F465212

General Info

Members Datasets Scaffolds Average Seq Length
573 234 1146 300

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_3226734|Ga0451853_3226734_621_1631
Length 336
Sequence LVRGRRILTDRGEPEWRKRAAQFDRTSAQQSYNRRMITSGVLAAIHARLALELAPPTSALRPLRIDGVAAGWVDDVRATRLAKFGDVFDVAADCIVFAVGIDDCASRTTAMARVARVLADDGLLTRWRDERYAVAHEFGAEPWFELERAASRYFGVLTHAAHVNGLVHRSDGGIAMWIARRSDTKAIDPGMLDNLVGGGIAAGQSVASTVIKEAFEEAGIDALVASQAIGAGKVHICREQPDGVQRETIFVHDLWLSEDFVPECRDGEAVEHRLVSLHEAAALIANSERPDAVTADASLVILDCLLRHNIITADAPLRRPLETLRIARHARCACSS

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
234 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.7
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.71
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 4.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_3226734 3300041512 Bacteria 1720
2 Ga0070676_10000358 3300005328 Bacteria 20978
3 Ga0070676_10083650 3300005328 Bacteria 1941
4 Ga0070683_100067258 3300005329 Bacteria 3337
5 Ga0070683_100260826 3300005329 Unclassified 1648
6 Ga0070690_100095108 3300005330 Bacteria 1967
7 Ga0070670_100002937 3300005331 Bacteria 14114
8 Ga0070670_100056080 3300005331 Bacteria 3381
9 Ga0070670_100125322 3300005331 Bacteria 2217
10 Ga0070670_100166728 3300005331 Bacteria 1910
11 Ga0070677_10000715 3300005333 Bacteria 11122
12 Ga0068869_100074106 3300005334 Bacteria 2526
13 Ga0068869_100151781 3300005334 Bacteria 1797
14 Ga0070666_10011863 3300005335 Bacteria 5481
15 Ga0070666_10145902 3300005335 Bacteria 1649
16 Ga0070666_10173149 3300005335 Bacteria 1512
17 Ga0070680_100085513 3300005336 Bacteria 2606
18 Ga0068868_100001448 3300005338 Bacteria 16365
19 Ga0068868_100124054 3300005338 Bacteria 2108
20 Ga0070660_100015753 3300005339 Bacteria 5468
21 Ga0070689_100012543 3300005340 Bacteria 6109
22 Ga0070689_100153310 3300005340 Bacteria 1859
23 Ga0070661_100003862 3300005344 Bacteria 10309
24 Ga0070661_100165298 3300005344 Bacteria 1678
25 Ga0070661_100259350 3300005344 Bacteria 1343
26 Ga0070692_10064650 3300005345 Bacteria 1935
27 Ga0070668_100020281 3300005347 Bacteria 5015
28 Ga0070668_100072910 3300005347 Bacteria 2676
29 Ga0070668_100087024 3300005347 Bacteria 2458
30 Ga0070668_100090685 3300005347 Bacteria 2408
31 Ga0070668_100090720 3300005347 Bacteria 2408
32 Ga0070668_100091241 3300005347 Bacteria 2401
33 Ga0070668_100117135 3300005347 Bacteria 2125
34 Ga0070668_100181813 3300005347 Bacteria 1718
35 Ga0070668_100275891 3300005347 Unclassified 1403
36 Ga0070669_100012541 3300005353 Bacteria 6011
37 Ga0070669_100072736 3300005353 Bacteria 2546
38 Ga0070669_100123137 3300005353 Bacteria 1981
39 Ga0070669_100183642 3300005353 Bacteria 1638
40 Ga0070669_100192956 3300005353 Bacteria 1599
41 Ga0070675_100000127 3300005354 Bacteria 45462
42 Ga0070675_100005058 3300005354 Bacteria 10070
43 Ga0070675_100009286 3300005354 Bacteria 7646
44 Ga0070671_100000385 3300005355 Bacteria 30358
45 Ga0070671_100003327 3300005355 Bacteria 12542
46 Ga0070671_100012985 3300005355 Bacteria 6711
47 Ga0070671_100168647 3300005355 Bacteria 1851
48 Ga0070671_100218884 3300005355 Bacteria 1615
49 Ga0070674_100000120 3300005356 Bacteria 35826
50 Ga0070674_100000959 3300005356 Bacteria 15042
51 Ga0070674_100021346 3300005356 Bacteria 4154
52 Ga0070673_100000167 3300005364 Bacteria 31804
53 Ga0070673_100000465 3300005364 Bacteria 21543
54 Ga0070673_100019052 3300005364 Bacteria 4922
55 Ga0070673_100022994 3300005364 Bacteria 4548
56 Ga0070673_100227831 3300005364 Bacteria 1616
57 Ga0070688_100001497 3300005365 Bacteria 11642
58 Ga0070688_100001532 3300005365 Bacteria 11550
59 Ga0070688_100070006 3300005365 Bacteria 2242
60 Ga0070659_100000182 3300005366 Bacteria 48054
61 Ga0070659_100033827 3300005366 Bacteria 3973
62 Ga0070659_100174282 3300005366 Unclassified 1763
63 Ga0070659_100368111 3300005366 Unclassified 1209
64 Ga0070667_100001635 3300005367 Bacteria 20037
65 Ga0070667_100007184 3300005367 Bacteria 9255
66 Ga0070667_100052450 3300005367 Bacteria 3442
67 Ga0070667_100068534 3300005367 Bacteria 3019
68 Ga0070667_100096048 3300005367 Bacteria 2556
