F465940

General Info

Members Datasets Scaffolds Average Seq Length
580 232 1160 210

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10070811|Ga0157373_100708112
Length 239
Sequence MKKTSFAGVALITLVAAQETARVAVSPESKLWIEGTSNLHGWSCKATTLDAAVEIDPAAASQVAVAPPKALKKVHVKVPVKSIKCGHGGMDDNLYKALKADETPEISYILATFEAVPGEAKDTFMLHTIGSLTIAGKENKVSMDVVSTQLEDGTVKATGVVPIKMTDFGIKPPTAIFGRLKTGDEVKVNFELSVGARAIAAATNGQPYIAAGPLAALGSLPPSQRPVSSGQQLDPSGNP

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.21
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 25.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10070811 3300013100 Unclassified 2464
2 rootH1_10353377 3300003323 Unclassified 1589
3 Ga0070658_10681320 3300005327 Unclassified 892
4 Ga0070683_100008925 3300005329 Bacteria 8542
5 Ga0070683_100010061 3300005329 Bacteria 8113
6 Ga0070683_100013862 3300005329 Bacteria 7039
7 Ga0070683_100074037 3300005329 Unclassified 3180
8 Ga0070683_100801881 3300005329 Unclassified 903
9 Ga0070690_100021691 3300005330 Unclassified 3924
10 Ga0070670_100001400 3300005331 Bacteria 19347
11 Ga0070670_100089299 3300005331 Unclassified 2649
12 Ga0070670_100136594 3300005331 Bacteria 2119
13 Ga0070670_100267895 3300005331 Unclassified 1490
14 Ga0070670_100900723 3300005331 Unclassified 802
15 Ga0070677_10188591 3300005333 Bacteria 987
16 Ga0070677_10267124 3300005333 Bacteria 856
17 Ga0068869_100009713 3300005334 Bacteria 6249
18 Ga0068869_100210875 3300005334 Bacteria 1535
19 Ga0068869_100217173 3300005334 Bacteria 1514
20 Ga0070666_10032587 3300005335 Bacteria 3442
21 Ga0070666_10036697 3300005335 Bacteria 3255
22 Ga0070666_10247241 3300005335 Bacteria 1262
23 Ga0070680_100001122 3300005336 Bacteria 19235
24 Ga0070682_100015364 3300005337 Unclassified 4434
25 Ga0070682_100170545 3300005337 Bacteria 1512
26 Ga0068868_100584433 3300005338 Bacteria 988
27 Ga0068868_100965383 3300005338 Unclassified 778
28 Ga0070660_100030081 3300005339 Bacteria 4072
29 Ga0070689_100050410 3300005340 Bacteria 3216
30 Ga0070689_100073130 3300005340 Bacteria 2680
31 Ga0070687_100011574 3300005343 Unclassified 3864
32 Ga0070687_100040503 3300005343 Bacteria 2348
33 Ga0070687_100072809 3300005343 Bacteria 1850
34 Ga0070661_100003451 3300005344 Bacteria 10911
35 Ga0070692_10024612 3300005345 Bacteria 2960
36 Ga0070668_100015607 3300005347 Bacteria 5678
37 Ga0070668_100109970 3300005347 Bacteria 2193
38 Ga0070669_100065179 3300005353 Unclassified 2684
39 Ga0070669_100667528 3300005353 Bacteria 876
40 Ga0070675_100008334 3300005354 Bacteria 8042
41 Ga0070675_100021373 3300005354 Bacteria 5171
42 Ga0070675_100087708 3300005354 Bacteria 2602
43 Ga0070675_100445676 3300005354 Bacteria 1160
44 Ga0070671_100062784 3300005355 Bacteria 3093
45 Ga0070673_100036183 3300005364 Unclassified 3750
46 Ga0070673_100037339 3300005364 Unclassified 3700
47 Ga0070673_100144646 3300005364 Bacteria 2009
48 Ga0070673_100250979 3300005364 Bacteria 1542
49 Ga0070673_100458913 3300005364 Unclassified 1147
50 Ga0070688_100013961 3300005365 Bacteria 4543
51 Ga0070688_100016621 3300005365 Bacteria 4210
52 Ga0070659_100006099 3300005366 Bacteria 8699
53 Ga0070667_100037307 3300005367 Bacteria 4075
54 Ga0070667_100283345 3300005367 Unclassified 1488
55 Ga0070709_10007745 3300005434 Bacteria 5898
56 Ga0070709_10014344 3300005434 Bacteria 4481
57 Ga0070709_10220518 3300005434 Bacteria 1352
58 Ga0070709_10227621 3300005434 Unclassified 1333
59 Ga0070714_100143888 3300005435 Bacteria 2143
60 Ga0070713_100001457 3300005436 Bacteria 15099
61 Ga0070713_100336778 3300005436 Bacteria 1397
62 Ga0070710_10029526 3300005437 Bacteria 2943
63 Ga0070710_10195908 3300005437 Bacteria 1273
64 Ga0070711_100231533 3300005439 Bacteria 1440
65 Ga0070694_100562619 3300005444 Bacteria 914
66 Ga0070708_100000010 3300005445 Bacteria 137980
67 Ga0070662_100025231 3300005457 Bacteria 4103
68 Ga0070662_100125945 3300005457 Unclassified 1969
69 Ga0070681_10000867 3300005458 Bacteria 25473
70 Ga0070681_10034520 3300005458 Bacteria 5078
71 Ga0070681_10041718 3300005458 Bacteria 4600
72 Ga0070681_10114498 3300005458 Unclassified 2635
73 Ga0070681_10378664 3300005458 Bacteria 1326
74 Ga0070681_10451918 3300005458 Bacteria 1197
75 Ga0068867_100282455 3300005459 Bacteria 1362
76 Ga0070685_10032131 3300005466 Bacteria 2938
77 Ga0070685_10050879 3300005466 Bacteria 2395
78 Ga0070685_10088720 3300005466 Unclassified 1868
79 Ga0070706_100567631 3300005467 Unclassified 1055
80 Ga0070707_100220757 3300005468 Bacteria 1846
81 Ga0070698_100739924 3300005471 Unclassified 926
82 Ga0070679_100002108 3300005530 Bacteria 17913
83 Ga0070679_100008081 3300005530 Bacteria 9889
84 Ga0070679_100030492 3300005530 Bacteria 5324
85 Ga0070679_100126474 3300005530 Unclassified 2538
86 Ga0070679_100211044 3300005530 Unclassified 1905
87 Ga0070684_100002358 3300005535 Bacteria 13926
88 Ga0070684_100006404 3300005535 Bacteria 9108
89 Ga0070684_100030868 3300005535 Bacteria 4558
90 Ga0070684_100143895 3300005535 Unclassified 2157
91 Ga0070684_100180333 3300005535 Unclassified 1920
92 Ga0070684_100254301 3300005535 Bacteria 1606
93 Ga0070697_100653202 3300005536 Bacteria 926
94 Ga0070672_100062843 3300005543 Bacteria 2932
95 Ga0070672_100729378 3300005543 Bacteria 869
96 Ga0070686_100040431 3300005544 Bacteria 2909
97 Ga0070686_100145803 3300005544 Bacteria 1653
98 Ga0070686_100298506 3300005544 Unclassified 1194
99 Ga0070686_100608212 3300005544 Unclassified 862
100 Ga0070695_100116265 3300005545 Bacteria 1823
