 3300046678 | Unclassified | 816 |
| 580 | Ga0495599_0435012 | 3300046678 | Unclassified | 778 |
| 581 | Ga0495623_0077659 | 3300046679 | Bacteria | 2058 |
| 582 | Ga0495623_0153177 | 3300046679 | Bacteria | 1361 |
| 583 | Ga0495623_0167740 | 3300046679 | Bacteria | 1285 |
| 584 | Ga0495623_0184520 | 3300046679 | Bacteria | 1209 |
| 585 | Ga0495623_0265205 | 3300046679 | Bacteria | 961 |
| 586 | Ga0495623_0356940 | 3300046679 | Unclassified | 795 |
| 587 | Ga0495646_0015014 | 3300046680 | Bacteria | 4919 |
| 588 | Ga0495646_0600178 | 3300046680 | Unclassified | 559 |
| 589 | Ga0495613_0109394 | 3300046689 | Bacteria | 1993 |
| 590 | Ga0495613_0288216 | 3300046689 | Unclassified | 1139 |
| 591 | Ga0495624_0619751 | 3300046690 | Unclassified | 644 |
| 592 | Ga0495600_0150840 | 3300046809 | Bacteria | 1505 |
| 593 | Ga0495600_0300293 | 3300046809 | Unclassified | 1013 |
| 594 | Ga0495604_0068721 | 3300047317 | Bacteria | 2688 |
| 595 | Ga0495604_0356168 | 3300047317 | Unclassified | 971 |
| 596 | Ga0495604_1036058 | 3300047317 | Bacteria | 506 |
| 597 | Ga0495674_0014673 | 3300047319 | Bacteria | 7331 |
| 598 | Ga0495674_0090870 | 3300047319 | Bacteria | 2608 |
| 599 | Ga0495674_0129028 | 3300047319 | Bacteria | 2131 |
| 600 | Ga0495674_0254111 | 3300047319 | Bacteria | 1446 |
| 601 | Ga0495674_0689391 | 3300047319 | Bacteria | 803 |
| 602 | Ga0495674_0775361 | 3300047319 | Unclassified | 747 |
| 603 | Ga0495674_0793335 | 3300047319 | Bacteria | 737 |
| 604 | Ga0495680_0048536 | 3300047322 | Bacteria | 3333 |
| 605 | Ga0495680_0398818 | 3300047322 | Unclassified | 950 |
| 606 | Ga0495675_0017626 | 3300047444 | Bacteria | 4528 |
| 607 | Ga0495675_0184983 | 3300047444 | Bacteria | 1274 |
| 608 | Ga0495675_0201953 | 3300047444 | Bacteria | 1210 |
| 609 | Ga0495675_0321929 | 3300047444 | Bacteria | 914 |
| 610 | Ga0495677_0415099 | 3300047445 | Bacteria | 533 |
| 611 | Ga0495684_0004174 | 3300047471 | Bacteria | 11280 |
| 612 | Ga0495684_0004482 | 3300047471 | Bacteria | 10910 |
| 613 | Ga0495684_0160909 | 3300047471 | Bacteria | 1674 |
| 614 | Ga0495684_0176220 | 3300047471 | Bacteria | 1587 |
| 615 | Ga0495684_0185886 | 3300047471 | Bacteria | 1538 |
| 616 | Ga0495684_0286722 | 3300047471 | Bacteria | 1186 |
| 617 | Ga0495684_0512369 | 3300047471 | Bacteria | 823 |
| 618 | Ga0495684_0622303 | 3300047471 | Unclassified | 726 |
| 619 | Ga0495684_0930771 | 3300047471 | Unclassified | 557 |
| 620 | Ga0495593_0246976 | 3300047673 | Unclassified | 894 |
| 621 | Ga0495602_0019321 | 3300048088 | Bacteria | 6769 |
| 622 | Ga0495602_0094336 | 3300048088 | Bacteria | 2473 |
| 623 | Ga0495602_0155955 | 3300048088 | Bacteria | 1788 |
| 624 | Ga0495602_0336489 | 3300048088 | Unclassified | 1093 |
| 625 | Ga0495602_0357629 | 3300048088 | Bacteria | 1052 |
| 626 | Ga0496104_0015651 | 3300048907 | Bacteria | 6878 |
| 627 | Ga0496106_0900336 | 3300048909 | Unclassified | 699 |
| 628 | Ga0496108_0809983 | 3300048911 | Unclassified | 808 |
| 629 | Ga0496110_1806671 | 3300048913 | Bacteria | 521 |
| 630 | Ga0496112_0145535 | 3300048915 | Unclassified | 2338 |
| 631 | Ga0496112_0165719 | 3300048915 | Unclassified | 2176 |
| 632 | nmdc:mga06r32_133004_c1 | 3300050510 | Unclassified | 2461 |
| 633 | nmdc:mga0n895_761281_c1 | 3300050512 | Bacteria | 961 |