69 Ga0070667_100113131 3300005367 Bacteria 2355
70 Ga0070703_10055988 3300005406 Bacteria 1275
71 Ga0070709_10034365 3300005434 Bacteria 3073
72 Ga0070709_10036625 3300005434 Bacteria 2990
73 Ga0070714_100001911 3300005435 Bacteria 15188
74 Ga0070714_100027550 3300005435 Bacteria 4706
75 Ga0070714_100061647 3300005435 Bacteria 3222
76 Ga0070714_100133246 3300005435 Bacteria 2222
77 Ga0070713_100000097 3300005436 Bacteria 55735
78 Ga0070713_100000757 3300005436 Bacteria 20671
79 Ga0070713_100006092 3300005436 Bacteria 8317
80 Ga0070710_10007504 3300005437 Bacteria 5283
81 Ga0070711_100000353 3300005439 Bacteria 23775
82 Ga0070711_100017769 3300005439 Bacteria 4531
83 Ga0070694_100024514 3300005444 Bacteria 3893
84 Ga0070708_100027827 3300005445 Bacteria 4856
85 Ga0070663_100033703 3300005455 Bacteria 3540
86 Ga0070678_100000532 3300005456 Bacteria 18540
87 Ga0070678_100000671 3300005456 Bacteria 16812
88 Ga0070678_100074651 3300005456 Bacteria 2549
89 Ga0070678_100140679 3300005456 Bacteria 1931
90 Ga0070662_100001506 3300005457 Bacteria 14330
91 Ga0070662_100044319 3300005457 Bacteria 3186
92 Ga0070681_10004889 3300005458 Bacteria 12854
93 Ga0068867_100016242 3300005459 Bacteria 5287
94 Ga0068867_100017674 3300005459 Bacteria 5062
95 Ga0068867_100041817 3300005459 Bacteria 3350
96 Ga0068867_100154919 3300005459 Unclassified 1803
97 Ga0070685_10003784 3300005466 Bacteria 7650
98 Ga0070685_10020561 3300005466 Bacteria 3573
99 Ga0070685_10198045 3300005466 Unclassified 1304
100 Ga0070706_100010327 3300005467 Bacteria 8673
101 Ga0070706_100097926 3300005467 Bacteria 2724
102 Ga0070707_100060593 3300005468 Bacteria 3629
103 Ga0070707_100315448 3300005468 Unclassified 1519
104 Ga0070698_100073708 3300005471 Bacteria 3420
105 Ga0070699_100013886 3300005518 Bacteria 6928
106 Ga0070699_100028329 3300005518 Bacteria 4830
107 Ga0070699_100175807 3300005518 Unclassified 1898
108 Ga0070679_100058947 3300005530 Bacteria 3826
109 Ga0070679_100134436 3300005530 Bacteria 2454
110 Ga0070684_100008099 3300005535 Bacteria 8204
111 Ga0070684_100129294 3300005535 Bacteria 2277
112 Ga0070697_100066925 3300005536 Bacteria 2937
113 Ga0070697_100113100 3300005536 Bacteria 2264
114 Ga0068853_100002518 3300005539 Bacteria 13748
115 Ga0068853_100031687 3300005539 Bacteria 4473
116 Ga0070672_100004158 3300005543 Bacteria 9446
117 Ga0070672_100013607 3300005543 Bacteria 5752
118 Ga0070672_100483511 3300005543 Bacteria 1069
119 Ga0070686_100027109 3300005544 Bacteria 3466
120 Ga0070695_100106990 3300005545 Bacteria 1892
121 Ga0070696_100013374 3300005546 Bacteria 5505
122 Ga0070696_100065074 3300005546 Bacteria 2555
123 Ga0070693_100000828 3300005547 Bacteria 13726
124 Ga0070693_100009141 3300005547 Bacteria 4921
125 Ga0070665_100010373 3300005548 Bacteria 9427
126 Ga0070665_100024190 3300005548 Bacteria 6117
127 Ga0070665_100428763 3300005548 Bacteria 1331
128 Ga0070704_100033469 3300005549 Bacteria 3475
129 Ga0068855_100001125 3300005563 Bacteria 33195
130 Ga0068855_100036496 3300005563 Bacteria 5849
131 Ga0068855_100077904 3300005563 Bacteria 3846
132 Ga0070664_100001754 3300005564 Bacteria 17358
133 Ga0070664_100084043 3300005564 Bacteria 2747
134 Ga0068854_100002997 3300005578 Bacteria 10480
135 Ga0068854_100020107 3300005578 Bacteria 4510
136 Ga0068854_100028145 3300005578 Bacteria 3880
137 Ga0068854_100029762 3300005578 Bacteria 3783
138 Ga0068854_100254438 3300005578 Bacteria 1404
139 Ga0068856_100001739 3300005614 Bacteria 22768
140 Ga0068856_100002166 3300005614 Bacteria 20348
141 Ga0070702_100015039 3300005615 Bacteria 3941
142 Ga0070702_100032505 3300005615 Bacteria 2864
143 Ga0068852_100054576 3300005616 Bacteria 3445
144 Ga0068859_100003087 3300005617 Bacteria 16901
145 Ga0068859_100022655 3300005617 Bacteria 6297
146 Ga0068859_100154929 3300005617 Bacteria 2368
147 Ga0068859_100156184 3300005617 Bacteria 2359
148 Ga0068859_100293469 3300005617 Bacteria 1719
149 Ga0068864_100000942 3300005618 Bacteria 24336
150 Ga0068864_100002069 3300005618 Bacteria 16579
151 Ga0068864_100025283 3300005618 Bacteria 4999