101 Ga0070665_100215477 3300005548 Bacteria 1921
102 Ga0070665_100463567 3300005548 Bacteria 1277
103 Ga0068855_100148746 3300005563 Unclassified 2664
104 Ga0068855_100180289 3300005563 Unclassified 2388
105 Ga0068855_101053867 3300005563 Unclassified 852
106 Ga0070664_100004055 3300005564 Bacteria 11768
107 Ga0070664_100028184 3300005564 Bacteria 4671
108 Ga0070664_100083794 3300005564 Unclassified 2751
109 Ga0070664_100249638 3300005564 Unclassified 1595
110 Ga0070664_100854633 3300005564 Bacteria 852
111 Ga0068857_100016640 3300005577 Bacteria 6442
112 Ga0068857_100046651 3300005577 Bacteria 3845
113 Ga0068857_100229352 3300005577 Unclassified 1698
114 Ga0068857_100308667 3300005577 Unclassified 1459
115 Ga0068856_100005942 3300005614 Bacteria 12014
116 Ga0068856_100071537 3300005614 Bacteria 3434
117 Ga0068856_100238433 3300005614 Unclassified 1834
118 Ga0070702_100010058 3300005615 Bacteria 4648
119 Ga0070702_100116442 3300005615 Bacteria 1666
120 Ga0070702_100445112 3300005615 Bacteria 938
121 Ga0068852_100159937 3300005616 Unclassified 2102
122 Ga0068852_100163319 3300005616 Bacteria 2081
123 Ga0068859_100035491 3300005617 Bacteria 5002
124 Ga0068859_100076231 3300005617 Bacteria 3394
125 Ga0068859_100090969 3300005617 Bacteria 3102
126 Ga0068859_100107067 3300005617 Bacteria 2855
127 Ga0068859_100186079 3300005617 Bacteria 2161
128 Ga0068864_100002558 3300005618 Bacteria 15026
129 Ga0068864_100105794 3300005618 Bacteria 2501
130 Ga0068864_100127973 3300005618 Bacteria 2278
131 Ga0068864_100149016 3300005618 Bacteria 2118
132 Ga0068866_10567542 3300005718 Unclassified 761
133 Ga0068861_100128589 3300005719 Bacteria 2053
134 Ga0068870_10053009 3300005840 Bacteria 2153
135 Ga0068870_10263818 3300005840 Unclassified 1073
136 Ga0068863_100009786 3300005841 Bacteria 9346
137 Ga0068858_100091332 3300005842 Unclassified 2834
138 Ga0068858_100343970 3300005842 Bacteria 1428
139 Ga0068860_100017223 3300005843 Bacteria 7042
140 Ga0068860_100030839 3300005843 Bacteria 5154
141 Ga0068860_100694612 3300005843 Bacteria 1027
142 Ga0070717_10004529 3300006028 Bacteria 10045
143 Ga0070712_100000864 3300006175 Bacteria 18046
144 Ga0070712_100178588 3300006175 Unclassified 1652
145 Ga0097621_100190820 3300006237 Unclassified 1774
146 Ga0097621_100818637 3300006237 Bacteria 864
147 Ga0068871_100034507 3300006358 Unclassified 4015
148 Ga0068871_100244300 3300006358 Unclassified 1562
149 Ga0068871_100465874 3300006358 Bacteria 1135
150 Ga0075433_10966174 3300006852 Unclassified 742
151 Ga0068865_100143078 3300006881 Bacteria 1805
152 Ga0068865_100287891 3300006881 Bacteria 1310
153 Ga0097620_100035493 3300006931 Bacteria 5002
154 Ga0097620_100076228 3300006931 Bacteria 3394
155 Ga0097620_100090966 3300006931 Bacteria 3102
156 Ga0097620_100107068 3300006931 Bacteria 2855
157 Ga0097620_100186075 3300006931 Bacteria 2161
158 Ga0075435_100761622 3300007076 Bacteria 842
159 Ga0105240_10769395 3300009093 Unclassified 1045
160 Ga0105240_11136441 3300009093 Unclassified 830
161 Ga0105245_10017624 3300009098 Bacteria 6234
162 Ga0105245_10027253 3300009098 Bacteria 5035
163 Ga0105245_10064074 3300009098 Bacteria 3321
164 Ga0105245_10199022 3300009098 Bacteria 1923
165 Ga0105245_10211847 3300009098 Bacteria 1865
166 Ga0105247_10403095 3300009101 Bacteria 975
167 Ga0105243_10041845 3300009148 Bacteria 3584
168 Ga0105243_10201012 3300009148 Bacteria 1747
169 Ga0105241_10024150 3300009174 Bacteria 4514
170 Ga0105241_10055542 3300009174 Bacteria 3034
171 Ga0105242_10038724 3300009176 Bacteria 3835
172 Ga0105242_10064059 3300009176 Unclassified 3029
173 Ga0105242_10123576 3300009176 Bacteria 2225
174 Ga0105242_10235562 3300009176 Bacteria 1643
175 Ga0105248_10007660 3300009177 Bacteria 11864
176 Ga0105248_10073452 3300009177 Bacteria 3844
177 Ga0105248_10093455 3300009177 Bacteria 3387
178 Ga0105248_10231281 3300009177 Unclassified 2081
179 Ga0105237_10384204 3300009545 Unclassified 1409
180 Ga0105238_10014182 3300009551 Bacteria 8060
181 Ga0105238_10269223 3300009551 Unclassified 1684
182 Ga0105249_10148132 3300009553 Bacteria 2257
183 Ga0105249_10237885 3300009553 Bacteria 1799
184 Ga0105239_10139630 3300010375 Bacteria 2699
185 Ga0105246_10004428 3300011119 Bacteria 8550
186 Ga0105246_10052869 3300011119 Bacteria 2793
187 Ga0105246_10233652 3300011119 Bacteria 1449
188 Ga0105246_10264047 3300011119 Bacteria 1373
189 Ga0157373_10017784 3300013100 Bacteria 5175
190 Ga0157371_10030811 3300013102 Unclassified 3866
191 Ga0157370_10001731 3300013104 Bacteria 26862
192 Ga0157370_10131910 3300013104 Unclassified 2330
193 Ga0157369_10024074 3300013105 Bacteria 6776
194 Ga0157369_10290350 3300013105 Bacteria 1702
195 Ga0157374_10002639 3300013296 Bacteria 15111
196 Ga0157374_10129501 3300013296 Bacteria 2441
197 Ga0157374_10911549 3300013296 Unclassified 897
198 Ga0157378_10265303 3300013297 Unclassified 1649
199 Ga0163162_10159444 3300013306 Unclassified 2377
200 Ga0163162_10336441 3300013306 Bacteria 1642
201 Ga0163162_10519868 3300013306 Bacteria 1320
202 Ga0157372_10003978 3300013307 Bacteria 15875
203 Ga0157372_10016507 3300013307 Bacteria 7923
204 Ga0157372_10020550 3300013307 Bacteria 7124
205 Ga0157372_10036258 3300013307 Bacteria 5435
206 Ga0157372_10097240 3300013307 Bacteria 3357
207 Ga0157372_10480169 3300013307 Unclassified 1449
208 Ga0157372_10588607 3300013307 Bacteria 1297
209 Ga0157372_10601414 3300013307 Bacteria 1282
210 Ga0157375_10013647 3300013308 Bacteria 7240
211 Ga0157375_10046869 3300013308 Unclassified 4217
