F470079

General Info

Members Datasets Scaffolds Average Seq Length
622 212 1244 300

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100018841|Ga0070708_1000188415
Length 331
Sequence MPDLVLKIHHKTGGQHPAAPSPEARDVNRWEFARTLAGAALSAAALPGGXAAAETEAQSSAKGIPFKLSVMLWTVYRDLPFEQRLEKVAEAGYQAVELVDEYKNWSTEEFRRVSLKVRSLNIVFDTIAQVKSGVADPGAREAFLSDLNTLLPISEKLECPAIIVLSGNRVEGLSHDAQHQSCVETLKRAGDIAGKRNVNLLLENIDPEENPKYYLTSVAEGFEIVREVNHPRVKFLYDFYHEQISEGNLINKLEKNIGEVGLVHIADVPGRHEPGTGEINYPNIFRKLAQLRYDRYAAMEFIPTGDAVASLRAAKDMALRAVSDYDQSRVP

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.5
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 12.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100018841 3300005445 Bacteria 5782
2 JGI24748J21848_1006654 3300002074 Unclassified 1348
3 JGI24751J29686_10001218 3300002459 Bacteria 5446
4 Ga0070658_10042310 3300005327 Bacteria 3679
5 Ga0070658_10156920 3300005327 Bacteria 1908
6 Ga0070658_10273757 3300005327 Bacteria 1436
7 Ga0070658_10467618 3300005327 Bacteria 1088
8 Ga0070676_10022206 3300005328 Bacteria 3558
9 Ga0070676_10034528 3300005328 Unclassified 2904
10 Ga0070683_100000123 3300005329 Bacteria 50564
11 Ga0070683_100003626 3300005329 Bacteria 12582
12 Ga0070683_100008448 3300005329 Bacteria 8747
13 Ga0070683_100070178 3300005329 Bacteria 3268
14 Ga0070683_100082539 3300005329 Bacteria 3010
15 Ga0070683_100104425 3300005329 Unclassified 2671
16 Ga0070683_100137497 3300005329 Bacteria 2314
17 Ga0070670_100010229 3300005331 Bacteria 8006
18 Ga0070670_100044171 3300005331 Bacteria 3831
19 Ga0068869_100001040 3300005334 Bacteria 16143
20 Ga0068869_100022701 3300005334 Bacteria 4327
21 Ga0068869_100031285 3300005334 Unclassified 3743
22 Ga0070666_10010607 3300005335 Bacteria 5765
23 Ga0070680_100014398 3300005336 Bacteria 6181
24 Ga0068868_100000009 3300005338 Bacteria 120604
25 Ga0068868_100001647 3300005338 Bacteria 15239
26 Ga0068868_100009374 3300005338 Bacteria 7039
27 Ga0068868_100018929 3300005338 Bacteria 5154
28 Ga0068868_100070943 3300005338 Bacteria 2778
29 Ga0070660_100065217 3300005339 Unclassified 2834
30 Ga0070660_100315666 3300005339 Bacteria 1283
31 Ga0070689_100000550 3300005340 Bacteria 22415
32 Ga0070687_100005275 3300005343 Bacteria 5223
33 Ga0070661_100002088 3300005344 Bacteria 13748
34 Ga0070661_100012680 3300005344 Bacteria 5896
35 Ga0070661_100014220 3300005344 Bacteria 5607
36 Ga0070661_100046876 3300005344 Unclassified 3162
37 Ga0070671_100006166 3300005355 Bacteria 9549
38 Ga0070671_100008004 3300005355 Bacteria 8461
39 Ga0070674_100005283 3300005356 Bacteria 7438
40 Ga0070688_100126894 3300005365 Bacteria 1716
41 Ga0070667_100006121 3300005367 Bacteria 9997
42 Ga0070667_100022311 3300005367 Bacteria 5251
43 Ga0070703_10016723 3300005406 Bacteria 2107
44 Ga0070709_10080469 3300005434 Unclassified 2124
45 Ga0070714_100001765 3300005435 Bacteria 15771
46 Ga0070714_100228310 3300005435 Bacteria 1714
47 Ga0070713_100001361 3300005436 Bacteria 15638
48 Ga0070713_100007093 3300005436 Bacteria 7832
49 Ga0070713_100123359 3300005436 Bacteria 2275
50 Ga0070713_100124890 3300005436 Bacteria 2262
51 Ga0070711_100000814 3300005439 Bacteria 16335
52 Ga0070711_100017909 3300005439 Bacteria 4514
53 Ga0070711_100507266 3300005439 Unclassified 995
54 Ga0070705_100002589 3300005440 Bacteria 9064
55 Ga0070694_100012321 3300005444 Bacteria 5312
56 Ga0070694_100232189 3300005444 Bacteria 1388
57 Ga0070708_100000598 3300005445 Bacteria 27157
58 Ga0070708_100001014 3300005445 Bacteria 21388
59 Ga0070708_100004228 3300005445 Bacteria 11275
60 Ga0070708_100025532 3300005445 Bacteria 5051
61 Ga0070663_100007437 3300005455 Bacteria 6663
62 Ga0070678_100001151 3300005456 Bacteria 13980
63 Ga0070681_10000386 3300005458 Bacteria 35704
64 Ga0070681_10068014 3300005458 Bacteria 3530
65 Ga0068867_100001846 3300005459 Bacteria 14738
66 Ga0068867_100037763 3300005459 Unclassified 3512
67 Ga0068867_100202343 3300005459 Bacteria 1590
68 Ga0070706_100009361 3300005467 Bacteria 9121
69 Ga0070706_100010775 3300005467 Bacteria 8485
70 Ga0070706_100082190 3300005467 Unclassified 2984
71 Ga0070706_100167336 3300005467 Bacteria 2052
72 Ga0070706_100452121 3300005467 Bacteria 1195
73 Ga0070707_100000915 3300005468 Bacteria 29244
74 Ga0070698_100000140 3300005471 Bacteria 65074
75 Ga0070698_100473402 3300005471 Bacteria 1189
76 Ga0070699_100006667 3300005518 Bacteria 10040
77 Ga0070679_100223542 3300005530 Bacteria 1843
78 Ga0070684_100000771 3300005535 Bacteria 22207
79 Ga0070684_100001601 3300005535 Bacteria 16345
80 Ga0070684_100012492 3300005535 Bacteria 6809
81 Ga0070684_100053734 3300005535 Bacteria 3508
82 Ga0070684_100059437 3300005535 Bacteria 3342
83 Ga0070697_100000517 3300005536 Bacteria 29116
84 Ga0070697_100000518 3300005536 Bacteria 29110
85 Ga0070697_100001215 3300005536 Bacteria 19429
86 Ga0070697_100385169 3300005536 Unclassified 1215
87 Ga0068853_100000153 3300005539 Bacteria 47326
88 Ga0068853_100011690 3300005539 Bacteria 7135
89 Ga0068853_100028778 3300005539 Bacteria 4676
90 Ga0068853_100237940 3300005539 Bacteria 1668
91 Ga0068853_100356419 3300005539 Bacteria 1362
92 Ga0070672_100000810 3300005543 Bacteria 18654
93 Ga0070672_100003646 3300005543 Bacteria 10001
94 Ga0070686_100013161 3300005544 Bacteria 4727
95 Ga0070695_100000210 3300005545 Bacteria 28472
96 Ga0070696_100002816 3300005546 Bacteria 11551
97 Ga0070693_100000105 3300005547 Bacteria 37510
98 Ga0070693_100004582 3300005547 Bacteria 6557
99 Ga0070693_100023477 3300005547 Bacteria 3297
100 Ga0070665_100007692 3300005548 Bacteria 10943
101 Ga0070665_100011505 3300005548 Bacteria 8949
102 Ga0070704_100012473 3300005549 Bacteria 5251
103 Ga0068855_100000221 3300005563 Bacteria 72860
104 Ga0068855_100000435 3300005563 Bacteria 51721
105 Ga0068855_100000940 3300005563 Bacteria 36298
106 Ga0068855_100006922 3300005563 Bacteria 13754
107 Ga0068855_100007369 3300005563 Bacteria 13320