| 634 | Ga0495601_0139198 | 3300053077 | Bacteria | 1583 |
| 635 | Ga0495601_0568805 | 3300053077 | Bacteria | 728 |
| 636 | Ga0495619_0657688 | 3300053085 | Bacteria | 714 |
| 637 | Ga0587111_0089888 | 3300060346 | Unclassified | 748 |
| 638 | Ga0265314_10151664 | |||
| 639 | Ga0070658_10742741 | |||
| 640 | Ga0070658_10864183 | |||
| 641 | Ga0070676_10941466 | |||
| 642 | Ga0070676_11464178 | |||
| 643 | Ga0070683_100000497 | |||
| 644 | Ga0070683_100100401 | |||
| 645 | Ga0070683_100172677 | |||
| 646 | Ga0070683_100358292 | |||
| 647 | Ga0070683_101083319 | |||
| 648 | Ga0070683_101474208 | |||
| 649 | Ga0070683_101657070 | |||
| 650 | Ga0070690_101529916 | |||
| 651 | Ga0070670_100893401 | |||
| 652 | Ga0070670_101320430 | |||
| 653 | Ga0068869_100980979 | |||
| 654 | Ga0070666_10323448 | |||
| 655 | Ga0070666_10710801 | |||
| 656 | Ga0070666_10869472 | |||
| 657 | Ga0070680_100003800 | |||
| 658 | Ga0070682_100061009 | |||
| 659 | Ga0070682_101729898 | |||
| 660 | Ga0068868_100074348 | |||
| 661 | Ga0068868_100122075 | |||
| 662 | Ga0068868_100729074 | |||
| 663 | Ga0070660_100059129 | |||
| 664 | Ga0070660_100427750 | |||
| 665 | Ga0070660_100901746 | |||
| 666 | Ga0070689_100162242 | |||
| 667 | Ga0070689_101004883 | |||
| 668 | Ga0070691_10001259 | |||
| 669 | Ga0070687_101266598 | |||
| 670 | Ga0070661_100039205 | |||
| 671 | Ga0070692_11412092 | |||
| 672 | Ga0070671_100208533 | |||
| 673 | Ga0070674_101906446 | |||
| 674 | Ga0070673_100081542 | |||
| 675 | Ga0070688_100060318 | |||
| 676 | Ga0070667_101419831 | |||
| 677 | Ga0070709_10180816 | |||
| 678 | Ga0070709_10197378 | |||
| 679 | Ga0070714_100032417 | |||
| 680 | Ga0070714_100135373 | |||
| 681 | Ga0070713_100022680 | |||
| 682 | Ga0070713_100334447 | |||
| 683 | Ga0070713_101708355 | |||
| 684 | Ga0070710_10742643 | |||
| 685 | Ga0070711_100056027 | |||
| 686 | Ga0070711_101497112 | |||
| 687 | Ga0070662_100039883 | |||
| 688 | Ga0070681_10007276 | |||
| 689 | Ga0070681_10208431 | |||
| 690 | Ga0070681_11762657 | |||
| 691 | Ga0068867_101191933 | |||
| 692 | Ga0070707_101155601 | |||
| 693 | Ga0070698_100872766 | |||
| 694 | Ga0070679_100001789 | |||
| 695 | Ga0070679_100404890 | |||
| 696 | Ga0070679_100957199 | |||
| 697 | Ga0070684_100002783 | |||
| 698 | Ga0070684_100179844 | |||
| 699 | Ga0070684_100307615 | |||
| 700 | Ga0070684_100866838 | |||
| 701 | Ga0070697_100316313 | |||
| 702 | Ga0068853_100200237 | |||
| 703 | Ga0068853_100481261 | |||
| 704 | Ga0070686_100335649 | |||
| 705 | Ga0070686_100349292 | |||
| 706 | Ga0070686_100913855 | |||
| 707 | Ga0070686_100955136 | |||
| 708 | Ga0070695_100104208 | |||
| 709 | Ga0070696_100557007 | |||
| 710 | Ga0070693_100061059 | |||
| 711 | Ga0070693_100242164 | |||
| 712 | Ga0070665_101720413 | |||
| 713 | Ga0070665_101779905 | |||
| 714 | Ga0068855_100004869 | |||
| 715 | Ga0068855_100023679 | |||
| 716 | Ga0068855_100026535 | |||
| 717 | Ga0068855_100360759 | |||
| 718 | Ga0070664_100282152 | |||
| 719 | Ga0068857_100001612 | |||
| 720 | Ga0068857_100009382 | |||
| 721 | Ga0068857_100676920 | |||
| 722 | Ga0068857_101146378 | |||
| 723 | Ga0068854_102005828 | |||
| 724 | Ga0068856_100012289 | |||
| 725 | Ga0068856_100019017 | |||
| 726 | Ga0068856_100728386 | |||
| 727 | Ga0068856_100774912 | |||
| 728 | Ga0068856_101220833 | |||