212 Ga0157375_10204823 3300013308 Bacteria 2129
213 Ga0157375_10394479 3300013308 Bacteria 1551
214 Ga0163163_10023208 3300014325 Bacteria 5885
215 Ga0163163_10218690 3300014325 Unclassified 1954
216 Ga0163163_10686391 3300014325 Bacteria 1088
217 Ga0157380_10684656 3300014326 Unclassified 1028
218 Ga0157379_10387057 3300014968 Bacteria 1284
219 Ga0157379_10793481 3300014968 Bacteria 893
220 Ga0157376_10085038 3300014969 Bacteria 2725
221 Ga0157376_10269015 3300014969 Unclassified 1600
222 Ga0157376_10385965 3300014969 Bacteria 1350
223 Ga0182007_10064531 3300015262 Unclassified 1200
224 Ga0213876_10056049 3300021384 Bacteria 2080
225 Ga0207697_10038724 3300025315 Unclassified 1955
226 Ga0207697_10101938 3300025315 Bacteria 1224
227 Ga0207656_10141941 3300025321 Bacteria 1132
228 Ga0207682_10140316 3300025893 Bacteria 1084
229 Ga0207692_10105667 3300025898 Unclassified 1553
230 Ga0207692_10130160 3300025898 Bacteria 1420
231 Ga0207680_10022656 3300025903 Bacteria 3420
232 Ga0207680_10099164 3300025903 Bacteria 1869
233 Ga0207680_10516532 3300025903 Bacteria 851
234 Ga0207647_10149922 3300025904 Unclassified 1363
235 Ga0207699_10001213 3300025906 Bacteria 12231
236 Ga0207699_10153295 3300025906 Bacteria 1527
237 Ga0207699_10178124 3300025906 Unclassified 1427
238 Ga0207643_10045705 3300025908 Bacteria 2473
239 Ga0207654_10021201 3300025911 Bacteria 3452
240 Ga0207654_10316576 3300025911 Bacteria 1065
241 Ga0207707_10003905 3300025912 Bacteria 13224
242 Ga0207707_10016458 3300025912 Bacteria 6448
243 Ga0207707_10041948 3300025912 Bacteria 3995
244 Ga0207707_10170602 3300025912 Bacteria 1901
245 Ga0207707_10527005 3300025912 Bacteria 1006
246 Ga0207707_10551734 3300025912 Bacteria 979
247 Ga0207695_10113496 3300025913 Unclassified 2686
248 Ga0207671_10500308 3300025914 Bacteria 969
249 Ga0207693_10002993 3300025915 Bacteria 14621
250 Ga0207693_10040623 3300025915 Unclassified 3663
251 Ga0207693_10076997 3300025915 Bacteria 2612
252 Ga0207663_10330940 3300025916 Unclassified 1147
253 Ga0207660_10035339 3300025917 Bacteria 3469
254 Ga0207662_10037368 3300025918 Bacteria 2841
255 Ga0207662_10048199 3300025918 Bacteria 2523
256 Ga0207662_10055645 3300025918 Bacteria 2361
257 Ga0207657_10035314 3300025919 Bacteria 4484
258 Ga0207649_10005806 3300025920 Bacteria 6684
259 Ga0207652_10001960 3300025921 Bacteria 17807
260 Ga0207652_10004304 3300025921 Bacteria 11602
261 Ga0207652_10027669 3300025921 Bacteria 4726
262 Ga0207652_10064639 3300025921 Bacteria 3166
263 Ga0207652_10402911 3300025921 Bacteria 1234
264 Ga0207652_10979078 3300025921 Unclassified 744
265 Ga0207646_10191744 3300025922 Bacteria 1846
266 Ga0207681_10051418 3300025923 Unclassified 2792
267 Ga0207694_10017282 3300025924 Bacteria 5452
268 Ga0207694_10148628 3300025924 Unclassified 1887
269 Ga0207650_10001139 3300025925 Bacteria 19526
270 Ga0207650_10070535 3300025925 Bacteria 2627
271 Ga0207650_10154333 3300025925 Bacteria 1814
272 Ga0207659_10014284 3300025926 Bacteria 5115
273 Ga0207659_10072844 3300025926 Bacteria 2513
274 Ga0207659_10471278 3300025926 Unclassified 1060
275 Ga0207659_10839398 3300025926 Bacteria 790
276 Ga0207687_10011287 3300025927 Bacteria 5839
277 Ga0207687_10050875 3300025927 Bacteria 2886
278 Ga0207687_10081212 3300025927 Bacteria 2342
279 Ga0207687_10301111 3300025927 Unclassified 1292
280 Ga0207700_10000292 3300025928 Bacteria 29706
281 Ga0207700_10006328 3300025928 Bacteria 7140
282 Ga0207700_10370505 3300025928 Bacteria 1250
283 Ga0207664_10035783 3300025929 Unclassified 3833
284 Ga0207664_10195201 3300025929 Unclassified 1745
285 Ga0207644_10219863 3300025931 Unclassified 1505
286 Ga0207644_10445939 3300025931 Unclassified 1063
287 Ga0207690_10004861 3300025932 Bacteria 7925
288 Ga0207706_10205403 3300025933 Unclassified 1727
289 Ga0207686_10056130 3300025934 Bacteria 2474
290 Ga0207686_10096166 3300025934 Unclassified 1967
291 Ga0207686_10127025 3300025934 Bacteria 1744
292 Ga0207686_10147524 3300025934 Unclassified 1634
293 Ga0207709_10453245 3300025935 Bacteria 992
294 Ga0207670_10232640 3300025936 Unclassified 1416
295 Ga0207669_10031840 3300025937 Unclassified 2953
296 Ga0207669_10679078 3300025937 Unclassified 845
297 Ga0207704_10079651 3300025938 Bacteria 2112
298 Ga0207665_10113652 3300025939 Unclassified 1905
299 Ga0207691_10090458 3300025940 Bacteria 2743
300 Ga0207691_10097336 3300025940 Bacteria 2630
301 Ga0207691_10203301 3300025940 Bacteria 1723
302 Ga0207711_10036729 3300025941 Bacteria 4158
303 Ga0207711_10047981 3300025941 Bacteria 3652
304 Ga0207711_10100659 3300025941 Unclassified 2556
305 Ga0207689_10017398 3300025942 Bacteria 6084
306 Ga0207689_10049379 3300025942 Bacteria 3470
307 Ga0207689_10125868 3300025942 Bacteria 2108
308 Ga0207689_10504795 3300025942 Bacteria 1013
309 Ga0207661_10000683 3300025944 Bacteria 21998
310 Ga0207661_10005216 3300025944 Bacteria 9134
311 Ga0207661_10033202 3300025944 Bacteria 4004
312 Ga0207661_10393408 3300025944 Unclassified 1256
313 Ga0207661_10428510 3300025944 Bacteria 1202
314 Ga0207679_10003704 3300025945 Bacteria 9473
315 Ga0207679_10067816 3300025945 Bacteria 2678
316 Ga0207679_10092366 3300025945 Unclassified 2345
317 Ga0207679_10438076 3300025945 Bacteria 1157
318 Ga0207679_10478031 3300025945 Bacteria 1109
319 Ga0207679_10525450 3300025945 Bacteria 1059
320 Ga0207667_10120952 3300025949 Unclassified 2698
321 Ga0207667_10217815 3300025949 Unclassified 1956
322 Ga0207651_10095235 3300025960 Bacteria 2192