108 Ga0068855_100007466 3300005563 Bacteria 13242
109 Ga0068855_100029168 3300005563 Bacteria 6598
110 Ga0068855_100230702 3300005563 Unclassified 2073
111 Ga0068855_100594923 3300005563 Bacteria 1193
112 Ga0070664_100004273 3300005564 Bacteria 11488
113 Ga0070664_100016768 3300005564 Bacteria 6011
114 Ga0070664_100092762 3300005564 Bacteria 2615
115 Ga0068857_100000181 3300005577 Bacteria 40250
116 Ga0068857_100002167 3300005577 Bacteria 15964
117 Ga0068857_100002175 3300005577 Bacteria 15937
118 Ga0068857_100005202 3300005577 Bacteria 11073
119 Ga0068857_100009121 3300005577 Bacteria 8607
120 Ga0068857_100315125 3300005577 Bacteria 1444
121 Ga0068854_100007222 3300005578 Bacteria 7093
122 Ga0068854_100013344 3300005578 Bacteria 5390
123 Ga0068854_100070704 3300005578 Bacteria 2551
124 Ga0068854_100266200 3300005578 Bacteria 1374
125 Ga0068856_100000220 3300005614 Bacteria 61662
126 Ga0068856_100000907 3300005614 Bacteria 31646
127 Ga0068856_100002293 3300005614 Bacteria 19720
128 Ga0068856_100002915 3300005614 Bacteria 17518
129 Ga0068856_100014582 3300005614 Bacteria 7594
130 Ga0068856_100032675 3300005614 Bacteria 5095
131 Ga0068856_100056592 3300005614 Bacteria 3870
132 Ga0068856_100058803 3300005614 Bacteria 3797
133 Ga0070702_100000146 3300005615 Bacteria 22142
134 Ga0070702_100097026 3300005615 Bacteria 1800
135 Ga0068852_100000138 3300005616 Bacteria 48917
136 Ga0068852_100000228 3300005616 Bacteria 38051
137 Ga0068852_100026782 3300005616 Bacteria 4692
138 Ga0068852_100069299 3300005616 Bacteria 3091
139 Ga0068852_100091587 3300005616 Bacteria 2721
140 Ga0068852_100092090 3300005616 Bacteria 2714
141 Ga0068852_100120669 3300005616 Unclassified 2399
142 Ga0068852_100298603 3300005616 Bacteria 1558
143 Ga0068852_100559426 3300005616 Bacteria 1145
144 Ga0068859_100001030 3300005617 Bacteria 28559
145 Ga0068859_100026055 3300005617 Bacteria 5867
146 Ga0068859_100150441 3300005617 Unclassified 2403
147 Ga0068864_100000353 3300005618 Bacteria 40356
148 Ga0068864_100000884 3300005618 Bacteria 25258
149 Ga0068864_100010796 3300005618 Bacteria 7548
150 Ga0068864_100023282 3300005618 Bacteria 5200
151 Ga0068866_10001134 3300005718 Bacteria 11694
152 Ga0068861_100042892 3300005719 Bacteria 3392
153 Ga0068851_10001122 3300005834 Bacteria 11602
154 Ga0068851_10003714 3300005834 Bacteria 6821
155 Ga0068851_10011426 3300005834 Bacteria 4164
156 Ga0068851_10025153 3300005834 Bacteria 2919
157 Ga0068851_10072247 3300005834 Bacteria 1787
158 Ga0068863_100001556 3300005841 Bacteria 22670
159 Ga0068863_100002457 3300005841 Bacteria 18419
160 Ga0068863_100026151 3300005841 Bacteria 5569
161 Ga0068863_100111307 3300005841 Bacteria 2608
162 Ga0068858_100001451 3300005842 Bacteria 24395
163 Ga0068858_100009574 3300005842 Bacteria 9242
164 Ga0068858_100023576 3300005842 Bacteria 5733
165 Ga0068858_100029806 3300005842 Bacteria 5069
166 Ga0068858_100056669 3300005842 Bacteria 3621
167 Ga0068858_100233155 3300005842 Unclassified 1745
168 Ga0068860_100000031 3300005843 Bacteria 255068
169 Ga0068860_100059418 3300005843 Bacteria 3635
170 Ga0068860_100152654 3300005843 Bacteria 2225
171 Ga0068862_100003922 3300005844 Bacteria 12654
172 Ga0068862_100015584 3300005844 Bacteria 6314
173 Ga0070717_10004636 3300006028 Bacteria 9964
174 Ga0070717_10110388 3300006028 Bacteria 2345
175 Ga0070717_10127960 3300006028 Bacteria 2182
176 Ga0070717_10134863 3300006028 Bacteria 2125
177 Ga0070717_10168592 3300006028 Unclassified 1903
178 Ga0070716_100030143 3300006173 Bacteria 2940
179 Ga0070716_100066286 3300006173 Bacteria 2106
180 Ga0070716_100078237 3300006173 Bacteria 1966
181 Ga0070716_100131105 3300006173 Unclassified 1585
182 Ga0070716_100131811 3300006173 Bacteria 1581
183 Ga0070712_100001533 3300006175 Bacteria 14105
184 Ga0070712_100115444 3300006175 Bacteria 2012
185 Ga0070712_100460771 3300006175 Bacteria 1060
186 Ga0097621_100000061 3300006237 Bacteria 56112
187 Ga0097621_100000266 3300006237 Bacteria 35430
188 Ga0097621_100000884 3300006237 Bacteria 21017
189 Ga0097621_100001020 3300006237 Bacteria 19720
190 Ga0097621_100013453 3300006237 Bacteria 6100
191 Ga0097621_100028170 3300006237 Bacteria 4426
192 Ga0097621_100117663 3300006237 Bacteria 2252
193 Ga0068871_100000057 3300006358 Bacteria 59839
194 Ga0068871_100000366 3300006358 Bacteria 31474
195 Ga0068871_100001417 3300006358 Bacteria 16044
196 Ga0068871_100032198 3300006358 Unclassified 4140
197 Ga0068871_100057974 3300006358 Unclassified 3152
198 Ga0068871_100315651 3300006358 Unclassified 1375
199 Ga0068871_100400340 3300006358 Bacteria 1222
200 Ga0075433_10019472 3300006852 Bacteria 5656
201 Ga0075434_100000557 3300006871 Bacteria 28585
202 Ga0075434_100014725 3300006871 Bacteria 7483
203 Ga0068865_100008044 3300006881 Bacteria 6510
204 Ga0068865_100087294 3300006881 Bacteria 2254
205 Ga0068865_100135250 3300006881 Bacteria 1851
206 Ga0075436_100001700 3300006914 Bacteria 15064
207 Ga0075436_100015655 3300006914 Bacteria 5192
208 Ga0075436_100169087 3300006914 Bacteria 1543
209 Ga0075436_100217999 3300006914 Bacteria 1354
210 Ga0097620_100001030 3300006931 Bacteria 28559
211 Ga0097620_100026055 3300006931 Bacteria 5867
212 Ga0097620_100150436 3300006931 Unclassified 2403
213 Ga0075435_100002647 3300007076 Bacteria 11935
214 Ga0075435_100012362 3300007076 Bacteria 6317
215 Ga0075435_100163291 3300007076 Bacteria 1877
216 Ga0099794_10088162 3300007265 Bacteria 1538
217 Ga0105250_10015280 3300009092 Unclassified 3144
218 Ga0105240_10001634 3300009093 Bacteria 38053
219 Ga0105240_10002286 3300009093 Bacteria 31029
220 Ga0105240_10007149 3300009093 Bacteria 16262
221 Ga0105240_10008678 3300009093 Bacteria 14511
222 Ga0105240_10027444 3300009093 Bacteria 7451
223 Ga0105240_10028309 3300009093 Bacteria 7320
224 Ga0105240_10050944 3300009093 Bacteria 5214
225 Ga0105240_10056127 3300009093 Unclassified 4928
226 Ga0105240_10061188 3300009093 Bacteria 4692