| 729 | Ga0070702_100094529 | |||
| 730 | Ga0068852_100004525 | |||
| 731 | Ga0068852_100168015 | |||
| 732 | Ga0068852_100292318 | |||
| 733 | Ga0068859_100027428 | |||
| 734 | Ga0068859_100145442 | |||
| 735 | Ga0068859_100526900 | |||
| 736 | Ga0068859_101243976 | |||
| 737 | Ga0068859_101271773 | |||
| 738 | Ga0068859_101940320 | |||
| 739 | Ga0068864_100318632 | |||
| 740 | Ga0068864_100333418 | |||
| 741 | Ga0068864_100435805 | |||
| 742 | Ga0068864_101445179 | |||
| 743 | Ga0068866_10324807 | |||
| 744 | Ga0068866_10776610 | |||
| 745 | Ga0068851_10195082 | |||
| 746 | Ga0068870_10038276 | |||
| 747 | Ga0068863_100044516 | |||
| 748 | Ga0068863_100160229 | |||
| 749 | Ga0068863_100442137 | |||
| 750 | Ga0068863_101320735 | |||
| 751 | Ga0068863_101636479 | |||
| 752 | Ga0068863_101870258 | |||
| 753 | Ga0068858_100009783 | |||
| 754 | Ga0068858_100108173 | |||
| 755 | Ga0068858_100192373 | |||
| 756 | Ga0068858_100279010 | |||
| 757 | Ga0068858_100571508 | |||
| 758 | Ga0068858_100665248 | |||
| 759 | Ga0068858_100919776 | |||
| 760 | Ga0068860_100129395 | |||
| 761 | Ga0068860_100487708 | |||
| 762 | Ga0068860_101680370 | |||
| 763 | Ga0070717_10040840 | |||
| 764 | Ga0070717_10150053 | |||
| 765 | Ga0070717_10487923 | |||
| 766 | Ga0070717_10841074 | |||
| 767 | Ga0070717_10962933 | |||
| 768 | Ga0070712_100470575 | |||
| 769 | Ga0097621_100015235 | |||
| 770 | Ga0097621_100029068 | |||
| 771 | Ga0097621_100201250 | |||
| 772 | Ga0097621_100337440 | |||
| 773 | Ga0097621_100911060 | |||
| 774 | Ga0097621_101046822 | |||
| 775 | Ga0097621_101218312 | |||
| 776 | Ga0097621_101315306 | |||
| 777 | Ga0068871_100011639 | |||
| 778 | Ga0068871_100026768 | |||
| 779 | Ga0068871_100185595 | |||
| 780 | Ga0068871_100197482 | |||
| 781 | Ga0068871_100353211 | |||
| 782 | Ga0068871_100519838 | |||
| 783 | Ga0068871_100605282 | |||
| 784 | Ga0075431_100002512 | |||
| 785 | Ga0075434_100834704 | |||
| 786 | Ga0068865_100057083 | |||
| 787 | Ga0068865_100063642 | |||
| 788 | Ga0068865_101066788 | |||
| 789 | Ga0068865_101878591 | |||
| 790 | Ga0068865_102054500 | |||
| 791 | Ga0097620_100027428 | |||
| 792 | Ga0097620_100145440 | |||
| 793 | Ga0097620_100526956 | |||
| 794 | Ga0097620_101243522 | |||
| 795 | Ga0097620_101271477 | |||
| 796 | Ga0097620_101939982 | |||
| 797 | Ga0105250_10511649 | |||
| 798 | Ga0105240_10003870 | |||
| 799 | Ga0105240_10010503 | |||
| 800 | Ga0105240_10027576 | |||
| 801 | Ga0105240_10052210 | |||
| 802 | Ga0105240_10083955 | |||
| 803 | Ga0105240_10196374 | |||
| 804 | Ga0105240_10341100 | |||
| 805 | Ga0105240_10590999 | |||
| 806 | Ga0105240_10620795 | |||
| 807 | Ga0105240_12205025 | |||
| 808 | Ga0105245_10003881 | |||
| 809 | Ga0105245_10004978 | |||
| 810 | Ga0105245_10030136 | |||
| 811 | Ga0105245_10083978 | |||
| 812 | Ga0105245_10239033 | |||
| 813 | Ga0105245_10322605 | |||
| 814 | Ga0105245_11299414 | |||
| 815 | Ga0105245_12039189 | |||
| 816 | Ga0105247_10732893 | |||
| 817 | Ga0105247_10799340 | |||
| 818 | Ga0105243_10579780 | |||
| 819 | Ga0105243_10629477 | |||
| 820 | Ga0105243_11370321 | |||
| 821 | Ga0105241_10002492 | |||
| 822 | Ga0105241_10137159 | |||
| 823 | Ga0105241_10404678 | |||
| 824 | Ga0105241_10514868 | |||
| 825 | Ga0105241_10765011 | |||
| 826 | Ga0105241_11545024 | |||
| 827 | Ga0105242_10010023 | |||