152 Ga0068864_100189249 3300005618 Bacteria 1886
153 Ga0068864_100307237 3300005618 Unclassified 1486
154 Ga0068866_10003303 3300005718 Bacteria 6625
155 Ga0068866_10044592 3300005718 Bacteria 2219
156 Ga0068866_10214208 3300005718 Bacteria 1158
157 Ga0068861_100000301 3300005719 Bacteria 27687
158 Ga0068861_100022344 3300005719 Bacteria 4556
159 Ga0068861_100030704 3300005719 Bacteria 3941
160 Ga0068861_100146378 3300005719 Bacteria 1934
161 Ga0068861_100197877 3300005719 Unclassified 1685
162 Ga0068861_100273126 3300005719 Bacteria 1452
163 Ga0068851_10002622 3300005834 Bacteria 7932
164 Ga0068851_10004974 3300005834 Bacteria 6019
165 Ga0068851_10127801 3300005834 Bacteria 1372
166 Ga0068870_10019331 3300005840 Bacteria 3303
167 Ga0068870_10023698 3300005840 Bacteria 3030
168 Ga0068870_10139750 3300005840 Unclassified 1416
169 Ga0068863_100001007 3300005841 Bacteria 28209
170 Ga0068863_100002587 3300005841 Bacteria 17944
171 Ga0068863_100005704 3300005841 Bacteria 12223
172 Ga0068863_100017301 3300005841 Bacteria 6914
173 Ga0068863_100092953 3300005841 Bacteria 2862
174 Ga0068863_100151390 3300005841 Bacteria 2220
175 Ga0068863_100236304 3300005841 Bacteria 1764
176 Ga0068863_100333733 3300005841 Bacteria 1474
177 Ga0068863_100436764 3300005841 Bacteria 1283
178 Ga0068858_100001611 3300005842 Bacteria 23012
179 Ga0068858_100006776 3300005842 Bacteria 11143
180 Ga0068858_100022845 3300005842 Bacteria 5833
181 Ga0068858_100045627 3300005842 Bacteria 4062
182 Ga0068858_100048683 3300005842 Bacteria 3926
183 Ga0068858_100092828 3300005842 Bacteria 2809
184 Ga0068860_100007240 3300005843 Bacteria 11095
185 Ga0068860_100057739 3300005843 Bacteria 3689
186 Ga0068860_100079120 3300005843 Bacteria 3126
187 Ga0068860_100079712 3300005843 Unclassified 3114
188 Ga0068860_100208296 3300005843 Bacteria 1896
189 Ga0068860_100249041 3300005843 Bacteria 1730
190 Ga0068860_100362811 3300005843 Bacteria 1427
191 Ga0068862_100071240 3300005844 Bacteria 3002
192 Ga0068862_100087686 3300005844 Bacteria 2706
193 Ga0070715_10034157 3300006163 Unclassified 2083
194 Ga0070712_100055749 3300006175 Bacteria 2769
195 Ga0070712_100085159 3300006175 Bacteria 2300
196 Ga0070712_100170937 3300006175 Unclassified 1686
197 Ga0097621_100115448 3300006237 Bacteria 2272
198 Ga0097621_100234011 3300006237 Bacteria 1604
199 Ga0097621_100402755 3300006237 Bacteria 1225
200 Ga0068871_100010438 3300006358 Bacteria 6778
201 Ga0068871_100090750 3300006358 Bacteria 2545
202 Ga0075428_100098545 3300006844 Bacteria 3186
203 Ga0068865_100028179 3300006881 Bacteria 3717
204 Ga0068865_100101360 3300006881 Bacteria 2108
205 Ga0075436_100047548 3300006914 Bacteria 2959
206 Ga0097620_100003087 3300006931 Bacteria 16901
207 Ga0097620_100022655 3300006931 Bacteria 6297
208 Ga0097620_100154926 3300006931 Bacteria 2368
209 Ga0097620_100156180 3300006931 Bacteria 2359
210 Ga0097620_100293476 3300006931 Bacteria 1719
211 Ga0105251_10107883 3300009011 Bacteria 1270
212 Ga0105240_10013339 3300009093 Bacteria 11292
213 Ga0105240_10259893 3300009093 Bacteria 2003
214 Ga0111539_10122770 3300009094 Bacteria 3044
215 Ga0111539_10483861 3300009094 Bacteria 1441
216 Ga0105245_10224207 3300009098 Bacteria 1815
217 Ga0105245_10287087 3300009098 Bacteria 1610
218 Ga0105245_10287088 3300009098 Bacteria 1610
219 Ga0105241_10003656 3300009174 Bacteria 11421
220 Ga0105241_10075590 3300009174 Bacteria 2625
221 Ga0105242_10031465 3300009176 Bacteria 4238
222 Ga0105242_10238665 3300009176 Bacteria 1633
223 Ga0105248_10012962 3300009177 Bacteria 9190
224 Ga0105248_10059812 3300009177 Unclassified 4280
225 Ga0105248_10069045 3300009177 Bacteria 3967
226 Ga0105248_10276258 3300009177 Unclassified 1891
227 Ga0105238_10081316 3300009551 Bacteria 3229
228 Ga0105238_10160503 3300009551 Bacteria 2224
229 Ga0105249_10170549 3300009553 Bacteria 2109
230 Ga0105249_10192408 3300009553 Bacteria 1992
231 Ga0105249_10272761 3300009553 Bacteria 1686
232 Ga0105239_10132851 3300010375 Bacteria 2770
233 Ga0157373_10000824 3300013100 Bacteria 24025
234 Ga0157373_10009831 3300013100 Bacteria 7051
235 Ga0157373_10133456 3300013100 Bacteria 1745