227 Ga0105240_10108899 3300009093 Bacteria 3356
228 Ga0105240_10115775 3300009093 Bacteria 3235
229 Ga0105240_10388235 3300009093 Bacteria 1575
230 Ga0105240_10599545 3300009093 Bacteria 1213
231 Ga0105240_10599546 3300009093 Bacteria 1213
232 Ga0105245_10000941 3300009098 Bacteria 26440
233 Ga0105245_10002835 3300009098 Bacteria 15579
234 Ga0105245_10017110 3300009098 Bacteria 6327
235 Ga0105245_10040046 3300009098 Bacteria 4172
236 Ga0105245_10124555 3300009098 Unclassified 2411
237 Ga0105247_10002195 3300009101 Bacteria 13442
238 Ga0105247_10027059 3300009101 Unclassified 3468
239 Ga0105247_10118933 3300009101 Bacteria 1710
240 Ga0105241_10000440 3300009174 Bacteria 31306
241 Ga0105241_10002826 3300009174 Bacteria 12974
242 Ga0105241_10002913 3300009174 Bacteria 12785
243 Ga0105241_10010277 3300009174 Bacteria 6875
244 Ga0105241_10026991 3300009174 Bacteria 4274
245 Ga0105242_10002284 3300009176 Bacteria 15147
246 Ga0105248_10003224 3300009177 Bacteria 18094
247 Ga0105248_10007066 3300009177 Bacteria 12299
248 Ga0105248_10010994 3300009177 Bacteria 9986
249 Ga0105248_10012427 3300009177 Bacteria 9391
250 Ga0105248_10069040 3300009177 Unclassified 3967
251 Ga0105248_10097393 3300009177 Unclassified 3314
252 Ga0105248_10351271 3300009177 Bacteria 1660
253 Ga0105237_10000875 3300009545 Bacteria 40797
254 Ga0105237_10007475 3300009545 Bacteria 11954
255 Ga0105237_10008303 3300009545 Bacteria 11268
256 Ga0105237_10013438 3300009545 Bacteria 8587
257 Ga0105237_10045684 3300009545 Bacteria 4406
258 Ga0105237_10053084 3300009545 Bacteria 4066
259 Ga0105237_10082857 3300009545 Bacteria 3198
260 Ga0105237_10472291 3300009545 Unclassified 1260
261 Ga0105238_10000024 3300009551 Bacteria 196322
262 Ga0105238_10000277 3300009551 Bacteria 56842
263 Ga0105238_10001454 3300009551 Bacteria 23784
264 Ga0105238_10002603 3300009551 Bacteria 17989
265 Ga0105238_10020025 3300009551 Bacteria 6811
266 Ga0105238_10024558 3300009551 Bacteria 6143
267 Ga0105238_10077875 3300009551 Bacteria 3306
268 Ga0105238_10094592 3300009551 Bacteria 2976
269 Ga0105238_10402967 3300009551 Bacteria 1361
270 Ga0105249_10004042 3300009553 Bacteria 12649
271 Ga0105249_10031742 3300009553 Bacteria 4778
272 Ga0105239_10004530 3300010375 Bacteria 16572
273 Ga0105239_10006296 3300010375 Bacteria 13798
274 Ga0105239_10007006 3300010375 Bacteria 12974
275 Ga0105239_10026688 3300010375 Bacteria 6357
276 Ga0105239_10029837 3300010375 Bacteria 5997
277 Ga0105239_10034397 3300010375 Bacteria 5564
278 Ga0105239_10069815 3300010375 Bacteria 3859
279 Ga0105239_10073331 3300010375 Unclassified 3764
280 Ga0105239_10404648 3300010375 Bacteria 1545
281 Ga0105246_10000281 3300011119 Bacteria 26626
282 Ga0105246_10000581 3300011119 Bacteria 20255
283 Ga0105246_10051636 3300011119 Bacteria 2824
284 Ga0157373_10021717 3300013100 Bacteria 4658
285 Ga0157371_10031513 3300013102 Bacteria 3819
286 Ga0157371_10036607 3300013102 Unclassified 3514
287 Ga0157371_10039973 3300013102 Unclassified 3352
288 Ga0157370_10000019 3300013104 Bacteria 167473
289 Ga0157370_10037168 3300013104 Bacteria 4721
290 Ga0157369_10000253 3300013105 Bacteria 73101
291 Ga0157369_10000557 3300013105 Bacteria 48995
292 Ga0157369_10001074 3300013105 Bacteria 34243
293 Ga0157369_10005776 3300013105 Bacteria 14386
294 Ga0157369_10007147 3300013105 Bacteria 12867
295 Ga0157369_10008546 3300013105 Bacteria 11742
296 Ga0157369_10012522 3300013105 Bacteria 9623
297 Ga0157369_10069711 3300013105 Bacteria 3777
298 Ga0157369_10098843 3300013105 Unclassified 3111
299 Ga0157369_10107127 3300013105 Plasmid 2973
300 Ga0157369_10184665 3300013105 Bacteria 2193
301 Ga0157369_10269933 3300013105 Unclassified 1773
302 Ga0157369_10329328 3300013105 Bacteria 1587
303 Ga0157369_10391868 3300013105 Bacteria 1441
304 Ga0157374_10000185 3300013296 Bacteria 58240
305 Ga0157374_10000701 3300013296 Bacteria 29492
306 Ga0157374_10001003 3300013296 Bacteria 24435
307 Ga0157374_10010576 3300013296 Bacteria 7942
308 Ga0157374_10014197 3300013296 Bacteria 6965
309 Ga0157374_10120495 3300013296 Unclassified 2532
310 Ga0157374_10268663 3300013296 Bacteria 1681
311 Ga0157374_10288874 3300013296 Bacteria 1620
312 Ga0157374_10288882 3300013296 Unclassified 1620
313 Ga0157374_10374009 3300013296 Unclassified 1418
314 Ga0157378_10000030 3300013297 Bacteria 124811
315 Ga0157378_10000075 3300013297 Bacteria 90485
316 Ga0157378_10000245 3300013297 Bacteria 53230
317 Ga0157378_10001010 3300013297 Bacteria 25749
318 Ga0157378_10001246 3300013297 Bacteria 22976
319 Ga0157378_10009047 3300013297 Bacteria 8667
320 Ga0157378_10009791 3300013297 Bacteria 8354
321 Ga0157378_10027083 3300013297 Bacteria 5057
322 Ga0157378_10059087 3300013297 Unclassified 3420
323 Ga0163162_10357658 3300013306 Bacteria 1593
324 Ga0157372_10000345 3300013307 Bacteria 51193
325 Ga0157372_10000365 3300013307 Bacteria 50075
326 Ga0157372_10000684 3300013307 Bacteria 37215
327 Ga0157372_10002658 3300013307 Bacteria 19369
328 Ga0157372_10003312 3300013307 Bacteria 17402
329 Ga0157372_10003886 3300013307 Bacteria 16048
330 Ga0157372_10004890 3300013307 Bacteria 14249
331 Ga0157372_10005533 3300013307 Bacteria 13430
332 Ga0157372_10014386 3300013307 Bacteria 8461
333 Ga0157372_10028445 3300013307 Bacteria 6100
334 Ga0157372_10029274 3300013307 Bacteria 6012
335 Ga0157372_10065776 3300013307 Bacteria 4072
336 Ga0157372_10086476 3300013307 Bacteria 3557
337 Ga0157372_10116038 3300013307 Unclassified 3070
338 Ga0157372_10159664 3300013307 Bacteria 2605
339 Ga0157375_10003496 3300013308 Bacteria 13619
340 Ga0157375_10079280 3300013308 Unclassified 3319
341 Ga0157375_10100318 3300013308 Unclassified 2975
342 Ga0163163_10000237 3300014325 Bacteria 56191
343 Ga0163163_10012152 3300014325 Bacteria 7834
344 Ga0163163_10157650 3300014325 Unclassified 2314
345 Ga0163163_10230932 3300014325 Bacteria 1899
346 Ga0163163_10409906 3300014325 Bacteria 1414