323 Ga0207651_10134158 3300025960 Bacteria 1901
324 Ga0207651_10733531 3300025960 Unclassified 872
325 Ga0207712_10044077 3300025961 Unclassified 3081
326 Ga0207712_10170833 3300025961 Bacteria 1699
327 Ga0207668_10022311 3300025972 Bacteria 4051
328 Ga0207668_10090643 3300025972 Bacteria 2245
329 Ga0207658_10074027 3300025986 Unclassified 2587
330 Ga0207658_10139152 3300025986 Bacteria 1962
331 Ga0207658_10173029 3300025986 Bacteria 1781
332 Ga0207677_10163117 3300026023 Bacteria 1734
333 Ga0207677_10612816 3300026023 Bacteria 956
334 Ga0207703_10070366 3300026035 Unclassified 2888
335 Ga0207703_10313194 3300026035 Bacteria 1435
336 Ga0207703_10461439 3300026035 Bacteria 1188
337 Ga0207703_10909836 3300026035 Unclassified 843
338 Ga0207702_10056814 3300026078 Bacteria 3324
339 Ga0207702_10076887 3300026078 Unclassified 2885
340 Ga0207702_10616891 3300026078 Unclassified 1065
341 Ga0207702_11080724 3300026078 Bacteria 796
342 Ga0207641_10144815 3300026088 Unclassified 2147
343 Ga0207641_10671471 3300026088 Bacteria 1019
344 Ga0207648_10138276 3300026089 Bacteria 2146
345 Ga0207648_10328789 3300026089 Bacteria 1375
346 Ga0207676_10004126 3300026095 Bacteria 10254
347 Ga0207676_10253697 3300026095 Bacteria 1585
348 Ga0207676_10356666 3300026095 Bacteria 1354
349 Ga0207676_10588130 3300026095 Bacteria 1068
350 Ga0207674_10000227 3300026116 Bacteria 70334
351 Ga0207674_10124328 3300026116 Unclassified 2545
352 Ga0207674_10285415 3300026116 Unclassified 1599
353 Ga0207675_100235991 3300026118 Bacteria 1766
354 Ga0207683_10168893 3300026121 Bacteria 1980
355 Ga0207698_10023732 3300026142 Bacteria 4290
356 Ga0207698_10127996 3300026142 Unclassified 2164
357 Ga0268266_10153017 3300028379 Bacteria 2081
358 Ga0268266_10320905 3300028379 Bacteria 1450
359 Ga0268265_10064491 3300028380 Unclassified 2822
360 Ga0268265_10150931 3300028380 Bacteria 1960
361 Ga0268264_10013669 3300028381 Bacteria 6682
362 Ga0268264_11111053 3300028381 Bacteria 799
363 Ga0373926_0119485 3300035083 Unclassified 993
364 Ga0373934_0004900 3300035086 Bacteria 4954
365 Ga0373934_0007272 3300035086 Unclassified 4107
366 Ga0373934_0014875 3300035086 Bacteria 2947
367 Ga0373944_0013204 3300035089 Bacteria 2287
368 Ga0373944_0040420 3300035089 Bacteria 1439
369 Ga0373923_0008256 3300035111 Bacteria 3704
370 Ga0373923_0088258 3300035111 Bacteria 1353
371 Ga0373936_0103432 3300035113 Bacteria 1203
372 Ga0373945_0003503 3300035116 Unclassified 4942
373 Ga0373945_0044386 3300035116 Unclassified 1616
374 Ga0373945_0175272 3300035116 Unclassified 880
375 Ga0373953_0004533 3300035117 Bacteria 4434
376 Ga0373954_0118290 3300035118 Unclassified 1285
377 Ga0373956_0000179 3300035119 Bacteria 24049
378 Ga0373956_0004672 3300035119 Bacteria 5473
379 Ga0373956_0037742 3300035119 Unclassified 2136
380 Ga0373957_0011047 3300035120 Bacteria 3003
381 Ga0373957_0025302 3300035120 Bacteria 2137
382 Ga0373957_0031134 3300035120 Bacteria 1959
383 Ga0373943_0014280 3300035170 Unclassified 3593
384 Ga0373946_0002875 3300035171 Bacteria 6106
385 Ga0373946_0050388 3300035171 Unclassified 1739
386 Ga0373955_0000358 3300035172 Bacteria 19171
387 Ga0373955_0003052 3300035172 Bacteria 7332
388 Ga0373955_0003905 3300035172 Bacteria 6576
389 Ga0373955_0122115 3300035172 Bacteria 1515
390 Ga0373924_0066138 3300035410 Bacteria 1519
391 Ga0373931_0004563 3300035691 Bacteria 6336
392 Ga0373935_0006557 3300035692 Bacteria 6952
393 Ga0373935_0503553 3300035692 Bacteria 879
394 Ga0373927_0005795 3300035695 Bacteria 8478
395 Ga0373927_0056607 3300035695 Unclassified 2536
396 Ga0373927_0119431 3300035695 Unclassified 1720
397 Ga0373933_0000244 3300035724 Bacteria 35858
398 Ga0373933_0003260 3300035724 Bacteria 9072
399 Ga0373933_0108335 3300035724 Bacteria 1730
400 Ga0373933_0159952 3300035724 Bacteria 1429
401 Ga0373947_0000363 3300035725 Bacteria 25602
402 Ga0373947_0003040 3300035725 Bacteria 9977
403 Ga0373947_0056304 3300035725 Bacteria 2376
404 Ga0373947_0122942 3300035725 Bacteria 1650
405 Ga0373937_0000097 3300036401 Bacteria 81932
406 Ga0373937_0006120 3300036401 Bacteria 10360
407 Ga0373937_0362569 3300036401 Bacteria 1373
408 Ga0373925_0002658 3300037068 Bacteria 14184
409 Ga0373925_0010717 3300037068 Bacteria 6649
410 Ga0373925_0117142 3300037068 Bacteria 2064
411 Ga0436365_0063202 3300039437 Bacteria 6555
412 Ga0436365_0845068 3300039437 Bacteria 2073
413 Ga0451576_0121089 3300045051 Bacteria 2724
414 Ga0451576_0268890 3300045051 Unclassified 1782
415 Ga0466967_0143473 3300045976 Bacteria 2226
416 Ga0466967_0320354 3300045976 Bacteria 1495
417 Ga0495592_0005389 3300046454 Bacteria 9441
418 Ga0495592_0041293 3300046454 Bacteria 3457
419 Ga0495592_0069621 3300046454 Bacteria 2565
420 Ga0495592_0149512 3300046454 Bacteria 1616
421 Ga0495603_0039471 3300046455 Unclassified 2828
422 Ga0495603_0105760 3300046455 Bacteria 1642
423 Ga0495629_0009676 3300046459 Bacteria 7041
424 Ga0495629_0114574 3300046459 Bacteria 1879
425 Ga0495629_0135742 3300046459 Bacteria 1713
426 Ga0495629_0173594 3300046459 Unclassified 1495
427 Ga0495651_0004393 3300046462 Bacteria 10794
428 Ga0495651_0004560 3300046462 Bacteria 10590
429 Ga0495651_0009621 3300046462 Bacteria 7427
430 Ga0495651_0045807 3300046462 Bacteria 3387
431 Ga0495653_0000026 3300046463 Bacteria 154862
432 Ga0495653_0008082 3300046463 Bacteria 8616
433 Ga0495653_0029886 3300046463 Bacteria 4343
434 Ga0495580_0001285 3300046472 Bacteria 22128
435 Ga0495580_0011100 3300046472 Bacteria 6981