236 Ga0157373_10189472 3300013100 Bacteria 1449
237 Ga0157371_10001585 3300013102 Bacteria 23358
238 Ga0157371_10028956 3300013102 Bacteria 4010
239 Ga0157370_10139480 3300013104 Bacteria 2259
240 Ga0157370_10141139 3300013104 Bacteria 2244
241 Ga0157370_10227355 3300013104 Bacteria 1727
242 Ga0157374_10001764 3300013296 Bacteria 18201
243 Ga0157374_10079725 3300013296 Bacteria 3103
244 Ga0157374_10269821 3300013296 Bacteria 1677
245 Ga0157378_10015183 3300013297 Bacteria 6743
246 Ga0157378_10068601 3300013297 Bacteria 3180
247 Ga0157378_10130260 3300013297 Bacteria 2328
248 Ga0157378_10278864 3300013297 Bacteria 1610
249 Ga0157378_10364173 3300013297 Bacteria 1415
250 Ga0163162_10143430 3300013306 Bacteria 2502
251 Ga0163162_10197867 3300013306 Bacteria 2138
252 Ga0163162_10350175 3300013306 Bacteria 1610
253 Ga0163162_10350176 3300013306 Bacteria 1610
254 Ga0157372_10002024 3300013307 Bacteria 22028
255 Ga0157372_10068759 3300013307 Bacteria 3982
256 Ga0157372_10255728 3300013307 Bacteria 2033
257 Ga0157372_10301715 3300013307 Bacteria 1863
258 Ga0157375_10000969 3300013308 Bacteria 24817
259 Ga0157375_10010250 3300013308 Bacteria 8244
260 Ga0157375_10139528 3300013308 Bacteria 2550
261 Ga0157375_10226484 3300013308 Bacteria 2028
262 Ga0157375_10657005 3300013308 Bacteria 1204
263 Ga0163163_10000609 3300014325 Bacteria 31134
264 Ga0163163_10026914 3300014325 Bacteria 5502
265 Ga0163163_10033032 3300014325 Bacteria 5002
266 Ga0163163_10126911 3300014325 Bacteria 2589
267 Ga0163163_10318977 3300014325 Bacteria 1608
268 Ga0157380_10270697 3300014326 Bacteria 1548
269 Ga0182008_10121891 3300014497 Bacteria 1296
270 Ga0157377_10033742 3300014745 Bacteria 2796
271 Ga0157377_10052022 3300014745 Bacteria 2312
272 Ga0157379_10003475 3300014968 Bacteria 13334
273 Ga0157379_10089270 3300014968 Bacteria 2765
274 Ga0157379_10212299 3300014968 Bacteria 1752
275 Ga0157376_10265429 3300014969 Bacteria 1610
276 Ga0157376_10272899 3300014969 Bacteria 1589
277 Ga0157376_10327734 3300014969 Bacteria 1458
278 Ga0163161_10026766 3300017792 Bacteria 4087
279 Ga0163161_10036247 3300017792 Bacteria 3532
280 Ga0163161_10059079 3300017792 Bacteria 2788
281 Ga0163161_10250424 3300017792 Bacteria 1381
282 Ga0197907_10542108 3300020069 Bacteria 1661
283 Ga0206350_10969186 3300020080 Bacteria 1197
284 Ga0206354_10597588 3300020081 Bacteria 1963
285 Ga0224712_10104951 3300022467 Bacteria 1204
286 Ga0207697_10008144 3300025315 Bacteria 4614
287 Ga0207656_10003450 3300025321 Bacteria 5432
288 Ga0207656_10035791 3300025321 Bacteria 2081
289 Ga0207682_10000037 3300025893 Bacteria 54103
290 Ga0207682_10000342 3300025893 Bacteria 21268
291 Ga0207692_10077274 3300025898 Bacteria 1771
292 Ga0207692_10114753 3300025898 Unclassified 1499
293 Ga0207692_10269063 3300025898 Bacteria 1027
294 Ga0207642_10003579 3300025899 Bacteria 4928
295 Ga0207642_10105177 3300025899 Bacteria 1426
296 Ga0207688_10002202 3300025901 Bacteria 10507
297 Ga0207680_10012372 3300025903 Bacteria 4343
298 Ga0207680_10037617 3300025903 Bacteria 2795
299 Ga0207699_10041054 3300025906 Bacteria 2669
300 Ga0207699_10091356 3300025906 Bacteria 1912
301 Ga0207645_10000187 3300025907 Bacteria 49829
302 Ga0207645_10006382 3300025907 Bacteria 8471
303 Ga0207643_10004724 3300025908 Bacteria 7306
304 Ga0207643_10013966 3300025908 Bacteria 4356
305 Ga0207643_10143704 3300025908 Unclassified 1426
306 Ga0207654_10047697 3300025911 Bacteria 2448
307 Ga0207654_10100519 3300025911 Bacteria 1781
308 Ga0207707_10068022 3300025912 Bacteria 3103
309 Ga0207707_10279440 3300025912 Bacteria 1446
310 Ga0207695_10041225 3300025913 Bacteria 4942
311 Ga0207695_10265073 3300025913 Bacteria 1615
312 Ga0207693_10000760 3300025915 Bacteria 28971
313 Ga0207693_10034342 3300025915 Bacteria 4000
314 Ga0207663_10100456 3300025916 Bacteria 1942
315 Ga0207663_10140156 3300025916 Bacteria 1683
316 Ga0207660_10085052 3300025917 Bacteria 2332
317 Ga0207662_10039249 3300025918 Bacteria 2777
318 Ga0207662_10068523 3300025918 Bacteria 2143
319 Ga0207657_10000102 3300025919 Bacteria 82096