347 Ga0157377_10063481 3300014745 Bacteria 2116
348 Ga0157379_10001348 3300014968 Bacteria 20081
349 Ga0157379_10053451 3300014968 Unclassified 3607
350 Ga0157379_10064293 3300014968 Bacteria 3279
351 Ga0157379_10334753 3300014968 Bacteria 1384
352 Ga0157376_10000932 3300014969 Bacteria 18996
353 Ga0157376_10001147 3300014969 Bacteria 17398
354 Ga0157376_10015889 3300014969 Bacteria 5700
355 Ga0157376_10085637 3300014969 Unclassified 2716
356 Ga0157376_10112103 3300014969 Bacteria 2403
357 Ga0182006_1049871 3300015261 Bacteria 1615
358 Ga0182007_10037775 3300015262 Bacteria 1620
359 Ga0163161_10020501 3300017792 Bacteria 4639
360 Ga0213876_10001260 3300021384 Bacteria 15980
361 Ga0213875_10000065 3300021388 Bacteria 128682
362 Ga0213875_10019927 3300021388 Unclassified 3222
363 Ga0207697_10001055 3300025315 Bacteria 15220
364 Ga0207656_10001552 3300025321 Bacteria 7621
365 Ga0207656_10003505 3300025321 Bacteria 5402
366 Ga0207656_10006294 3300025321 Bacteria 4255
367 Ga0207656_10039373 3300025321 Bacteria 1999
368 Ga0207653_10003797 3300025885 Bacteria 4756
369 Ga0207642_10010132 3300025899 Bacteria 3307
370 Ga0207710_10000866 3300025900 Bacteria 16270
371 Ga0207680_10005674 3300025903 Bacteria 5975
372 Ga0207680_10152177 3300025903 Bacteria 1543
373 Ga0207647_10002454 3300025904 Bacteria 14056
374 Ga0207647_10003179 3300025904 Bacteria 12329
375 Ga0207647_10015155 3300025904 Bacteria 5294
376 Ga0207685_10003157 3300025905 Bacteria 3951
377 Ga0207699_10000496 3300025906 Bacteria 19714
378 Ga0207699_10075464 3300025906 Unclassified 2074
379 Ga0207699_10078652 3300025906 Bacteria 2038
380 Ga0207699_10138146 3300025906 Bacteria 1598
381 Ga0207645_10000471 3300025907 Bacteria 33296
382 Ga0207645_10029063 3300025907 Bacteria 3564
383 Ga0207643_10000375 3300025908 Bacteria 30034
384 Ga0207705_10022512 3300025909 Bacteria 4493
385 Ga0207684_10001117 3300025910 Bacteria 29965
386 Ga0207684_10007311 3300025910 Bacteria 9962
387 Ga0207684_10052933 3300025910 Bacteria 3446
388 Ga0207684_10068163 3300025910 Unclassified 3024
389 Ga0207684_10377651 3300025910 Bacteria 1219
390 Ga0207654_10000078 3300025911 Bacteria 63974
391 Ga0207654_10000512 3300025911 Bacteria 22223
392 Ga0207654_10001245 3300025911 Bacteria 13563
393 Ga0207654_10172164 3300025911 Bacteria 1407
394 Ga0207654_10266550 3300025911 Bacteria 1154
395 Ga0207707_10000193 3300025912 Bacteria 64266
396 Ga0207707_10007498 3300025912 Bacteria 9506
397 Ga0207695_10000075 3300025913 Bacteria 308496
398 Ga0207695_10000115 3300025913 Bacteria 240394
399 Ga0207695_10000145 3300025913 Bacteria 209555
400 Ga0207695_10000380 3300025913 Bacteria 100840
401 Ga0207695_10001487 3300025913 Bacteria 39165
402 Ga0207695_10024584 3300025913 Bacteria 6770
403 Ga0207695_10039982 3300025913 Bacteria 5035
404 Ga0207695_10048306 3300025913 Bacteria 4495
405 Ga0207695_10059693 3300025913 Unclassified 3953
406 Ga0207695_10224300 3300025913 Unclassified 1786
407 Ga0207695_10355824 3300025913 Unclassified 1351
408 Ga0207671_10000032 3300025914 Bacteria 245878
409 Ga0207671_10000864 3300025914 Bacteria 38407
410 Ga0207671_10110312 3300025914 Unclassified 2093
411 Ga0207693_10000034 3300025915 Bacteria 113763
412 Ga0207693_10183788 3300025915 Bacteria 1645
413 Ga0207663_10009481 3300025916 Bacteria 5143
414 Ga0207663_10200046 3300025916 Bacteria 1441
415 Ga0207663_10446421 3300025916 Unclassified 997
416 Ga0207662_10006123 3300025918 Bacteria 6469
417 Ga0207657_10023403 3300025919 Bacteria 5752
418 Ga0207649_10000233 3300025920 Bacteria 45406
419 Ga0207649_10004282 3300025920 Bacteria 7764
420 Ga0207649_10226174 3300025920 Bacteria 1335
421 Ga0207652_10418548 3300025921 Bacteria 1208
422 Ga0207646_10000471 3300025922 Bacteria 53728
423 Ga0207694_10000024 3300025924 Bacteria 259443
424 Ga0207694_10000141 3300025924 Bacteria 74190
425 Ga0207694_10006088 3300025924 Bacteria 9223
426 Ga0207694_10010672 3300025924 Bacteria 6932
427 Ga0207694_10055469 3300025924 Unclassified 3076
428 Ga0207694_10093533 3300025924 Bacteria 2375
429 Ga0207694_10379218 3300025924 Bacteria 1173
430 Ga0207650_10000107 3300025925 Bacteria 109863
431 Ga0207650_10003336 3300025925 Bacteria 11045
432 Ga0207650_10011118 3300025925 Bacteria 6190
433 Ga0207659_10065323 3300025926 Bacteria 2636
434 Ga0207687_10000208 3300025927 Bacteria 39686
435 Ga0207687_10013303 3300025927 Bacteria 5372
436 Ga0207687_10058449 3300025927 Bacteria 2713
437 Ga0207687_10094829 3300025927 Unclassified 2185
438 Ga0207700_10005383 3300025928 Bacteria 7646
439 Ga0207700_10011477 3300025928 Bacteria 5650
440 Ga0207700_10023026 3300025928 Bacteria 4285
441 Ga0207700_10060974 3300025928 Bacteria 2859
442 Ga0207700_10125517 3300025928 Unclassified 2088
443 Ga0207700_10354296 3300025928 Unclassified 1278
444 Ga0207700_10427313 3300025928 Bacteria 1164
445 Ga0207664_10012069 3300025929 Bacteria 6170
446 Ga0207664_10013420 3300025929 Bacteria 5880
447 Ga0207644_10003984 3300025931 Bacteria 9592
448 Ga0207644_10004657 3300025931 Bacteria 8914
449 Ga0207690_10108367 3300025932 Unclassified 1996
450 Ga0207690_10139889 3300025932 Bacteria 1782
451 Ga0207706_10000238 3300025933 Bacteria 60595
452 Ga0207706_10005043 3300025933 Bacteria 12331
453 Ga0207706_10103093 3300025933 Bacteria 2510
454 Ga0207686_10097886 3300025934 Unclassified 1952
455 Ga0207686_10143422 3300025934 Bacteria 1654
456 Ga0207669_10163042 3300025937 Bacteria 1577
457 Ga0207704_10021428 3300025938 Bacteria 3442
458 Ga0207704_10112217 3300025938 Bacteria 1846
459 Ga0207704_10152802 3300025938 Bacteria 1631
460 Ga0207665_10048245 3300025939 Bacteria 2857
461 Ga0207665_10082773 3300025939 Unclassified 2212
462 Ga0207665_10264837 3300025939 Bacteria 1274
463 Ga0207691_10000751 3300025940 Bacteria 32082
464 Ga0207691_10001227 3300025940 Bacteria 25547
465 Ga0207711_10001686 3300025941 Bacteria 20338
466 Ga0207711_10013349 3300025941 Bacteria 6822