| 828 | Ga0105242_10084466 | |||
| 829 | Ga0105242_10090563 | |||
| 830 | Ga0105242_10375259 | |||
| 831 | Ga0105242_10510581 | |||
| 832 | Ga0105242_10515963 | |||
| 833 | Ga0105242_10845468 | |||
| 834 | Ga0105242_11059402 | |||
| 835 | Ga0105242_11427112 | |||
| 836 | Ga0105242_12768378 | |||
| 837 | Ga0105248_10018110 | |||
| 838 | Ga0105248_10023469 | |||
| 839 | Ga0105248_10061312 | |||
| 840 | Ga0105248_10114265 | |||
| 841 | Ga0105248_10636445 | |||
| 842 | Ga0105248_11192244 | |||
| 843 | Ga0105248_11909055 | |||
| 844 | Ga0105248_12651213 | |||
| 845 | Ga0105237_10024427 | |||
| 846 | Ga0105237_10054043 | |||
| 847 | Ga0105237_10174413 | |||
| 848 | Ga0105237_10832498 | |||
| 849 | Ga0105237_11477522 | |||
| 850 | Ga0105237_11619610 | |||
| 851 | Ga0105237_12175149 | |||
| 852 | Ga0105238_10008917 | |||
| 853 | Ga0105238_10016712 | |||
| 854 | Ga0105238_10025381 | |||
| 855 | Ga0105238_10026524 | |||
| 856 | Ga0105238_10089653 | |||
| 857 | Ga0105238_10107885 | |||
| 858 | Ga0105238_10332648 | |||
| 859 | Ga0105238_11246701 | |||
| 860 | Ga0105249_10028818 | |||
| 861 | Ga0105249_10287542 | |||
| 862 | Ga0105249_10819880 | |||
| 863 | Ga0105249_11573700 | |||
| 864 | Ga0105239_10006055 | |||
| 865 | Ga0105239_10019753 | |||
| 866 | Ga0105239_10091500 | |||
| 867 | Ga0105239_11351404 | |||
| 868 | Ga0105246_10009670 | |||
| 869 | Ga0105246_10299447 | |||
| 870 | Ga0105246_11139919 | |||
| 871 | Ga0105246_11737218 | |||
| 872 | Ga0157373_10517935 | |||
| 873 | Ga0157370_10001341 | |||
| 874 | Ga0157370_10009436 | |||
| 875 | Ga0157370_10021566 | |||
| 876 | Ga0157370_10993657 | |||
| 877 | Ga0157370_11165626 | |||
| 878 | Ga0157369_10007122 | |||
| 879 | Ga0157369_10023682 | |||
| 880 | Ga0157369_10089316 | |||
| 881 | Ga0157374_10292627 | |||
| 882 | Ga0157374_10500019 | |||
| 883 | Ga0157374_11101472 | |||
| 884 | Ga0157374_11143856 | |||
| 885 | Ga0157374_11206929 | |||
| 886 | Ga0157374_11576739 | |||
| 887 | Ga0157378_10509096 | |||
| 888 | Ga0157378_10661803 | |||
| 889 | Ga0163162_10154092 | |||
| 890 | Ga0163162_10158510 | |||
| 891 | Ga0163162_10578578 | |||
| 892 | Ga0163162_11281107 | |||
| 893 | Ga0163162_12946955 | |||
| 894 | Ga0157372_10010533 | |||
| 895 | Ga0157372_10316516 | |||
| 896 | Ga0157372_10590181 | |||
| 897 | Ga0157372_11241732 | |||
| 898 | Ga0157372_11537859 | |||
| 899 | Ga0157375_10008109 | |||
| 900 | Ga0157375_10615720 | |||
| 901 | Ga0157375_11513848 | |||
| 902 | Ga0157375_12343138 | |||
| 903 | Ga0157375_12670088 | |||
| 904 | Ga0157375_12845779 | |||
| 905 | Ga0163163_10029227 | |||
| 906 | Ga0163163_10235639 | |||
| 907 | Ga0163163_10474372 | |||
| 908 | Ga0163163_10919231 | |||
| 909 | Ga0157380_11528279 | |||
| 910 | Ga0157380_12849176 | |||
| 911 | Ga0157379_10039223 | |||
| 912 | Ga0157379_10109053 | |||
| 913 | Ga0157379_11581951 | |||
| 914 | Ga0157379_11754689 | |||
| 915 | Ga0157376_10147744 | |||
| 916 | Ga0157376_10369617 | |||
| 917 | Ga0157376_10457491 | |||
| 918 | Ga0157376_11065804 | |||
| 919 | Ga0157376_11169784 | |||
| 920 | Ga0157376_11334009 | |||
| 921 | Ga0157376_11452333 | |||
| 922 | Ga0157376_12259284 | |||
| 923 | Ga0157376_12315753 | |||
| 924 | Ga0213876_10473410 | |||
| 925 | Ga0213875_10325466 | |||
| 926 | Ga0207656_10174965 | |||
| 927 | Ga0207642_10116173 | |||