320 Ga0207657_10002028 3300025919 Bacteria 21896
321 Ga0207657_10004073 3300025919 Bacteria 15510
322 Ga0207657_10041681 3300025919 Bacteria 4057
323 Ga0207649_10016589 3300025920 Bacteria 4157
324 Ga0207649_10033213 3300025920 Bacteria 3081
325 Ga0207652_10135050 3300025921 Bacteria 2203
326 Ga0207652_10141659 3300025921 Bacteria 2150
327 Ga0207681_10013883 3300025923 Bacteria 4992
328 Ga0207681_10025841 3300025923 Bacteria 3782
329 Ga0207681_10167046 3300025923 Bacteria 1664
330 Ga0207681_10532451 3300025923 Unclassified 965
331 Ga0207694_10088426 3300025924 Bacteria 2442
332 Ga0207694_10188628 3300025924 Bacteria 1674
333 Ga0207694_10326195 3300025924 Bacteria 1268
334 Ga0207650_10009611 3300025925 Bacteria 6613
335 Ga0207659_10004018 3300025926 Bacteria 8875
336 Ga0207659_10006850 3300025926 Bacteria 7008
337 Ga0207659_10019966 3300025926 Bacteria 4422
338 Ga0207659_10041311 3300025926 Bacteria 3229
339 Ga0207687_10047794 3300025927 Bacteria 2968
340 Ga0207687_10151595 3300025927 Bacteria 1769
341 Ga0207687_10199197 3300025927 Bacteria 1564
342 Ga0207700_10000209 3300025928 Bacteria 35041
343 Ga0207700_10003286 3300025928 Bacteria 9358
344 Ga0207700_10019129 3300025928 Bacteria 4620
345 Ga0207664_10001754 3300025929 Bacteria 14292
346 Ga0207664_10012811 3300025929 Bacteria 6006
347 Ga0207664_10263695 3300025929 Bacteria 1507
348 Ga0207644_10002572 3300025931 Bacteria 11670
349 Ga0207644_10004748 3300025931 Bacteria 8834
350 Ga0207644_10011528 3300025931 Bacteria 5853
351 Ga0207644_10061970 3300025931 Bacteria 2710
352 Ga0207644_10081912 3300025931 Bacteria 2386
353 Ga0207644_10248937 3300025931 Bacteria 1417
354 Ga0207690_10000595 3300025932 Bacteria 23415
355 Ga0207706_10000095 3300025933 Bacteria 92378
356 Ga0207706_10008022 3300025933 Bacteria 9743
357 Ga0207706_10081372 3300025933 Bacteria 2846
358 Ga0207706_10288575 3300025933 Bacteria 1430
359 Ga0207686_10000568 3300025934 Bacteria 23395
360 Ga0207709_10210414 3300025935 Bacteria 1395
361 Ga0207670_10002662 3300025936 Bacteria 9393
362 Ga0207670_10015582 3300025936 Bacteria 4546
363 Ga0207669_10002058 3300025937 Bacteria 8517
364 Ga0207669_10007399 3300025937 Bacteria 5075
365 Ga0207669_10007629 3300025937 Bacteria 5022
366 Ga0207669_10209415 3300025937 Unclassified 1422
367 Ga0207704_10024471 3300025938 Bacteria 3276
368 Ga0207704_10156842 3300025938 Bacteria 1614
369 Ga0207665_10065700 3300025939 Bacteria 2467
370 Ga0207691_10000024 3300025940 Bacteria 132111
371 Ga0207691_10002234 3300025940 Bacteria 18960
372 Ga0207691_10014589 3300025940 Bacteria 7489
373 Ga0207691_10032052 3300025940 Bacteria 4903
374 Ga0207691_10043516 3300025940 Bacteria 4138
375 Ga0207691_10076482 3300025940 Bacteria 3016
376 Ga0207691_10400617 3300025940 Bacteria 1170
377 Ga0207711_10005936 3300025941 Bacteria 10322
378 Ga0207711_10024064 3300025941 Bacteria 5098
379 Ga0207711_10622032 3300025941 Bacteria 1008
380 Ga0207689_10007082 3300025942 Bacteria 9858
381 Ga0207689_10007473 3300025942 Bacteria 9580
382 Ga0207689_10010531 3300025942 Bacteria 7962
383 Ga0207689_10094801 3300025942 Bacteria 2451
384 Ga0207689_10106491 3300025942 Bacteria 2304
385 Ga0207661_10049322 3300025944 Bacteria 3351
386 Ga0207679_10003389 3300025945 Bacteria 9838
387 Ga0207679_10055414 3300025945 Bacteria 2922
388 Ga0207679_10066366 3300025945 Bacteria 2704
389 Ga0207679_10465131 3300025945 Bacteria 1123
390 Ga0207667_10000233 3300025949 Bacteria 77272
391 Ga0207651_10000505 3300025960 Bacteria 16387
392 Ga0207651_10013286 3300025960 Bacteria 4705
393 Ga0207651_10045979 3300025960 Bacteria 2931
394 Ga0207651_10048403 3300025960 Bacteria 2874
395 Ga0207651_10117016 3300025960 Bacteria 2013
396 Ga0207651_10133718 3300025960 Bacteria 1903
397 Ga0207651_10418941 3300025960 Bacteria 1143
398 Ga0207712_10118385 3300025961 Bacteria 1999
399 Ga0207668_10017089 3300025972 Bacteria 4539
400 Ga0207668_10032496 3300025972 Bacteria 3448
401 Ga0207668_10048095 3300025972 Bacteria 2925
402 Ga0207668_10058257 3300025972 Bacteria 2699
403 Ga0207668_10135517 3300025972 Bacteria 1886
404 Ga0207668_10166210 3300025972 Bacteria 1725