467 Ga0207711_10036678 3300025941 Bacteria 4161
468 Ga0207711_10076265 3300025941 Unclassified 2919
469 Ga0207711_10165567 3300025941 Bacteria 2004
470 Ga0207689_10000445 3300025942 Bacteria 38886
471 Ga0207689_10079645 3300025942 Bacteria 2692
472 Ga0207661_10000123 3300025944 Bacteria 49544
473 Ga0207661_10000138 3300025944 Bacteria 46093
474 Ga0207661_10024212 3300025944 Bacteria 4598
475 Ga0207661_10037247 3300025944 Bacteria 3803
476 Ga0207661_10062544 3300025944 Bacteria 3012
477 Ga0207661_10281204 3300025944 Bacteria 1487
478 Ga0207679_10000058 3300025945 Bacteria 101602
479 Ga0207679_10050560 3300025945 Unclassified 3038
480 Ga0207667_10001050 3300025949 Bacteria 35166
481 Ga0207667_10001118 3300025949 Bacteria 33805
482 Ga0207667_10001308 3300025949 Bacteria 31221
483 Ga0207667_10008084 3300025949 Bacteria 12538
484 Ga0207667_10480520 3300025949 Bacteria 1261
485 Ga0207651_10071930 3300025960 Unclassified 2453
486 Ga0207668_10039096 3300025972 Bacteria 3190
487 Ga0207640_10005367 3300025981 Bacteria 6992
488 Ga0207640_10066682 3300025981 Bacteria 2406
489 Ga0207640_10082974 3300025981 Unclassified 2196
490 Ga0207640_10110281 3300025981 Bacteria 1949
491 Ga0207658_10000135 3300025986 Bacteria 77651
492 Ga0207658_10013895 3300025986 Bacteria 5509
493 Ga0207677_10000034 3300026023 Bacteria 117922
494 Ga0207677_10001114 3300026023 Bacteria 14641
495 Ga0207677_10007806 3300026023 Bacteria 5941
496 Ga0207677_10175988 3300026023 Unclassified 1678
497 Ga0207677_10285544 3300026023 Unclassified 1356
498 Ga0207703_10003501 3300026035 Bacteria 13129
499 Ga0207703_10027222 3300026035 Unclassified 4502
500 Ga0207703_10088202 3300026035 Bacteria 2603
501 Ga0207703_10177189 3300026035 Bacteria 1879
502 Ga0207639_10000050 3300026041 Bacteria 121432
503 Ga0207639_10001447 3300026041 Bacteria 15977
504 Ga0207678_10001492 3300026067 Bacteria 21439
505 Ga0207678_10125405 3300026067 Bacteria 2191
506 Ga0207702_10000109 3300026078 Bacteria 95381
507 Ga0207702_10001075 3300026078 Bacteria 27960
508 Ga0207702_10001759 3300026078 Bacteria 21327
509 Ga0207702_10003441 3300026078 Bacteria 14454
510 Ga0207702_10004512 3300026078 Bacteria 12345
511 Ga0207702_10037607 3300026078 Unclassified 4052
512 Ga0207702_10087164 3300026078 Bacteria 2724
513 Ga0207702_10208352 3300026078 Unclassified 1816
514 Ga0207641_10000163 3300026088 Bacteria 94033
515 Ga0207641_10000936 3300026088 Bacteria 30120
516 Ga0207641_10005456 3300026088 Bacteria 10849
517 Ga0207648_10000604 3300026089 Bacteria 40445
518 Ga0207648_10126361 3300026089 Bacteria 2250
519 Ga0207648_10229073 3300026089 Bacteria 1653
520 Ga0207676_10000142 3300026095 Bacteria 62851
521 Ga0207676_10000571 3300026095 Bacteria 30486
522 Ga0207676_10029989 3300026095 Bacteria 4077
523 Ga0207674_10000336 3300026116 Bacteria 60214
524 Ga0207674_10001376 3300026116 Bacteria 31419
525 Ga0207674_10007697 3300026116 Bacteria 12542
526 Ga0207674_10164465 3300026116 Bacteria 2173
527 Ga0207674_10261909 3300026116 Bacteria 1676
528 Ga0207675_100078075 3300026118 Bacteria 3102
529 Ga0207683_10000432 3300026121 Bacteria 38828
530 Ga0207683_10001600 3300026121 Bacteria 20352
531 Ga0207698_10000011 3300026142 Bacteria 260352
532 Ga0207698_10000080 3300026142 Bacteria 63462
533 Ga0207698_10020900 3300026142 Bacteria 4517
534 Ga0207698_10211377 3300026142 Bacteria 1746
535 Ga0207698_10355045 3300026142 Bacteria 1386
536 Ga0268266_10002706 3300028379 Bacteria 18593
537 Ga0268266_10004001 3300028379 Bacteria 14259
538 Ga0268266_10040130 3300028379 Unclassified 3989
539 Ga0268265_10063548 3300028380 Bacteria 2840
540 Ga0268265_10172022 3300028380 Unclassified 1852
541 Ga0268264_10000240 3300028381 Bacteria 104362
542 Ga0268264_10003435 3300028381 Bacteria 13665
543 Ga0268264_10022790 3300028381 Bacteria 5110
544 Ga0268264_10198789 3300028381 Bacteria 1832
545 Ga0265338_10005812 3300028800 Bacteria 15923
546 Ga0265338_10029153 3300028800 Bacteria 5480
547 Ga0265325_10004046 3300031241 Bacteria 9359
548 Ga0265339_10001930 3300031249 Bacteria 15225
549 Ga0265313_10031235 3300031595 Bacteria 2732
550 Ga0373936_0103327 3300035113 Bacteria 1204
551 Ga0373943_0113375 3300035170 Bacteria 1432
552 Ga0373935_0064628 3300035692 Unclassified 2347
553 Ga0373933_0055163 3300035724 Bacteria 2383
554 Ga0373947_0066095 3300035725 Bacteria 2207
555 Ga0373937_0023115 3300036401 Bacteria 5594
556 Ga0373925_0002566 3300037068 Bacteria 14458
557 Ga0373925_0025240 3300037068 Bacteria 4340
558 Ga0395900_0060526 3300037418 Bacteria 3897
559 Ga0436364_0045331 3300037853 Bacteria 11242
560 Ga0436364_0579132 3300037853 Bacteria 1490
561 Ga0436364_0828992 3300037853 Bacteria 61632
562 Ga0436364_0906457 3300037853 Bacteria 5608
563 Ga0436365_1252734 3300039437 Bacteria 1849
564 Ga0436365_1400847 3300039437 Bacteria 1610
565 Ga0436365_1930386 3300039437 Bacteria 16089
566 Ga0436363_1046885 3300039450 Unclassified 1505
567 Ga0466966_0228872 3300044684 Unclassified 1122
568 Ga0466961_0161855 3300044693 Bacteria 1395
569 Ga0466963_0093713 3300044694 Bacteria 2048
570 Ga0466967_0004926 3300045976 Bacteria 9127
571 Ga0495629_0012043 3300046459 Bacteria 6269
572 Ga0495580_0016035 3300046472 Bacteria 5634
573 Ga0495580_0183317 3300046472 Bacteria 1445
574 Ga0495665_0016016 3300046531 Bacteria 4040
575 Ga0495587_0019601 3300046536 Bacteria 4185
576 Ga0495669_0059495 3300046684 Bacteria 1726
577 Ga0495613_0061292 3300046689 Bacteria 2755
578 Ga0495613_0103633 3300046689 Bacteria 2054
579 Ga0495674_0085550 3300047319 Unclassified 2701
580 Ga0495684_0133439 3300047471 Bacteria 1864
581 Ga0495602_0026421 3300048088 Bacteria 5599
582 Ga0496100_0069130 3300048903 Bacteria 2351
583 Ga0496101_0017631 3300048904 Bacteria 4844
584 Ga0496102_0193031 3300048905 Bacteria 1919
585 Ga0496102_0239773 3300048905 Bacteria 1710
586 Ga0496102_0259883 3300048905 Bacteria 1637
587 Ga0496102_0312633 3300048905 Bacteria 1480