436 Ga0495580_0019576 3300046472 Bacteria 5028
437 Ga0495580_0055542 3300046472 Bacteria 2790
438 Ga0495580_0064886 3300046472 Bacteria 2558
439 Ga0495582_0002149 3300046473 Bacteria 11025
440 Ga0495582_0017982 3300046473 Bacteria 3865
441 Ga0495582_0128426 3300046473 Bacteria 1431
442 Ga0495582_0151708 3300046473 Bacteria 1316
443 Ga0495582_0167453 3300046473 Bacteria 1250
444 Ga0495639_0000374 3300046475 Bacteria 21644
445 Ga0495639_0001274 3300046475 Bacteria 11336
446 Ga0495639_0020508 3300046475 Bacteria 2888
447 Ga0495664_0099526 3300046477 Bacteria 1751
448 Ga0495664_0257685 3300046477 Unclassified 1055
449 Ga0495594_0005931 3300046499 Bacteria 6280
450 Ga0495594_0024480 3300046499 Bacteria 3243
451 Ga0495594_0046042 3300046499 Bacteria 2395
452 Ga0495594_0073546 3300046499 Unclassified 1903
453 Ga0495594_0139235 3300046499 Bacteria 1376
454 Ga0495608_0000117 3300046511 Bacteria 56601
455 Ga0495608_0037061 3300046511 Unclassified 3280
456 Ga0495608_0075099 3300046511 Bacteria 2203
457 Ga0495608_0089578 3300046511 Unclassified 1991
458 Ga0495628_0004521 3300046516 Bacteria 12324
459 Ga0495628_0062939 3300046516 Unclassified 2907
460 Ga0495628_0208473 3300046516 Unclassified 1470
461 Ga0495630_0003103 3300046517 Bacteria 11519
462 Ga0495630_0008353 3300046517 Bacteria 7433
463 Ga0495630_0013568 3300046517 Bacteria 5925
464 Ga0495630_0048114 3300046517 Bacteria 3191
465 Ga0495630_0057705 3300046517 Bacteria 2910
466 Ga0495630_0059216 3300046517 Bacteria 2873
467 Ga0495666_0028644 3300046526 Bacteria 2740
468 Ga0495666_0050517 3300046526 Bacteria 1999
469 Ga0495652_0008022 3300046529 Bacteria 9680
470 Ga0495652_0022038 3300046529 Bacteria 5658
471 Ga0495652_0090674 3300046529 Bacteria 2500
472 Ga0495665_0000281 3300046531 Bacteria 25893
473 Ga0495665_0008791 3300046531 Bacteria 5482
474 Ga0495665_0020315 3300046531 Bacteria 3568
475 Ga0495665_0053460 3300046531 Unclassified 2135
476 Ga0495665_0200345 3300046531 Bacteria 1035
477 Ga0495586_0007181 3300046535 Bacteria 5941
478 Ga0495586_0146276 3300046535 Unclassified 1328
479 Ga0495587_0000554 3300046536 Bacteria 25771
480 Ga0495587_0003963 3300046536 Bacteria 9817
481 Ga0495587_0008018 3300046536 Bacteria 6818
482 Ga0495587_0017772 3300046536 Unclassified 4411
483 Ga0495645_0000083 3300046543 Bacteria 64874
484 Ga0495645_0000342 3300046543 Bacteria 33033
485 Ga0495645_0002178 3300046543 Bacteria 13317
486 Ga0495645_0040730 3300046543 Bacteria 3388
487 Ga0495645_0103419 3300046543 Bacteria 2023
488 Ga0495667_0012791 3300046559 Bacteria 5686
489 Ga0495667_0013565 3300046559 Bacteria 5513
490 Ga0495667_0014181 3300046559 Bacteria 5380
491 Ga0495667_0019678 3300046559 Bacteria 4554
492 Ga0495667_0222260 3300046559 Unclassified 1205
493 Ga0495667_0242728 3300046559 Bacteria 1147
494 Ga0495634_0082269 3300046642 Bacteria 2104
495 Ga0495634_0421199 3300046642 Unclassified 791
496 Ga0495635_0000279 3300046663 Bacteria 32802
497 Ga0495635_0200039 3300046663 Bacteria 1355
498 Ga0495588_0020035 3300046674 Unclassified 3281
499 Ga0495588_0135484 3300046674 Unclassified 1300
500 Ga0495657_0000100 3300046675 Bacteria 76416
501 Ga0495599_0000191 3300046678 Bacteria 40630
502 Ga0495599_0002635 3300046678 Bacteria 10456
503 Ga0495599_0004555 3300046678 Bacteria 8217
504 Ga0495599_0019601 3300046678 Unclassified 4217
505 Ga0495623_0000088 3300046679 Bacteria 54273
506 Ga0495623_0005239 3300046679 Bacteria 8505
507 Ga0495623_0006681 3300046679 Bacteria 7506
508 Ga0495623_0008164 3300046679 Bacteria 6806
509 Ga0495623_0203363 3300046679 Bacteria 1137
510 Ga0495646_0000382 3300046680 Bacteria 23147
511 Ga0495646_0105074 3300046680 Bacteria 1614
512 Ga0495647_0207419 3300046681 Unclassified 861
513 Ga0495658_0000303 3300046683 Bacteria 27912
514 Ga0495658_0005303 3300046683 Bacteria 6342
515 Ga0495658_0028343 3300046683 Unclassified 3022
516 Ga0495613_0014178 3300046689 Bacteria 5913
517 Ga0495613_0032246 3300046689 Unclassified 3891
518 Ga0495613_0040548 3300046689 Bacteria 3450
519 Ga0495613_0185014 3300046689 Bacteria 1474
520 Ga0495600_0000106 3300046809 Bacteria 46369
521 Ga0495581_0007104 3300047315 Bacteria 6484
522 Ga0495581_0007466 3300047315 Bacteria 6324
523 Ga0495581_0030201 3300047315 Bacteria 3141
524 Ga0495581_0193158 3300047315 Bacteria 1191
525 Ga0495581_0271997 3300047315 Bacteria 990
526 Ga0495604_0000088 3300047317 Bacteria 78169
527 Ga0495604_0084127 3300047317 Bacteria 2376
528 Ga0495604_0158974 3300047317 Unclassified 1598
529 Ga0495604_0479865 3300047317 Unclassified 809
530 Ga0495674_0000203 3300047319 Bacteria 48439
531 Ga0495674_0039585 3300047319 Bacteria 4224
532 Ga0495674_0092062 3300047319 Bacteria 2589
533 Ga0495680_0007524 3300047322 Bacteria 9970
534 Ga0495675_0003235 3300047444 Bacteria 9790
535 Ga0495675_0003561 3300047444 Bacteria 9391
536 Ga0495675_0006526 3300047444 Bacteria 7140
537 Ga0495675_0024889 3300047444 Unclassified 3818
538 Ga0495675_0069231 3300047444 Bacteria 2228
539 Ga0495684_0000038 3300047471 Bacteria 104215
540 Ga0495684_0005036 3300047471 Bacteria 10310
541 Ga0495684_0012528 3300047471 Bacteria 6535
542 Ga0495684_0019280 3300047471 Bacteria 5252
543 Ga0495684_0034735 3300047471 Bacteria 3868
544 Ga0495684_0070453 3300047471 Bacteria 2658
545 Ga0495684_0168285 3300047471 Bacteria 1631
546 Ga0495593_0000264 3300047673 Bacteria 28418
547 Ga0495593_0004728 3300047673 Bacteria 8093
548 Ga0495602_0000087 3300048088 Bacteria 89869
549 Ga0495602_0014001 3300048088 Bacteria 8164