| 928 | Ga0207642_10251009 | |||
| 929 | Ga0207680_10329756 | |||
| 930 | Ga0207699_10416266 | |||
| 931 | Ga0207699_10523621 | |||
| 932 | Ga0207645_10119948 | |||
| 933 | Ga0207645_10505496 | |||
| 934 | Ga0207654_10002572 | |||
| 935 | Ga0207654_10023078 | |||
| 936 | Ga0207654_10245452 | |||
| 937 | Ga0207654_10893132 | |||
| 938 | Ga0207707_10002413 | |||
| 939 | Ga0207695_10003003 | |||
| 940 | Ga0207695_10003666 | |||
| 941 | Ga0207695_10031742 | |||
| 942 | Ga0207695_10087451 | |||
| 943 | Ga0207695_10443646 | |||
| 944 | Ga0207695_10681209 | |||
| 945 | Ga0207695_11259396 | |||
| 946 | Ga0207695_11753020 | |||
| 947 | Ga0207671_10016255 | |||
| 948 | Ga0207671_10433821 | |||
| 949 | Ga0207663_11471102 | |||
| 950 | Ga0207660_10006741 | |||
| 951 | Ga0207657_10069153 | |||
| 952 | Ga0207657_10361457 | |||
| 953 | Ga0207649_10251985 | |||
| 954 | Ga0207652_10007211 | |||
| 955 | Ga0207694_10001140 | |||
| 956 | Ga0207694_10014490 | |||
| 957 | Ga0207694_10033238 | |||
| 958 | Ga0207694_10133369 | |||
| 959 | Ga0207694_10436933 | |||
| 960 | Ga0207694_10723215 | |||
| 961 | Ga0207650_11113870 | |||
| 962 | Ga0207659_11780957 | |||
| 963 | Ga0207687_10001618 | |||
| 964 | Ga0207687_10004164 | |||
| 965 | Ga0207687_10079039 | |||
| 966 | Ga0207687_10103748 | |||
| 967 | Ga0207687_10143448 | |||
| 968 | Ga0207687_10158611 | |||
| 969 | Ga0207687_11184702 | |||
| 970 | Ga0207700_10001426 | |||
| 971 | Ga0207700_10073664 | |||
| 972 | Ga0207700_10187819 | |||
| 973 | Ga0207700_10989185 | |||
| 974 | Ga0207664_10109035 | |||
| 975 | Ga0207644_10013017 | |||
| 976 | Ga0207706_10089073 | |||
| 977 | Ga0207686_10005228 | |||
| 978 | Ga0207686_10027819 | |||
| 979 | Ga0207686_10138239 | |||
| 980 | Ga0207686_10459630 | |||
| 981 | Ga0207686_11217806 | |||
| 982 | Ga0207709_10924961 | |||
| 983 | Ga0207670_10282510 | |||
| 984 | Ga0207670_11030223 | |||
| 985 | Ga0207669_10477747 | |||
| 986 | Ga0207704_10071640 | |||
| 987 | Ga0207704_10101730 | |||
| 988 | Ga0207704_11644444 | |||
| 989 | Ga0207691_10390052 | |||
| 990 | Ga0207711_10001497 | |||
| 991 | Ga0207711_10140324 | |||
| 992 | Ga0207711_10184377 | |||
| 993 | Ga0207711_10914893 | |||
| 994 | Ga0207711_10915945 | |||
| 995 | Ga0207689_11069811 | |||
| 996 | Ga0207661_10002033 | |||
| 997 | Ga0207661_10019538 | |||
| 998 | Ga0207661_10344501 | |||
| 999 | Ga0207661_10830515 | |||
| 1000 | Ga0207661_11090269 | |||
| 1001 | Ga0207661_11212694 | |||
| 1002 | Ga0207661_11858497 | |||
| 1003 | Ga0207679_10812984 | |||
| 1004 | Ga0207679_11029749 | |||
| 1005 | Ga0207667_10003900 | |||
| 1006 | Ga0207667_10007597 | |||
| 1007 | Ga0207651_10877455 | |||
| 1008 | Ga0207712_10018854 | |||
| 1009 | Ga0207712_10750989 | |||
| 1010 | Ga0207712_10982677 | |||
| 1011 | Ga0207640_10660257 | |||
| 1012 | Ga0207658_11272531 | |||
| 1013 | Ga0207658_11859687 | |||
| 1014 | Ga0207677_10181296 | |||
| 1015 | Ga0207677_10300557 | |||
| 1016 | Ga0207677_10426984 | |||
| 1017 | Ga0207677_11384146 | |||
| 1018 | Ga0207703_10002747 | |||
| 1019 | Ga0207703_10318925 | |||
| 1020 | Ga0207703_10824866 | |||
| 1021 | Ga0207703_10949003 | |||
| 1022 | Ga0207703_11138154 | |||
| 1023 | Ga0207639_10036659 | |||
| 1024 | Ga0207639_10048845 | |||
| 1025 | Ga0207639_10671455 | |||
| 1026 | Ga0207639_10949566 | |||