405 Ga0207640_10002755 3300025981 Bacteria 9404
406 Ga0207640_10043463 3300025981 Bacteria 2872
407 Ga0207640_10077951 3300025981 Bacteria 2254
408 Ga0207640_10204448 3300025981 Bacteria 1499
409 Ga0207658_10005413 3300025986 Bacteria 8752
410 Ga0207658_10061006 3300025986 Bacteria 2816
411 Ga0207658_10077827 3300025986 Unclassified 2532
412 Ga0207658_10087863 3300025986 Bacteria 2401
413 Ga0207658_10180087 3300025986 Bacteria 1748
414 Ga0207658_10185256 3300025986 Bacteria 1726
415 Ga0207658_10211364 3300025986 Bacteria 1626
416 Ga0207677_10000920 3300026023 Bacteria 16454
417 Ga0207677_10004579 3300026023 Bacteria 7434
418 Ga0207677_10212051 3300026023 Bacteria 1547
419 Ga0207677_10320204 3300026023 Unclassified 1288
420 Ga0207703_10001926 3300026035 Bacteria 18380
421 Ga0207703_10009771 3300026035 Bacteria 7526
422 Ga0207703_10014385 3300026035 Bacteria 6170
423 Ga0207703_10049145 3300026035 Bacteria 3409
424 Ga0207703_10097446 3300026035 Bacteria 2485
425 Ga0207639_10002255 3300026041 Bacteria 12960
426 Ga0207639_10006578 3300026041 Bacteria 7904
427 Ga0207639_10020729 3300026041 Bacteria 4710
428 Ga0207639_10478887 3300026041 Bacteria 1134
429 Ga0207678_10002105 3300026067 Bacteria 18024
430 Ga0207678_10025042 3300026067 Bacteria 5211
431 Ga0207678_10041157 3300026067 Bacteria 4006
432 Ga0207708_10004184 3300026075 Bacteria 10608
433 Ga0207708_10012569 3300026075 Bacteria 6313
434 Ga0207702_10006044 3300026078 Bacteria 10504
435 Ga0207702_10160745 3300026078 Bacteria 2051
436 Ga0207702_10214692 3300026078 Bacteria 1790
437 Ga0207702_10514679 3300026078 Bacteria 1168
438 Ga0207641_10008460 3300026088 Bacteria 8505
439 Ga0207641_10016130 3300026088 Bacteria 6118
440 Ga0207641_10227345 3300026088 Bacteria 1733
441 Ga0207641_10247546 3300026088 Bacteria 1663
442 Ga0207641_10259988 3300026088 Bacteria 1625
443 Ga0207641_10340288 3300026088 Unclassified 1427
444 Ga0207648_10010022 3300026089 Bacteria 9012
445 Ga0207648_10012459 3300026089 Bacteria 7961
446 Ga0207648_10020826 3300026089 Bacteria 5904
447 Ga0207648_10025301 3300026089 Bacteria 5289
448 Ga0207648_10028092 3300026089 Bacteria 4990
449 Ga0207676_10000754 3300026095 Bacteria 25321
450 Ga0207676_10039647 3300026095 Bacteria 3604
451 Ga0207676_10054171 3300026095 Bacteria 3142
452 Ga0207676_10075122 3300026095 Bacteria 2725
453 Ga0207676_10111186 3300026095 Bacteria 2293
454 Ga0207676_10128429 3300026095 Bacteria 2151
455 Ga0207676_10320806 3300026095 Unclassified 1422
456 Ga0207674_10000326 3300026116 Bacteria 60670
457 Ga0207674_10003123 3300026116 Bacteria 20429
458 Ga0207674_10094865 3300026116 Bacteria 2970
459 Ga0207674_10146250 3300026116 Bacteria 2322
460 Ga0207674_10206849 3300026116 Bacteria 1912
461 Ga0207675_100006614 3300026118 Bacteria 10962
462 Ga0207675_100032054 3300026118 Bacteria 4895
463 Ga0207675_100033221 3300026118 Bacteria 4808
464 Ga0207675_100036485 3300026118 Bacteria 4586
465 Ga0207675_100047601 3300026118 Bacteria 4003
466 Ga0207675_100063417 3300026118 Bacteria 3452
467 Ga0207683_10000012 3300026121 Bacteria 134768
468 Ga0207683_10001576 3300026121 Bacteria 20549
469 Ga0207683_10052794 3300026121 Bacteria 3562
470 Ga0207683_10109562 3300026121 Bacteria 2472
471 Ga0207683_10283554 3300026121 Bacteria 1514
472 Ga0207698_10008476 3300026142 Bacteria 6506
473 Ga0207698_10058285 3300026142 Bacteria 2992
474 Ga0207698_10177960 3300026142 Bacteria 1880
475 Ga0207698_10203025 3300026142 Bacteria 1777
476 Ga0209971_1010000 3300027682 Bacteria 2243
477 Ga0268266_10148318 3300028379 Bacteria 2111
478 Ga0268265_10138669 3300028380 Bacteria 2033
479 Ga0268264_10002657 3300028381 Bacteria 15612
480 Ga0268264_10011215 3300028381 Bacteria 7404
481 Ga0268264_10058196 3300028381 Bacteria 3236
482 Ga0268264_10202902 3300028381 Bacteria 1815
483 Ga0268264_10263884 3300028381 Unclassified 1606
484 Ga0268264_10273980 3300028381 Bacteria 1578
485 Ga0265330_10001082 3300031235 Bacteria 16406
486 Ga0265332_10006731 3300031238 Bacteria 5207
487 Ga0265328_10028595 3300031239 Bacteria 2085
488 Ga0265325_10039473 3300031241 Bacteria 2486