550 Ga0495602_0070622 3300048088 Unclassified 2987
551 Ga0495602_0287855 3300048088 Bacteria 1207
552 Ga0495614_0000012 3300048089 Bacteria 58103
553 Ga0495614_0026526 3300048089 Bacteria 2497
554 Ga0496104_0034405 3300048907 Bacteria 4725
555 Ga0496104_0138490 3300048907 Bacteria 2339
556 Ga0496105_0382919 3300048908 Bacteria 1119
557 Ga0496110_0954171 3300048913 Unclassified 764
558 Ga0496111_0143322 3300048914 Bacteria 1771
559 Ga0496112_0031253 3300048915 Bacteria 5162
560 Ga0496113_0334507 3300048916 Bacteria 1214
561 Ga0501034_0159001 3300049571 Bacteria 2232
562 Ga0501043_0434117 3300049579 Unclassified 989
563 Ga0501070_0350343 3300049586 Bacteria 1198
564 nmdc:mga0n895_140643_c1 3300050512 Unclassified 2442
565 nmdc:mga0n895_305608_c1 3300050512 Unclassified 1612
566 nmdc:mga0n895_452604_c1 3300050512 Unclassified 1296
567 nmdc:mga08x19_100749_c1 3300050514 Bacteria 1916
568 Ga0495601_0017098 3300053077 Bacteria 4401
569 Ga0495601_0085636 3300053077 Bacteria 2025
570 Ga0495601_0087659 3300053077 Unclassified 2001
571 Ga0495601_0126903 3300053077 Bacteria 1660
572 Ga0495612_0000823 3300053078 Bacteria 12622
573 Ga0495612_0037250 3300053078 Bacteria 1975
574 Ga0495619_0001475 3300053085 Bacteria 15515
575 Ga0495619_0049007 3300053085 Unclassified 2784
576 Ga0495619_0051526 3300053085 Bacteria 2720
577 Ga0495619_0053271 3300053085 Bacteria 2676
578 Ga0495619_0078251 3300053085 Bacteria 2223
579 Ga0495619_0444728 3300053085 Unclassified 894
580 Ga0500641_0147869 3300053096 Bacteria 1015
581 Ga0157373_10070811
582 rootH1_10353377
583 Ga0070658_10681320
584 Ga0070683_100008925
585 Ga0070683_100010061
586 Ga0070683_100013862
587 Ga0070683_100074037
588 Ga0070683_100801881
589 Ga0070690_100021691
590 Ga0070670_100001400
591 Ga0070670_100089299
592 Ga0070670_100136594
593 Ga0070670_100267895
594 Ga0070670_100900723
595 Ga0070677_10188591
596 Ga0070677_10267124
597 Ga0068869_100009713
598 Ga0068869_100210875
599 Ga0068869_100217173
600 Ga0070666_10032587
601 Ga0070666_10036697
602 Ga0070666_10247241
603 Ga0070680_100001122
604 Ga0070682_100015364
605 Ga0070682_100170545
606 Ga0068868_100584433
607 Ga0068868_100965383
608 Ga0070660_100030081
609 Ga0070689_100050410
610 Ga0070689_100073130
611 Ga0070687_100011574
612 Ga0070687_100040503
613 Ga0070687_100072809
614 Ga0070661_100003451
615 Ga0070692_10024612
616 Ga0070668_100015607
617 Ga0070668_100109970
618 Ga0070669_100065179
619 Ga0070669_100667528
620 Ga0070675_100008334
621 Ga0070675_100021373
622 Ga0070675_100087708
623 Ga0070675_100445676
624 Ga0070671_100062784
625 Ga0070673_100036183
626 Ga0070673_100037339
627 Ga0070673_100144646
628 Ga0070673_100250979
629 Ga0070673_100458913
630 Ga0070688_100013961
631 Ga0070688_100016621
632 Ga0070659_100006099
633 Ga0070667_100037307
634 Ga0070667_100283345
635 Ga0070709_10007745
636 Ga0070709_10014344
637 Ga0070709_10220518
638 Ga0070709_10227621
639 Ga0070714_100143888
640 Ga0070713_100001457
641 Ga0070713_100336778
642 Ga0070710_10029526
643 Ga0070710_10195908
644 Ga0070711_100231533
645 Ga0070694_100562619
646 Ga0070708_100000010
647 Ga0070662_100025231
648 Ga0070662_100125945
649 Ga0070681_10000867
650 Ga0070681_10034520
651 Ga0070681_10041718
652 Ga0070681_10114498
653 Ga0070681_10378664
654 Ga0070681_10451918
655 Ga0068867_100282455
656 Ga0070685_10032131
657 Ga0070685_10050879
658 Ga0070685_10088720
659 Ga0070706_100567631
660 Ga0070707_100220757
661 Ga0070698_100739924
662 Ga0070679_100002108
663 Ga0070679_100008081
664 Ga0070679_100030492
665 Ga0070679_100126474
666 Ga0070679_100211044
667 Ga0070684_100002358
668 Ga0070684_100006404
669 Ga0070684_100030868
670 Ga0070684_100143895
671 Ga0070684_100180333
672 Ga0070684_100254301
673 Ga0070697_100653202
674 Ga0070672_100062843
675 Ga0070672_100729378
676 Ga0070686_100040431
677 Ga0070686_100145803
678 Ga0070686_100298506
679 Ga0070686_100608212
680 Ga0070695_100116265
681 Ga0070665_100215477
682 Ga0070665_100463567
683 Ga0068855_100148746
684 Ga0068855_100180289
685 Ga0068855_101053867
686 Ga0070664_100004055
687 Ga0070664_100028184
688 Ga0070664_100083794
689 Ga0070664_100249638
690 Ga0070664_100854633
691 Ga0068857_100016640
692 Ga0068857_100046651
693 Ga0068857_100229352
694 Ga0068857_100308667
695 Ga0068856_100005942
696 Ga0068856_100071537
697 Ga0068856_100238433
698 Ga0070702_100010058
699 Ga0070702_100116442
700 Ga0070702_100445112
701 Ga0068852_100159937
702 Ga0068852_100163319
703 Ga0068859_100035491
704 Ga0068859_100076231
705 Ga0068859_100090969
706 Ga0068859_100107067
707 Ga0068859_100186079
708 Ga0068864_100002558
709 Ga0068864_100105794
710 Ga0068864_100127973
711 Ga0068864_100149016
712 Ga0068866_10567542
713 Ga0068861_100128589
714 Ga0068870_10053009
715 Ga0068870_10263818
716 Ga0068863_100009786
717 Ga0068858_100091332
718 Ga0068858_100343970
719 Ga0068860_100017223
720 Ga0068860_100030839
721 Ga0068860_100694612
722 Ga0070717_10004529
723 Ga0070712_100000864
724 Ga0070712_100178588
725 Ga0097621_100190820
726 Ga0097621_100818637
727 Ga0068871_100034507
728 Ga0068871_100244300
729 Ga0068871_100465874
730 Ga0075433_10966174
731 Ga0068865_100143078
732 Ga0068865_100287891
733 Ga0097620_100035493
734 Ga0097620_100076228
735 Ga0097620_100090966
736 Ga0097620_100107068
737 Ga0097620_100186075
738 Ga0075435_100761622
739 Ga0105240_10769395
740 Ga0105240_11136441
741 Ga0105245_10017624
742 Ga0105245_10027253
743 Ga0105245_10064074
744 Ga0105245_10199022
745 Ga0105245_10211847
746 Ga0105247_10403095
747 Ga0105243_10041845