| 1027 | Ga0207702_10018859 | |||
| 1028 | Ga0207702_10022844 | |||
| 1029 | Ga0207702_10185034 | |||
| 1030 | Ga0207702_11448905 | |||
| 1031 | Ga0207702_11700750 | |||
| 1032 | Ga0207641_10818446 | |||
| 1033 | Ga0207648_10202954 | |||
| 1034 | Ga0207648_11400895 | |||
| 1035 | Ga0207648_11432465 | |||
| 1036 | Ga0207676_10488840 | |||
| 1037 | Ga0207676_11995360 | |||
| 1038 | Ga0207674_10000300 | |||
| 1039 | Ga0207674_10002379 | |||
| 1040 | Ga0207674_10911198 | |||
| 1041 | Ga0207698_10072225 | |||
| 1042 | Ga0207698_11422082 | |||
| 1043 | Ga0268266_10206708 | |||
| 1044 | Ga0268266_11962408 | |||
| 1045 | Ga0268264_10055308 | |||
| 1046 | Ga0268264_10378264 | |||
| 1047 | Ga0268264_12563544 | |||
| 1048 | Ga0265338_10281528 | |||
| 1049 | Ga0265338_10411772 | |||
| 1050 | Ga0265325_10077738 | |||
| 1051 | Ga0265325_10237697 | |||
| 1052 | Ga0265340_10018852 | |||
| 1053 | Ga0265331_10233266 | |||
| 1054 | Ga0265331_10504216 | |||
| 1055 | Ga0265316_10011521 | |||
| 1056 | Ga0265313_10056102 | |||
| 1057 | Ga0265314_10002094 | |||
| 1058 | Ga0265314_10463125 | |||
| 1059 | Ga0265342_10233930 | |||
| 1060 | Ga0373926_0273313 | |||
| 1061 | Ga0373934_0000593 | |||
| 1062 | Ga0373934_0008662 | |||
| 1063 | Ga0373940_0089370 | |||
| 1064 | Ga0373923_0081737 | |||
| 1065 | Ga0373923_0081910 | |||
| 1066 | Ga0373923_0575699 | |||
| 1067 | Ga0373953_0049137 | |||
| 1068 | Ga0373953_0115137 | |||
| 1069 | Ga0373953_0375032 | |||
| 1070 | Ga0373954_0002654 | |||
| 1071 | Ga0373954_0005175 | |||
| 1072 | Ga0373954_0047780 | |||
| 1073 | Ga0373956_0041371 | |||
| 1074 | Ga0373956_0143868 | |||
| 1075 | Ga0373956_0157268 | |||
| 1076 | Ga0373956_0334748 | |||
| 1077 | Ga0373957_0021796 | |||
| 1078 | Ga0373957_0218462 | |||
| 1079 | Ga0373957_0286150 | |||
| 1080 | Ga0373943_0004839 | |||
| 1081 | Ga0373946_0020333 | |||
| 1082 | Ga0373946_0372364 | |||
| 1083 | Ga0373955_0013233 | |||
| 1084 | Ga0373955_0025591 | |||
| 1085 | Ga0373955_0043896 | |||
| 1086 | Ga0373955_0141247 | |||
| 1087 | Ga0373961_0301422 | |||
| 1088 | Ga0373924_0250443 | |||
| 1089 | Ga0373931_0672211 | |||
| 1090 | Ga0373935_0359346 | |||
| 1091 | Ga0373927_0002053 | |||
| 1092 | Ga0373927_0076234 | |||
| 1093 | Ga0373927_0583468 | |||
| 1094 | Ga0373927_0707226 | |||
| 1095 | Ga0373927_0822356 | |||
| 1096 | Ga0373927_0889444 | |||
| 1097 | Ga0373933_0028567 | |||
| 1098 | Ga0373933_0034293 | |||
| 1099 | Ga0373933_0135407 | |||
| 1100 | Ga0373933_0329803 | |||
| 1101 | Ga0373933_0496015 | |||
| 1102 | Ga0373933_0586800 | |||
| 1103 | Ga0373933_1041464 | |||
| 1104 | Ga0373947_0388954 | |||
| 1105 | Ga0373947_0605447 | |||
| 1106 | Ga0373947_0633977 | |||
| 1107 | Ga0373947_0960738 | |||
| 1108 | Ga0373937_0013144 | |||
| 1109 | Ga0373937_0013794 | |||
| 1110 | Ga0373937_0033752 | |||
| 1111 | Ga0373937_0069874 | |||
| 1112 | Ga0373937_0335267 | |||
| 1113 | Ga0373937_0415962 | |||
| 1114 | Ga0373937_0522120 | |||
| 1115 | Ga0373937_0888920 | |||
| 1116 | Ga0373937_1108141 | |||
| 1117 | Ga0373937_1125740 | |||
| 1118 | Ga0373925_0009106 | |||
| 1119 | Ga0373925_0080542 | |||
| 1120 | Ga0373925_0128274 | |||
| 1121 | Ga0373925_1309696 | |||
| 1122 | Ga0395899_0422637 | |||
| 1123 | Ga0395900_0627616 | |||
| 1124 | Ga0395898_0609929 | |||
| 1125 | Ga0436364_0427996 | |||