588 Ga0496104_0090166 3300048907 Unclassified 2929
589 Ga0496104_0228276 3300048907 Bacteria 1774
590 Ga0496104_0309971 3300048907 Bacteria 1491
591 Ga0496104_0394910 3300048907 Bacteria 1295
592 Ga0496104_0494262 3300048907 Unclassified 1135
593 Ga0496105_0050583 3300048908 Unclassified 3432
594 Ga0496107_0027701 3300048910 Bacteria 4024
595 Ga0496108_0000082 3300048911 Bacteria 101998
596 Ga0496109_0000148 3300048912 Bacteria 69299
597 Ga0496109_0185913 3300048912 Bacteria 1952
598 Ga0496109_0211644 3300048912 Bacteria 1823
599 Ga0496110_0053363 3300048913 Bacteria 3554
600 Ga0496112_0000093 3300048915 Bacteria 58124
601 Ga0496112_0004736 3300048915 Bacteria 11592
602 Ga0496112_0077506 3300048915 Bacteria 3287
603 Ga0496112_0268289 3300048915 Bacteria 1655
604 Ga0496112_0571981 3300048915 Bacteria 1063
605 Ga0496114_0013186 3300048917 Bacteria 6624
606 Ga0496114_0147248 3300048917 Bacteria 2042
607 Ga0496115_0092866 3300048918 Unclassified 2467
608 Ga0496115_0125493 3300048918 Bacteria 2114
609 Ga0496115_0127511 3300048918 Bacteria 2097
610 Ga0501043_0273616 3300049579 Unclassified 1296
611 Ga0501035_0233669 3300049822 Unclassified 1566
612 Ga0501044_0000597 3300049823 Bacteria 43761
613 nmdc:mga0n895_1593_c1 3300050512 Bacteria 11144
614 nmdc:mga0n895_4050_c1 3300050512 Bacteria 11928
615 nmdc:mga0rr50_28829_c1 3300050513 Bacteria 3907
616 nmdc:mga0rr50_399_c1 3300050513 Bacteria 23614
617 nmdc:mga08x19_11669_c1 3300050514 Bacteria 5290
618 nmdc:mga08x19_12725_c1 3300050514 Bacteria 5074
619 nmdc:mga08x19_146629_c1 3300050514 Bacteria 1596
620 nmdc:mga08x19_241654_c1 3300050514 Bacteria 1245
621 nmdc:mga08x19_3330_c1 3300050514 Bacteria 5286
622 nmdc:mga0a205_649_c1 3300050515 Bacteria 8003
623 Ga0070708_100018841
624 JGI24748J21848_1006654
625 JGI24751J29686_10001218
626 Ga0070658_10042310
627 Ga0070658_10156920
628 Ga0070658_10273757
629 Ga0070658_10467618
630 Ga0070676_10022206
631 Ga0070676_10034528
632 Ga0070683_100000123
633 Ga0070683_100003626
634 Ga0070683_100008448
635 Ga0070683_100070178
636 Ga0070683_100082539
637 Ga0070683_100104425
638 Ga0070683_100137497
639 Ga0070670_100010229
640 Ga0070670_100044171
641 Ga0068869_100001040
642 Ga0068869_100022701
643 Ga0068869_100031285
644 Ga0070666_10010607
645 Ga0070680_100014398
646 Ga0068868_100000009
647 Ga0068868_100001647
648 Ga0068868_100009374
649 Ga0068868_100018929
650 Ga0068868_100070943
651 Ga0070660_100065217
652 Ga0070660_100315666
653 Ga0070689_100000550
654 Ga0070687_100005275
655 Ga0070661_100002088
656 Ga0070661_100012680
657 Ga0070661_100014220
658 Ga0070661_100046876
659 Ga0070671_100006166
660 Ga0070671_100008004
661 Ga0070674_100005283
662 Ga0070688_100126894
663 Ga0070667_100006121
664 Ga0070667_100022311
665 Ga0070703_10016723
666 Ga0070709_10080469
667 Ga0070714_100001765
668 Ga0070714_100228310
669 Ga0070713_100001361
670 Ga0070713_100007093
671 Ga0070713_100123359
672 Ga0070713_100124890
673 Ga0070711_100000814
674 Ga0070711_100017909
675 Ga0070711_100507266
676 Ga0070705_100002589
677 Ga0070694_100012321
678 Ga0070694_100232189
679 Ga0070708_100000598
680 Ga0070708_100001014
681 Ga0070708_100004228
682 Ga0070708_100025532
683 Ga0070663_100007437
684 Ga0070678_100001151
685 Ga0070681_10000386
686 Ga0070681_10068014
687 Ga0068867_100001846
688 Ga0068867_100037763
689 Ga0068867_100202343
690 Ga0070706_100009361
691 Ga0070706_100010775
692 Ga0070706_100082190
693 Ga0070706_100167336
694 Ga0070706_100452121
695 Ga0070707_100000915
696 Ga0070698_100000140
697 Ga0070698_100473402
698 Ga0070699_100006667
699 Ga0070679_100223542
700 Ga0070684_100000771
701 Ga0070684_100001601
702 Ga0070684_100012492
703 Ga0070684_100053734
704 Ga0070684_100059437
705 Ga0070697_100000517
706 Ga0070697_100000518
707 Ga0070697_100001215
708 Ga0070697_100385169
709 Ga0068853_100000153
710 Ga0068853_100011690
711 Ga0068853_100028778
712 Ga0068853_100237940
713 Ga0068853_100356419
714 Ga0070672_100000810
715 Ga0070672_100003646
716 Ga0070686_100013161
717 Ga0070695_100000210
718 Ga0070696_100002816
719 Ga0070693_100000105
720 Ga0070693_100004582
721 Ga0070693_100023477
722 Ga0070665_100007692
723 Ga0070665_100011505
724 Ga0070704_100012473
725 Ga0068855_100000221
726 Ga0068855_100000435
727 Ga0068855_100000940
728 Ga0068855_100006922
729 Ga0068855_100007369
730 Ga0068855_100007466
731 Ga0068855_100029168
732 Ga0068855_100230702
733 Ga0068855_100594923
734 Ga0070664_100004273
735 Ga0070664_100016768
736 Ga0070664_100092762
737 Ga0068857_100000181
738 Ga0068857_100002167
739 Ga0068857_100002175
740 Ga0068857_100005202
741 Ga0068857_100009121
742 Ga0068857_100315125
743 Ga0068854_100007222
744 Ga0068854_100013344
745 Ga0068854_100070704
746 Ga0068854_100266200
747 Ga0068856_100000220
748 Ga0068856_100000907
749 Ga0068856_100002293
750 Ga0068856_100002915
751 Ga0068856_100014582
752 Ga0068856_100032675
753 Ga0068856_100056592
754 Ga0068856_100058803
755 Ga0070702_100000146
756 Ga0070702_100097026
757 Ga0068852_100000138
758 Ga0068852_100000228
759 Ga0068852_100026782
760 Ga0068852_100069299
761 Ga0068852_100091587
762 Ga0068852_100092090
763 Ga0068852_100120669
764 Ga0068852_100298603
765 Ga0068852_100559426
766 Ga0068859_100001030
767 Ga0068859_100026055
768 Ga0068859_100150441
769 Ga0068864_100000353
770 Ga0068864_100000884
771 Ga0068864_100010796
772 Ga0068864_100023282
773 Ga0068866_10001134
774 Ga0068861_100042892
775 Ga0068851_10001122
776 Ga0068851_10003714
777 Ga0068851_10011426
778 Ga0068851_10025153
779 Ga0068851_10072247
780 Ga0068863_100001556
781 Ga0068863_100002457
782 Ga0068863_100026151
783 Ga0068863_100111307
784 Ga0068858_100001451
785 Ga0068858_100009574
786 Ga0068858_100023576
787 Ga0068858_100029806
788 Ga0068858_100056669
789 Ga0068858_100233155
790 Ga0068860_100000031
791 Ga0068860_100059418
792 Ga0068860_100152654
793 Ga0068862_100003922
794 Ga0068862_100015584
795 Ga0070717_10004636
796 Ga0070717_10110388
797 Ga0070717_10127960