489 Ga0265329_10001186 3300031242 Bacteria 12780
490 Ga0265340_10100024 3300031247 Unclassified 1348
491 Ga0265331_10000350 3300031250 Bacteria 48905
492 Ga0265316_10057663 3300031344 Bacteria 3027
493 Ga0307409_100019841 3300031995 Bacteria 4565
494 Ga0373926_0087598 3300035083 Bacteria 1156
495 Ga0373923_0005342 3300035111 Bacteria 4361
496 Ga0373953_0014250 3300035117 Bacteria 2856
497 Ga0373954_0034352 3300035118 Bacteria 2348
498 Ga0373956_0003461 3300035119 Bacteria 6350
499 Ga0373956_0054875 3300035119 Bacteria 1796
500 Ga0373957_0023322 3300035120 Bacteria 2212
501 Ga0373943_0141502 3300035170 Bacteria 1296
502 Ga0373955_0003173 3300035172 Bacteria 7194
503 Ga0373935_0131309 3300035692 Bacteria 1683
504 Ga0373935_0285866 3300035692 Bacteria 1162
505 Ga0373927_0008666 3300035695 Bacteria 6835
506 Ga0373927_0013802 3300035695 Bacteria 5362
507 Ga0373927_0031227 3300035695 Bacteria 3473
508 Ga0373933_0003463 3300035724 Bacteria 8785
509 Ga0373933_0037315 3300035724 Bacteria 2850
510 Ga0373947_0013887 3300035725 Bacteria 4617
511 Ga0373947_0097167 3300035725 Bacteria 1845
512 Ga0373937_0006837 3300036401 Bacteria 9841
513 Ga0373937_0203462 3300036401 Bacteria 1861
514 Ga0373925_0014214 3300037068 Bacteria 5759
515 Ga0373925_0014328 3300037068 Bacteria 5736
516 Ga0373925_0158634 3300037068 Bacteria 1781
517 Ga0395899_0126916 3300037312 Bacteria 1824
518 Ga0466958_0195620 3300045836 Unclassified 1286
519 Ga0495603_0106267 3300046455 Bacteria 1638
520 Ga0495651_0185609 3300046462 Bacteria 1468
521 Ga0495580_0037221 3300046472 Bacteria 3493
522 Ga0495582_0104263 3300046473 Bacteria 1589
523 Ga0495639_0010070 3300046475 Bacteria 4063
524 Ga0495664_0007370 3300046477 Bacteria 6110
525 Ga0495587_0019544 3300046536 Bacteria 4191
526 Ga0495621_0017443 3300046539 Bacteria 2321
527 Ga0495621_0074086 3300046539 Bacteria 1259
528 Ga0495645_0011397 3300046543 Bacteria 6255
529 Ga0495667_0095762 3300046559 Bacteria 1922
530 Ga0495635_0017219 3300046663 Bacteria 5047
531 Ga0495599_0024339 3300046678 Bacteria 3787
532 Ga0495647_0022632 3300046681 Bacteria 2271
533 Ga0495658_0191841 3300046683 Bacteria 1270
534 Ga0495613_0035593 3300046689 Bacteria 3694
535 Ga0495600_0149919 3300046809 Bacteria 1510
536 Ga0495581_0006293 3300047315 Bacteria 6883
537 Ga0495674_0095477 3300047319 Bacteria 2535
538 Ga0495680_0079873 3300047322 Bacteria 2473
539 Ga0495593_0024449 3300047673 Bacteria 3348
540 Ga0496101_0038252 3300048904 Bacteria 3407
541 Ga0496102_0002295 3300048905 Bacteria 16340
542 Ga0496102_0034930 3300048905 Bacteria 4525
543 Ga0496102_0110538 3300048905 Bacteria 2562
544 Ga0496103_0216933 3300048906 Bacteria 1230
545 Ga0496104_0009256 3300048907 Bacteria 8760
546 Ga0496104_0072684 3300048907 Bacteria 3270
547 Ga0496105_0004334 3300048908 Bacteria 10691
548 Ga0496105_0170498 3300048908 Bacteria 1784
549 Ga0496106_0002713 3300048909 Bacteria 13119
550 Ga0496106_0012007 3300048909 Bacteria 6392
551 Ga0496107_0042075 3300048910 Bacteria 3282
552 Ga0496107_0080885 3300048910 Bacteria 2370
553 Ga0496108_0003376 3300048911 Bacteria 12818
554 Ga0496108_0461917 3300048911 Unclassified 1109
555 Ga0496109_0006131 3300048912 Bacteria 10102
556 Ga0496109_0299642 3300048912 Bacteria 1516
557 Ga0496110_0014042 3300048913 Bacteria 6638
558 Ga0496110_0177462 3300048913 Bacteria 1934
559 Ga0496111_0018599 3300048914 Bacteria 4815
560 Ga0496112_0000236 3300048915 Bacteria 35432
561 Ga0496112_0017188 3300048915 Bacteria 6793
562 Ga0496112_0081382 3300048915 Bacteria 3202
563 Ga0496112_0473893 3300048915 Bacteria 1189
564 Ga0496112_0595297 3300048915 Bacteria 1038
565 Ga0496114_0101109 3300048917 Bacteria 2461
566 Ga0496115_0247293 3300048918 Bacteria 1469
567 Ga0501070_0004047 3300049586 Bacteria 12597
568 Ga0501080_0001874 3300049742 Bacteria 18084
569 Ga0501080_0089991 3300049742 Bacteria 2851
570 nmdc:mga08y16_442659_c1 3300050511 Bacteria 1326
571 nmdc:mga0n895_33870_c1 3300050512 Bacteria 4912
572 2834644995 2834641062 Bacteria 5559922
573 8003401374 8003400568 Bacteria 5535898
574 Ga0451853_3226734
575 Ga0070676_10000358