| 1126 | Ga0436364_0998116 | |||
| 1127 | Ga0436364_1301028 | |||
| 1128 | Ga0436365_1919844 | |||
| 1129 | Ga0451807_1889015 | |||
| 1130 | Ga0466963_1210767 | |||
| 1131 | Ga0466971_0212521 | |||
| 1132 | Ga0466959_0136127 | |||
| 1133 | Ga0466959_0907137 | |||
| 1134 | Ga0451576_0070512 | |||
| 1135 | Ga0451576_0564616 | |||
| 1136 | Ga0451576_0596920 | |||
| 1137 | Ga0451576_1023639 | |||
| 1138 | Ga0451576_2200864 | |||
| 1139 | Ga0466958_0205148 | |||
| 1140 | Ga0466967_2266286 | |||
| 1141 | Ga0495592_0103667 | |||
| 1142 | Ga0495629_0524543 | |||
| 1143 | Ga0495651_0038251 | |||
| 1144 | Ga0495651_0038407 | |||
| 1145 | Ga0495651_0141809 | |||
| 1146 | Ga0495651_0728589 | |||
| 1147 | Ga0495653_0173846 | |||
| 1148 | Ga0495580_0004434 | |||
| 1149 | Ga0495580_0021508 | |||
| 1150 | Ga0495580_0034704 | |||
| 1151 | Ga0495580_0055520 | |||
| 1152 | Ga0495580_0183736 | |||
| 1153 | Ga0495580_0309620 | |||
| 1154 | Ga0495580_0319339 | |||
| 1155 | Ga0495580_0838780 | |||
| 1156 | Ga0495582_0056650 | |||
| 1157 | Ga0495582_0315743 | |||
| 1158 | Ga0495582_0599680 | |||
| 1159 | Ga0495639_0412778 | |||
| 1160 | Ga0495639_0424142 | |||
| 1161 | Ga0495662_0088750 | |||
| 1162 | Ga0495664_0002552 | |||
| 1163 | Ga0495664_0284274 | |||
| 1164 | Ga0495594_0083946 | |||
| 1165 | Ga0495608_0060792 | |||
| 1166 | Ga0495608_0664261 | |||
| 1167 | Ga0495608_0844791 | |||
| 1168 | Ga0495618_0213644 | |||
| 1169 | Ga0495628_0119419 | |||
| 1170 | Ga0495628_0301970 | |||
| 1171 | Ga0495628_0455094 | |||
| 1172 | Ga0495628_0932289 | |||
| 1173 | Ga0495630_0054348 | |||
| 1174 | Ga0495630_0115696 | |||
| 1175 | Ga0495666_0188398 | |||
| 1176 | Ga0495652_0015778 | |||
| 1177 | Ga0495652_0081207 | |||
| 1178 | Ga0495652_0432084 | |||
| 1179 | Ga0495665_0155696 | |||
| 1180 | Ga0495665_0505447 | |||
| 1181 | Ga0495640_0098796 | |||
| 1182 | Ga0495640_0601490 | |||
| 1183 | Ga0495640_0822335 | |||
| 1184 | Ga0495586_0189219 | |||
| 1185 | Ga0495586_0317621 | |||
| 1186 | Ga0495586_0590331 | |||
| 1187 | Ga0495587_0063820 | |||
| 1188 | Ga0495587_0087280 | |||
| 1189 | Ga0495587_0089389 | |||
| 1190 | Ga0495587_0253134 | |||
| 1191 | Ga0495587_0352128 | |||
| 1192 | Ga0495587_0453024 | |||
| 1193 | Ga0495645_0010566 | |||
| 1194 | Ga0495645_0021394 | |||
| 1195 | Ga0495645_0035507 | |||
| 1196 | Ga0495645_0066864 | |||
| 1197 | Ga0495645_0341636 | |||
| 1198 | Ga0495645_0660257 | |||
| 1199 | Ga0495645_0692388 | |||
| 1200 | Ga0495667_0052338 | |||
| 1201 | Ga0495667_0054850 | |||
| 1202 | Ga0495667_0228164 | |||
| 1203 | Ga0495667_0348296 | |||
| 1204 | Ga0495667_0377310 | |||
| 1205 | Ga0495667_0846018 | |||
| 1206 | Ga0495634_0100680 | |||
| 1207 | Ga0495635_0179125 | |||
| 1208 | Ga0495635_0989214 | |||
| 1209 | Ga0495588_0371599 | |||
| 1210 | Ga0495657_0181226 | |||
| 1211 | Ga0495657_0763942 | |||
| 1212 | Ga0495599_0002944 | |||
| 1213 | Ga0495599_0041869 | |||
| 1214 | Ga0495599_0069354 | |||
| 1215 | Ga0495599_0276718 | |||
| 1216 | Ga0495599_0402035 | |||
| 1217 | Ga0495599_0435012 | |||
| 1218 | Ga0495623_0077659 | |||
| 1219 | Ga0495623_0153177 | |||
| 1220 | Ga0495623_0167740 | |||
| 1221 | Ga0495623_0184520 | |||
| 1222 | Ga0495623_0265205 | |||
| 1223 | Ga0495623_0356940 | |||
| 1224 | Ga0495646_0015014 | |||
| 1225 | Ga0495646_0600178 | |||