748 Ga0105243_10201012
749 Ga0105241_10024150
750 Ga0105241_10055542
751 Ga0105242_10038724
752 Ga0105242_10064059
753 Ga0105242_10123576
754 Ga0105242_10235562
755 Ga0105248_10007660
756 Ga0105248_10073452
757 Ga0105248_10093455
758 Ga0105248_10231281
759 Ga0105237_10384204
760 Ga0105238_10014182
761 Ga0105238_10269223
762 Ga0105249_10148132
763 Ga0105249_10237885
764 Ga0105239_10139630
765 Ga0105246_10004428
766 Ga0105246_10052869
767 Ga0105246_10233652
768 Ga0105246_10264047
769 Ga0157373_10017784
770 Ga0157371_10030811
771 Ga0157370_10001731
772 Ga0157370_10131910
773 Ga0157369_10024074
774 Ga0157369_10290350
775 Ga0157374_10002639
776 Ga0157374_10129501
777 Ga0157374_10911549
778 Ga0157378_10265303
779 Ga0163162_10159444
780 Ga0163162_10336441
781 Ga0163162_10519868
782 Ga0157372_10003978
783 Ga0157372_10016507
784 Ga0157372_10020550
785 Ga0157372_10036258
786 Ga0157372_10097240
787 Ga0157372_10480169
788 Ga0157372_10588607
789 Ga0157372_10601414
790 Ga0157375_10013647
791 Ga0157375_10046869
792 Ga0157375_10204823
793 Ga0157375_10394479
794 Ga0163163_10023208
795 Ga0163163_10218690
796 Ga0163163_10686391
797 Ga0157380_10684656
798 Ga0157379_10387057
799 Ga0157379_10793481
800 Ga0157376_10085038
801 Ga0157376_10269015
802 Ga0157376_10385965
803 Ga0182007_10064531
804 Ga0213876_10056049
805 Ga0207697_10038724
806 Ga0207697_10101938
807 Ga0207656_10141941
808 Ga0207682_10140316
809 Ga0207692_10105667
810 Ga0207692_10130160
811 Ga0207680_10022656
812 Ga0207680_10099164
813 Ga0207680_10516532
814 Ga0207647_10149922
815 Ga0207699_10001213
816 Ga0207699_10153295
817 Ga0207699_10178124
818 Ga0207643_10045705
819 Ga0207654_10021201
820 Ga0207654_10316576
821 Ga0207707_10003905
822 Ga0207707_10016458
823 Ga0207707_10041948
824 Ga0207707_10170602
825 Ga0207707_10527005
826 Ga0207707_10551734
827 Ga0207695_10113496
828 Ga0207671_10500308
829 Ga0207693_10002993
830 Ga0207693_10040623
831 Ga0207693_10076997
832 Ga0207663_10330940
833 Ga0207660_10035339
834 Ga0207662_10037368
835 Ga0207662_10048199
836 Ga0207662_10055645
837 Ga0207657_10035314
838 Ga0207649_10005806
839 Ga0207652_10001960
840 Ga0207652_10004304
841 Ga0207652_10027669
842 Ga0207652_10064639
843 Ga0207652_10402911
844 Ga0207652_10979078
845 Ga0207646_10191744
846 Ga0207681_10051418
847 Ga0207694_10017282
848 Ga0207694_10148628
849 Ga0207650_10001139
850 Ga0207650_10070535
851 Ga0207650_10154333
852 Ga0207659_10014284
853 Ga0207659_10072844
854 Ga0207659_10471278
855 Ga0207659_10839398
856 Ga0207687_10011287
857 Ga0207687_10050875
858 Ga0207687_10081212
859 Ga0207687_10301111
860 Ga0207700_10000292
861 Ga0207700_10006328
862 Ga0207700_10370505
863 Ga0207664_10035783
864 Ga0207664_10195201
865 Ga0207644_10219863
866 Ga0207644_10445939
867 Ga0207690_10004861
868 Ga0207706_10205403
869 Ga0207686_10056130
870 Ga0207686_10096166
871 Ga0207686_10127025
872 Ga0207686_10147524
873 Ga0207709_10453245
874 Ga0207670_10232640
875 Ga0207669_10031840
876 Ga0207669_10679078
877 Ga0207704_10079651
878 Ga0207665_10113652
879 Ga0207691_10090458
880 Ga0207691_10097336
881 Ga0207691_10203301
882 Ga0207711_10036729
883 Ga0207711_10047981
884 Ga0207711_10100659
885 Ga0207689_10017398
886 Ga0207689_10049379
887 Ga0207689_10125868
888 Ga0207689_10504795
889 Ga0207661_10000683
890 Ga0207661_10005216
891 Ga0207661_10033202
892 Ga0207661_10393408
893 Ga0207661_10428510
894 Ga0207679_10003704
895 Ga0207679_10067816
896 Ga0207679_10092366
897 Ga0207679_10438076
898 Ga0207679_10478031
899 Ga0207679_10525450
900 Ga0207667_10120952
901 Ga0207667_10217815
902 Ga0207651_10095235
903 Ga0207651_10134158
904 Ga0207651_10733531
905 Ga0207712_10044077
906 Ga0207712_10170833
907 Ga0207668_10022311
908 Ga0207668_10090643
909 Ga0207658_10074027
910 Ga0207658_10139152
911 Ga0207658_10173029
912 Ga0207677_10163117
913 Ga0207677_10612816
914 Ga0207703_10070366
915 Ga0207703_10313194
916 Ga0207703_10461439
917 Ga0207703_10909836
918 Ga0207702_10056814
919 Ga0207702_10076887
920 Ga0207702_10616891
921 Ga0207702_11080724
922 Ga0207641_10144815
923 Ga0207641_10671471
924 Ga0207648_10138276
925 Ga0207648_10328789
926 Ga0207676_10004126
927 Ga0207676_10253697
928 Ga0207676_10356666
929 Ga0207676_10588130
930 Ga0207674_10000227
931 Ga0207674_10124328
932 Ga0207674_10285415
933 Ga0207675_100235991
934 Ga0207683_10168893
935 Ga0207698_10023732
936 Ga0207698_10127996
937 Ga0268266_10153017
938 Ga0268266_10320905
939 Ga0268265_10064491
940 Ga0268265_10150931
941 Ga0268264_10013669
942 Ga0268264_11111053
943 Ga0373926_0119485
944 Ga0373934_0004900
945 Ga0373934_0007272
946 Ga0373934_0014875
947 Ga0373944_0013204
948 Ga0373944_0040420
949 Ga0373923_0008256
950 Ga0373923_0088258
951 Ga0373936_0103432
952 Ga0373945_0003503
953 Ga0373945_0044386
954 Ga0373945_0175272
955 Ga0373953_0004533
956 Ga0373954_0118290
957 Ga0373956_0000179
958 Ga0373956_0004672
959 Ga0373956_0037742
960 Ga0373957_0011047
961 Ga0373957_0025302
962 Ga0373957_0031134
963 Ga0373943_0014280
964 Ga0373946_0002875
965 Ga0373946_0050388
966 Ga0373955_0000358
967 Ga0373955_0003052
968 Ga0373955_0003905
969 Ga0373955_0122115
970 Ga0373924_0066138
971 Ga0373931_0004563
972 Ga0373935_0006557
973 Ga0373935_0503553
974 Ga0373927_0005795
975 Ga0373927_0056607
976 Ga0373927_0119431
977 Ga0373933_0000244
978 Ga0373933_0003260
979 Ga0373933_0108335
980 Ga0373933_0159952
981 Ga0373947_0000363
982 Ga0373947_0003040
983 Ga0373947_0056304
984 Ga0373947_0122942
985 Ga0373937_0000097
986 Ga0373937_0006120