798 Ga0070717_10134863
799 Ga0070717_10168592
800 Ga0070716_100030143
801 Ga0070716_100066286
802 Ga0070716_100078237
803 Ga0070716_100131105
804 Ga0070716_100131811
805 Ga0070712_100001533
806 Ga0070712_100115444
807 Ga0070712_100460771
808 Ga0097621_100000061
809 Ga0097621_100000266
810 Ga0097621_100000884
811 Ga0097621_100001020
812 Ga0097621_100013453
813 Ga0097621_100028170
814 Ga0097621_100117663
815 Ga0068871_100000057
816 Ga0068871_100000366
817 Ga0068871_100001417
818 Ga0068871_100032198
819 Ga0068871_100057974
820 Ga0068871_100315651
821 Ga0068871_100400340
822 Ga0075433_10019472
823 Ga0075434_100000557
824 Ga0075434_100014725
825 Ga0068865_100008044
826 Ga0068865_100087294
827 Ga0068865_100135250
828 Ga0075436_100001700
829 Ga0075436_100015655
830 Ga0075436_100169087
831 Ga0075436_100217999
832 Ga0097620_100001030
833 Ga0097620_100026055
834 Ga0097620_100150436
835 Ga0075435_100002647
836 Ga0075435_100012362
837 Ga0075435_100163291
838 Ga0099794_10088162
839 Ga0105250_10015280
840 Ga0105240_10001634
841 Ga0105240_10002286
842 Ga0105240_10007149
843 Ga0105240_10008678
844 Ga0105240_10027444
845 Ga0105240_10028309
846 Ga0105240_10050944
847 Ga0105240_10056127
848 Ga0105240_10061188
849 Ga0105240_10108899
850 Ga0105240_10115775
851 Ga0105240_10388235
852 Ga0105240_10599545
853 Ga0105240_10599546
854 Ga0105245_10000941
855 Ga0105245_10002835
856 Ga0105245_10017110
857 Ga0105245_10040046
858 Ga0105245_10124555
859 Ga0105247_10002195
860 Ga0105247_10027059
861 Ga0105247_10118933
862 Ga0105241_10000440
863 Ga0105241_10002826
864 Ga0105241_10002913
865 Ga0105241_10010277
866 Ga0105241_10026991
867 Ga0105242_10002284
868 Ga0105248_10003224
869 Ga0105248_10007066
870 Ga0105248_10010994
871 Ga0105248_10012427
872 Ga0105248_10069040
873 Ga0105248_10097393
874 Ga0105248_10351271
875 Ga0105237_10000875
876 Ga0105237_10007475
877 Ga0105237_10008303
878 Ga0105237_10013438
879 Ga0105237_10045684
880 Ga0105237_10053084
881 Ga0105237_10082857
882 Ga0105237_10472291
883 Ga0105238_10000024
884 Ga0105238_10000277
885 Ga0105238_10001454
886 Ga0105238_10002603
887 Ga0105238_10020025
888 Ga0105238_10024558
889 Ga0105238_10077875
890 Ga0105238_10094592
891 Ga0105238_10402967
892 Ga0105249_10004042
893 Ga0105249_10031742
894 Ga0105239_10004530
895 Ga0105239_10006296
896 Ga0105239_10007006
897 Ga0105239_10026688
898 Ga0105239_10029837
899 Ga0105239_10034397
900 Ga0105239_10069815
901 Ga0105239_10073331
902 Ga0105239_10404648
903 Ga0105246_10000281
904 Ga0105246_10000581
905 Ga0105246_10051636
906 Ga0157373_10021717
907 Ga0157371_10031513
908 Ga0157371_10036607
909 Ga0157371_10039973
910 Ga0157370_10000019
911 Ga0157370_10037168
912 Ga0157369_10000253
913 Ga0157369_10000557
914 Ga0157369_10001074
915 Ga0157369_10005776
916 Ga0157369_10007147
917 Ga0157369_10008546
918 Ga0157369_10012522
919 Ga0157369_10069711
920 Ga0157369_10098843
921 Ga0157369_10107127
922 Ga0157369_10184665
923 Ga0157369_10269933
924 Ga0157369_10329328
925 Ga0157369_10391868
926 Ga0157374_10000185
927 Ga0157374_10000701
928 Ga0157374_10001003
929 Ga0157374_10010576
930 Ga0157374_10014197
931 Ga0157374_10120495
932 Ga0157374_10268663
933 Ga0157374_10288874
934 Ga0157374_10288882
935 Ga0157374_10374009
936 Ga0157378_10000030
937 Ga0157378_10000075
938 Ga0157378_10000245
939 Ga0157378_10001010
940 Ga0157378_10001246
941 Ga0157378_10009047
942 Ga0157378_10009791
943 Ga0157378_10027083
944 Ga0157378_10059087
945 Ga0163162_10357658
946 Ga0157372_10000345
947 Ga0157372_10000365
948 Ga0157372_10000684
949 Ga0157372_10002658
950 Ga0157372_10003312
951 Ga0157372_10003886
952 Ga0157372_10004890
953 Ga0157372_10005533
954 Ga0157372_10014386
955 Ga0157372_10028445
956 Ga0157372_10029274
957 Ga0157372_10065776
958 Ga0157372_10086476
959 Ga0157372_10116038
960 Ga0157372_10159664
961 Ga0157375_10003496
962 Ga0157375_10079280
963 Ga0157375_10100318
964 Ga0163163_10000237
965 Ga0163163_10012152
966 Ga0163163_10157650
967 Ga0163163_10230932
968 Ga0163163_10409906
969 Ga0157377_10063481
970 Ga0157379_10001348
971 Ga0157379_10053451
972 Ga0157379_10064293
973 Ga0157379_10334753
974 Ga0157376_10000932
975 Ga0157376_10001147
976 Ga0157376_10015889
977 Ga0157376_10085637
978 Ga0157376_10112103
979 Ga0182006_1049871
980 Ga0182007_10037775
981 Ga0163161_10020501
982 Ga0213876_10001260
983 Ga0213875_10000065
984 Ga0213875_10019927
985 Ga0207697_10001055
986 Ga0207656_10001552
987 Ga0207656_10003505
988 Ga0207656_10006294
989 Ga0207656_10039373
990 Ga0207653_10003797
991 Ga0207642_10010132
992 Ga0207710_10000866
993 Ga0207680_10005674
994 Ga0207680_10152177
995 Ga0207647_10002454
996 Ga0207647_10003179
997 Ga0207647_10015155
998 Ga0207685_10003157
999 Ga0207699_10000496
1000 Ga0207699_10075464
1001 Ga0207699_10078652
1002 Ga0207699_10138146
1003 Ga0207645_10000471
1004 Ga0207645_10029063
1005 Ga0207643_10000375
1006 Ga0207705_10022512
1007 Ga0207684_10001117
1008 Ga0207684_10007311
1009 Ga0207684_10052933
1010 Ga0207684_10068163
1011 Ga0207684_10377651
1012 Ga0207654_10000078
1013 Ga0207654_10000512
1014 Ga0207654_10001245
1015 Ga0207654_10172164
1016 Ga0207654_10266550
1017 Ga0207707_10000193
1018 Ga0207707_10007498
1019 Ga0207695_10000075
1020 Ga0207695_10000115
1021 Ga0207695_10000145
1022 Ga0207695_10000380
1023 Ga0207695_10001487
1024 Ga0207695_10024584
1025 Ga0207695_10039982
1026 Ga0207695_10048306
1027 Ga0207695_10059693
1028 Ga0207695_10224300
1029 Ga0207695_10355824
1030 Ga0207671_10000032
1031 Ga0207671_10000864
1032 Ga0207671_10110312
1033 Ga0207693_10000034
1034 Ga0207693_10183788
1035 Ga0207663_10009481
1036 Ga0207663_10200046
1037 Ga0207663_10446421
1038 Ga0207662_10006123
1039 Ga0207657_10023403
1040 Ga0207649_10000233
1041 Ga0207649_10004282
1042 Ga0207649_10226174
1043 Ga0207652_10418548
1044 Ga0207646_10000471
1045 Ga0207694_10000024
1046 Ga0207694_10000141
1047 Ga0207694_10006088
1048 Ga0207694_10010672
1049 Ga0207694_10055469