| 1226 | Ga0495613_0109394 | |||
| 1227 | Ga0495613_0288216 | |||
| 1228 | Ga0495624_0619751 | |||
| 1229 | Ga0495600_0150840 | |||
| 1230 | Ga0495600_0300293 | |||
| 1231 | Ga0495604_0068721 | |||
| 1232 | Ga0495604_0356168 | |||
| 1233 | Ga0495604_1036058 | |||
| 1234 | Ga0495674_0014673 | |||
| 1235 | Ga0495674_0090870 | |||
| 1236 | Ga0495674_0129028 | |||
| 1237 | Ga0495674_0254111 | |||
| 1238 | Ga0495674_0689391 | |||
| 1239 | Ga0495674_0775361 | |||
| 1240 | Ga0495674_0793335 | |||
| 1241 | Ga0495680_0048536 | |||
| 1242 | Ga0495680_0398818 | |||
| 1243 | Ga0495675_0017626 | |||
| 1244 | Ga0495675_0184983 | |||
| 1245 | Ga0495675_0201953 | |||
| 1246 | Ga0495675_0321929 | |||
| 1247 | Ga0495677_0415099 | |||
| 1248 | Ga0495684_0004174 | |||
| 1249 | Ga0495684_0004482 | |||
| 1250 | Ga0495684_0160909 | |||
| 1251 | Ga0495684_0176220 | |||
| 1252 | Ga0495684_0185886 | |||
| 1253 | Ga0495684_0286722 | |||
| 1254 | Ga0495684_0512369 | |||
| 1255 | Ga0495684_0622303 | |||
| 1256 | Ga0495684_0930771 | |||
| 1257 | Ga0495593_0246976 | |||
| 1258 | Ga0495602_0019321 | |||
| 1259 | Ga0495602_0094336 | |||
| 1260 | Ga0495602_0155955 | |||
| 1261 | Ga0495602_0336489 | |||
| 1262 | Ga0495602_0357629 | |||
| 1263 | Ga0496104_0015651 | |||
| 1264 | Ga0496106_0900336 | |||
| 1265 | Ga0496108_0809983 | |||
| 1266 | Ga0496110_1806671 | |||
| 1267 | Ga0496112_0145535 | |||
| 1268 | Ga0496112_0165719 | |||
| 1269 | nmdc:mga06r32_133004_c1 | |||
| 1270 | nmdc:mga0n895_761281_c1 | |||
| 1271 | Ga0495601_0139198 | |||
| 1272 | Ga0495601_0568805 | |||
| 1273 | Ga0495619_0657688 | |||
| 1274 | Ga0587111_0089888 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8t5j-assembly1.cif.gz_A | crystal structure of outer membrane lipoprotein carrier protein (lola) from francisella philomiragia | 0.7075 | 5 | 28 |
| 8pii-assembly1.cif.gz_A | vhh z70 mutant 3 in interaction with phf6 tau peptide | 0.6532 | 49 | 73 |
| 6ca9-assembly2.cif.gz_D | crystal structure of fab pct64_lmca (sar), the least mutated common ancestor of the hiv-1 broadly neutralizing antibody lineage pct64 | 0.5915 | 8 | 73 |
| 2v7n-assembly4.cif.gz_H | unusual twinning in crystals of the cits binding antibody fab fragment f3p4 | 0.5906 | 8 | 73 |
| 2qr0-assembly1.cif.gz_B | structure of vegf complexed to a fab containing tyr and ser in the cdrs | 0.5895 | 8 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6P6T3_123_233_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8288 | 8 | 25 | 2.60.40.10 |
| af_Q5RHK5_4_99_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8034 | 5 | 72 | 2.30.29.30 |
| 6gq8B00 | Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain | 0.7531 | 8 | 28 | 2.60.40.730 |
| af_Q4TT88_528_617_2.60.40.1910 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.7409 | 9 | 28 | 2.60.40.1910 |
| af_I1MLI4_98_386_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.7399 | 9 | 27 | 2.120.10.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351ZU22-F1-model_v4 | Uncharacterized protein | 0.973 | 1 | 71 |
|
| AF-A0A351ZU22-F1-model_v4 | Uncharacterized protein | 0.9599 | 1 | 71 |
|
| AF-A0A7J4GQY5-F1-model_v4 | Terpene utilization protein AtuA | 0.9592 | 3 | 69 |
|
| AF-A0A3D3RUI2-F1-model_v4 | deleted | 0.9507 | 3 | 79 |
|
| AF-A0A5C6XVF3-F1-model_v4 | deleted | 0.945 | 1 | 76 |
|