987 Ga0373937_0362569
988 Ga0373925_0002658
989 Ga0373925_0010717
990 Ga0373925_0117142
991 Ga0436365_0063202
992 Ga0436365_0845068
993 Ga0451576_0121089
994 Ga0451576_0268890
995 Ga0466967_0143473
996 Ga0466967_0320354
997 Ga0495592_0005389
998 Ga0495592_0041293
999 Ga0495592_0069621
1000 Ga0495592_0149512
1001 Ga0495603_0039471
1002 Ga0495603_0105760
1003 Ga0495629_0009676
1004 Ga0495629_0114574
1005 Ga0495629_0135742
1006 Ga0495629_0173594
1007 Ga0495651_0004393
1008 Ga0495651_0004560
1009 Ga0495651_0009621
1010 Ga0495651_0045807
1011 Ga0495653_0000026
1012 Ga0495653_0008082
1013 Ga0495653_0029886
1014 Ga0495580_0001285
1015 Ga0495580_0011100
1016 Ga0495580_0019576
1017 Ga0495580_0055542
1018 Ga0495580_0064886
1019 Ga0495582_0002149
1020 Ga0495582_0017982
1021 Ga0495582_0128426
1022 Ga0495582_0151708
1023 Ga0495582_0167453
1024 Ga0495639_0000374
1025 Ga0495639_0001274
1026 Ga0495639_0020508
1027 Ga0495664_0099526
1028 Ga0495664_0257685
1029 Ga0495594_0005931
1030 Ga0495594_0024480
1031 Ga0495594_0046042
1032 Ga0495594_0073546
1033 Ga0495594_0139235
1034 Ga0495608_0000117
1035 Ga0495608_0037061
1036 Ga0495608_0075099
1037 Ga0495608_0089578
1038 Ga0495628_0004521
1039 Ga0495628_0062939
1040 Ga0495628_0208473
1041 Ga0495630_0003103
1042 Ga0495630_0008353
1043 Ga0495630_0013568
1044 Ga0495630_0048114
1045 Ga0495630_0057705
1046 Ga0495630_0059216
1047 Ga0495666_0028644
1048 Ga0495666_0050517
1049 Ga0495652_0008022
1050 Ga0495652_0022038
1051 Ga0495652_0090674
1052 Ga0495665_0000281
1053 Ga0495665_0008791
1054 Ga0495665_0020315
1055 Ga0495665_0053460
1056 Ga0495665_0200345
1057 Ga0495586_0007181
1058 Ga0495586_0146276
1059 Ga0495587_0000554
1060 Ga0495587_0003963
1061 Ga0495587_0008018
1062 Ga0495587_0017772
1063 Ga0495645_0000083
1064 Ga0495645_0000342
1065 Ga0495645_0002178
1066 Ga0495645_0040730
1067 Ga0495645_0103419
1068 Ga0495667_0012791
1069 Ga0495667_0013565
1070 Ga0495667_0014181
1071 Ga0495667_0019678
1072 Ga0495667_0222260
1073 Ga0495667_0242728
1074 Ga0495634_0082269
1075 Ga0495634_0421199
1076 Ga0495635_0000279
1077 Ga0495635_0200039
1078 Ga0495588_0020035
1079 Ga0495588_0135484
1080 Ga0495657_0000100
1081 Ga0495599_0000191
1082 Ga0495599_0002635
1083 Ga0495599_0004555
1084 Ga0495599_0019601
1085 Ga0495623_0000088
1086 Ga0495623_0005239
1087 Ga0495623_0006681
1088 Ga0495623_0008164
1089 Ga0495623_0203363
1090 Ga0495646_0000382
1091 Ga0495646_0105074
1092 Ga0495647_0207419
1093 Ga0495658_0000303
1094 Ga0495658_0005303
1095 Ga0495658_0028343
1096 Ga0495613_0014178
1097 Ga0495613_0032246
1098 Ga0495613_0040548
1099 Ga0495613_0185014
1100 Ga0495600_0000106
1101 Ga0495581_0007104
1102 Ga0495581_0007466
1103 Ga0495581_0030201
1104 Ga0495581_0193158
1105 Ga0495581_0271997
1106 Ga0495604_0000088
1107 Ga0495604_0084127
1108 Ga0495604_0158974
1109 Ga0495604_0479865
1110 Ga0495674_0000203
1111 Ga0495674_0039585
1112 Ga0495674_0092062
1113 Ga0495680_0007524
1114 Ga0495675_0003235
1115 Ga0495675_0003561
1116 Ga0495675_0006526
1117 Ga0495675_0024889
1118 Ga0495675_0069231
1119 Ga0495684_0000038
1120 Ga0495684_0005036
1121 Ga0495684_0012528
1122 Ga0495684_0019280
1123 Ga0495684_0034735
1124 Ga0495684_0070453
1125 Ga0495684_0168285
1126 Ga0495593_0000264
1127 Ga0495593_0004728
1128 Ga0495602_0000087
1129 Ga0495602_0014001
1130 Ga0495602_0070622
1131 Ga0495602_0287855
1132 Ga0495614_0000012
1133 Ga0495614_0026526
1134 Ga0496104_0034405
1135 Ga0496104_0138490
1136 Ga0496105_0382919
1137 Ga0496110_0954171
1138 Ga0496111_0143322
1139 Ga0496112_0031253
1140 Ga0496113_0334507
1141 Ga0501034_0159001
1142 Ga0501043_0434117
1143 Ga0501070_0350343
1144 nmdc:mga0n895_140643_c1
1145 nmdc:mga0n895_305608_c1
1146 nmdc:mga0n895_452604_c1
1147 nmdc:mga08x19_100749_c1
1148 Ga0495601_0017098
1149 Ga0495601_0085636
1150 Ga0495601_0087659
1151 Ga0495601_0126903
1152 Ga0495612_0000823
1153 Ga0495612_0037250
1154 Ga0495619_0001475
1155 Ga0495619_0049007
1156 Ga0495619_0051526
1157 Ga0495619_0053271
1158 Ga0495619_0078251
1159 Ga0495619_0444728
1160 Ga0500641_0147869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

18

194

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8135 34 195
3zg5-assembly2.cif.gz_B crystal structure of pbp2a from mrsa in complex with peptidoglycan analogue at allosteric 0.7828 112 154
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.7756 34 195
5w2d-assembly1.cif.gz_A crystal structure of mutant cj ycei protein (cj-g34c) for nanotechnology applications 0.7741 40 196
5w17-assembly1.cif.gz_A crystal structure of campylobacter jejuni ycei protein that crystallizes with large solvent channels for nanotechnology applications 0.7703 40 196
ID Description Score Start End Superfamily
af_A0A0P0WCA8_24_155_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.781 112 154 3.10.450.50
3ub1A02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7782 111 154 3.10.450.540
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7749 41 196 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7568 33 194 2.40.128.110
af_O07742_26_201_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.7547 24 196 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A520IPY0-F1-model_v4 YceI family protein 0.9533 86 194
AF-A0A0D3LNV8-F1-model_v4 tRNA modification GTPase 0.9353 24 196
AF-A0A5Q4FNK9-F1-model_v4 YceI family protein 0.9301 37 195
AF-A0A2S7WF29-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9276 24 196
AF-A0A645DG93-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9275 37 196

Map