1050 Ga0207694_10093533
1051 Ga0207694_10379218
1052 Ga0207650_10000107
1053 Ga0207650_10003336
1054 Ga0207650_10011118
1055 Ga0207659_10065323
1056 Ga0207687_10000208
1057 Ga0207687_10013303
1058 Ga0207687_10058449
1059 Ga0207687_10094829
1060 Ga0207700_10005383
1061 Ga0207700_10011477
1062 Ga0207700_10023026
1063 Ga0207700_10060974
1064 Ga0207700_10125517
1065 Ga0207700_10354296
1066 Ga0207700_10427313
1067 Ga0207664_10012069
1068 Ga0207664_10013420
1069 Ga0207644_10003984
1070 Ga0207644_10004657
1071 Ga0207690_10108367
1072 Ga0207690_10139889
1073 Ga0207706_10000238
1074 Ga0207706_10005043
1075 Ga0207706_10103093
1076 Ga0207686_10097886
1077 Ga0207686_10143422
1078 Ga0207669_10163042
1079 Ga0207704_10021428
1080 Ga0207704_10112217
1081 Ga0207704_10152802
1082 Ga0207665_10048245
1083 Ga0207665_10082773
1084 Ga0207665_10264837
1085 Ga0207691_10000751
1086 Ga0207691_10001227
1087 Ga0207711_10001686
1088 Ga0207711_10013349
1089 Ga0207711_10036678
1090 Ga0207711_10076265
1091 Ga0207711_10165567
1092 Ga0207689_10000445
1093 Ga0207689_10079645
1094 Ga0207661_10000123
1095 Ga0207661_10000138
1096 Ga0207661_10024212
1097 Ga0207661_10037247
1098 Ga0207661_10062544
1099 Ga0207661_10281204
1100 Ga0207679_10000058
1101 Ga0207679_10050560
1102 Ga0207667_10001050
1103 Ga0207667_10001118
1104 Ga0207667_10001308
1105 Ga0207667_10008084
1106 Ga0207667_10480520
1107 Ga0207651_10071930
1108 Ga0207668_10039096
1109 Ga0207640_10005367
1110 Ga0207640_10066682
1111 Ga0207640_10082974
1112 Ga0207640_10110281
1113 Ga0207658_10000135
1114 Ga0207658_10013895
1115 Ga0207677_10000034
1116 Ga0207677_10001114
1117 Ga0207677_10007806
1118 Ga0207677_10175988
1119 Ga0207677_10285544
1120 Ga0207703_10003501
1121 Ga0207703_10027222
1122 Ga0207703_10088202
1123 Ga0207703_10177189
1124 Ga0207639_10000050
1125 Ga0207639_10001447
1126 Ga0207678_10001492
1127 Ga0207678_10125405
1128 Ga0207702_10000109
1129 Ga0207702_10001075
1130 Ga0207702_10001759
1131 Ga0207702_10003441
1132 Ga0207702_10004512
1133 Ga0207702_10037607
1134 Ga0207702_10087164
1135 Ga0207702_10208352
1136 Ga0207641_10000163
1137 Ga0207641_10000936
1138 Ga0207641_10005456
1139 Ga0207648_10000604
1140 Ga0207648_10126361
1141 Ga0207648_10229073
1142 Ga0207676_10000142
1143 Ga0207676_10000571
1144 Ga0207676_10029989
1145 Ga0207674_10000336
1146 Ga0207674_10001376
1147 Ga0207674_10007697
1148 Ga0207674_10164465
1149 Ga0207674_10261909
1150 Ga0207675_100078075
1151 Ga0207683_10000432
1152 Ga0207683_10001600
1153 Ga0207698_10000011
1154 Ga0207698_10000080
1155 Ga0207698_10020900
1156 Ga0207698_10211377
1157 Ga0207698_10355045
1158 Ga0268266_10002706
1159 Ga0268266_10004001
1160 Ga0268266_10040130
1161 Ga0268265_10063548
1162 Ga0268265_10172022
1163 Ga0268264_10000240
1164 Ga0268264_10003435
1165 Ga0268264_10022790
1166 Ga0268264_10198789
1167 Ga0265338_10005812
1168 Ga0265338_10029153
1169 Ga0265325_10004046
1170 Ga0265339_10001930
1171 Ga0265313_10031235
1172 Ga0373936_0103327
1173 Ga0373943_0113375
1174 Ga0373935_0064628
1175 Ga0373933_0055163
1176 Ga0373947_0066095
1177 Ga0373937_0023115
1178 Ga0373925_0002566
1179 Ga0373925_0025240
1180 Ga0395900_0060526
1181 Ga0436364_0045331
1182 Ga0436364_0579132
1183 Ga0436364_0828992
1184 Ga0436364_0906457
1185 Ga0436365_1252734
1186 Ga0436365_1400847
1187 Ga0436365_1930386
1188 Ga0436363_1046885
1189 Ga0466966_0228872
1190 Ga0466961_0161855
1191 Ga0466963_0093713
1192 Ga0466967_0004926
1193 Ga0495629_0012043
1194 Ga0495580_0016035
1195 Ga0495580_0183317
1196 Ga0495665_0016016
1197 Ga0495587_0019601
1198 Ga0495669_0059495
1199 Ga0495613_0061292
1200 Ga0495613_0103633
1201 Ga0495674_0085550
1202 Ga0495684_0133439
1203 Ga0495602_0026421
1204 Ga0496100_0069130
1205 Ga0496101_0017631
1206 Ga0496102_0193031
1207 Ga0496102_0239773
1208 Ga0496102_0259883
1209 Ga0496102_0312633
1210 Ga0496104_0090166
1211 Ga0496104_0228276
1212 Ga0496104_0309971
1213 Ga0496104_0394910
1214 Ga0496104_0494262
1215 Ga0496105_0050583
1216 Ga0496107_0027701
1217 Ga0496108_0000082
1218 Ga0496109_0000148
1219 Ga0496109_0185913
1220 Ga0496109_0211644
1221 Ga0496110_0053363
1222 Ga0496112_0000093
1223 Ga0496112_0004736
1224 Ga0496112_0077506
1225 Ga0496112_0268289
1226 Ga0496112_0571981
1227 Ga0496114_0013186
1228 Ga0496114_0147248
1229 Ga0496115_0092866
1230 Ga0496115_0125493
1231 Ga0496115_0127511
1232 Ga0501043_0273616
1233 Ga0501035_0233669
1234 Ga0501044_0000597
1235 nmdc:mga0n895_1593_c1
1236 nmdc:mga0n895_4050_c1
1237 nmdc:mga0rr50_28829_c1
1238 nmdc:mga0rr50_399_c1
1239 nmdc:mga08x19_11669_c1
1240 nmdc:mga08x19_12725_c1
1241 nmdc:mga08x19_146629_c1
1242 nmdc:mga08x19_241654_c1
1243 nmdc:mga08x19_3330_c1
1244 nmdc:mga0a205_649_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

85

318

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8662 31 279
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8641 31 279
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8351 31 279
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8274 31 279
5hmq-assembly3.cif.gz_D xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein 0.8245 34 285
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8843 34 284 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8815 34 281 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8554 32 273 3.20.20.150
af_Q11185_2_259_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8474 31 279 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8468 34 281 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9SLC7-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9946 39 207 GO:0016853
AF-A0A2V9NJY5-F1-model_v4 Hydroxypyruvate isomerase 0.9503 167 290 GO:0016853
AF-B8G8E7-F1-model_v4 Xylose isomerase domain protein TIM barrel 0.9465 31 286 GO:0016853
AF-A0A2V9SLC7-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9445 39 207 GO:0016853
AF-A0A7C3TCT1-F1-model_v4 Hydroxypyruvate isomerase 0.944 151 289 GO:0016853

Map