576 Ga0070676_10083650
577 Ga0070683_100067258
578 Ga0070683_100260826
579 Ga0070690_100095108
580 Ga0070670_100002937
581 Ga0070670_100056080
582 Ga0070670_100125322
583 Ga0070670_100166728
584 Ga0070677_10000715
585 Ga0068869_100074106
586 Ga0068869_100151781
587 Ga0070666_10011863
588 Ga0070666_10145902
589 Ga0070666_10173149
590 Ga0070680_100085513
591 Ga0068868_100001448
592 Ga0068868_100124054
593 Ga0070660_100015753
594 Ga0070689_100012543
595 Ga0070689_100153310
596 Ga0070661_100003862
597 Ga0070661_100165298
598 Ga0070661_100259350
599 Ga0070692_10064650
600 Ga0070668_100020281
601 Ga0070668_100072910
602 Ga0070668_100087024
603 Ga0070668_100090685
604 Ga0070668_100090720
605 Ga0070668_100091241
606 Ga0070668_100117135
607 Ga0070668_100181813
608 Ga0070668_100275891
609 Ga0070669_100012541
610 Ga0070669_100072736
611 Ga0070669_100123137
612 Ga0070669_100183642
613 Ga0070669_100192956
614 Ga0070675_100000127
615 Ga0070675_100005058
616 Ga0070675_100009286
617 Ga0070671_100000385
618 Ga0070671_100003327
619 Ga0070671_100012985
620 Ga0070671_100168647
621 Ga0070671_100218884
622 Ga0070674_100000120
623 Ga0070674_100000959
624 Ga0070674_100021346
625 Ga0070673_100000167
626 Ga0070673_100000465
627 Ga0070673_100019052
628 Ga0070673_100022994
629 Ga0070673_100227831
630 Ga0070688_100001497
631 Ga0070688_100001532
632 Ga0070688_100070006
633 Ga0070659_100000182
634 Ga0070659_100033827
635 Ga0070659_100174282
636 Ga0070659_100368111
637 Ga0070667_100001635
638 Ga0070667_100007184
639 Ga0070667_100052450
640 Ga0070667_100068534
641 Ga0070667_100096048
642 Ga0070667_100113131
643 Ga0070703_10055988
644 Ga0070709_10034365
645 Ga0070709_10036625
646 Ga0070714_100001911
647 Ga0070714_100027550
648 Ga0070714_100061647
649 Ga0070714_100133246
650 Ga0070713_100000097
651 Ga0070713_100000757
652 Ga0070713_100006092
653 Ga0070710_10007504
654 Ga0070711_100000353
655 Ga0070711_100017769
656 Ga0070694_100024514
657 Ga0070708_100027827
658 Ga0070663_100033703
659 Ga0070678_100000532
660 Ga0070678_100000671
661 Ga0070678_100074651
662 Ga0070678_100140679
663 Ga0070662_100001506
664 Ga0070662_100044319
665 Ga0070681_10004889
666 Ga0068867_100016242
667 Ga0068867_100017674
668 Ga0068867_100041817
669 Ga0068867_100154919
670 Ga0070685_10003784
671 Ga0070685_10020561
672 Ga0070685_10198045
673 Ga0070706_100010327
674 Ga0070706_100097926
675 Ga0070707_100060593
676 Ga0070707_100315448
677 Ga0070698_100073708
678 Ga0070699_100013886
679 Ga0070699_100028329
680 Ga0070699_100175807
681 Ga0070679_100058947
682 Ga0070679_100134436
683 Ga0070684_100008099
684 Ga0070684_100129294
685 Ga0070697_100066925
686 Ga0070697_100113100
687 Ga0068853_100002518
688 Ga0068853_100031687
689 Ga0070672_100004158
690 Ga0070672_100013607
691 Ga0070672_100483511
692 Ga0070686_100027109
693 Ga0070695_100106990
694 Ga0070696_100013374
695 Ga0070696_100065074
696 Ga0070693_100000828
697 Ga0070693_100009141
698 Ga0070665_100010373
699 Ga0070665_100024190
700 Ga0070665_100428763
701 Ga0070704_100033469
702 Ga0068855_100001125
703 Ga0068855_100036496
704 Ga0068855_100077904
705 Ga0070664_100001754
706 Ga0070664_100084043
707 Ga0068854_100002997
708 Ga0068854_100020107
709 Ga0068854_100028145
710 Ga0068854_100029762
711 Ga0068854_100254438
712 Ga0068856_100001739
713 Ga0068856_100002166
714 Ga0070702_100015039
715 Ga0070702_100032505
716 Ga0068852_100054576
717 Ga0068859_100003087
718 Ga0068859_100022655
719 Ga0068859_100154929
720 Ga0068859_100156184
721 Ga0068859_100293469
722 Ga0068864_100000942
723 Ga0068864_100002069
724 Ga0068864_100025283
725 Ga0068864_100189249
726 Ga0068864_100307237
727 Ga0068866_10003303
728 Ga0068866_10044592
729 Ga0068866_10214208
730 Ga0068861_100000301
731 Ga0068861_100022344
732 Ga0068861_100030704
733 Ga0068861_100146378
734 Ga0068861_100197877
735 Ga0068861_100273126
736 Ga0068851_10002622
737 Ga0068851_10004974
738 Ga0068851_10127801
739 Ga0068870_10019331
740 Ga0068870_10023698
741 Ga0068870_10139750
742 Ga0068863_100001007
743 Ga0068863_100002587
744 Ga0068863_100005704
745 Ga0068863_100017301
746 Ga0068863_100092953
747 Ga0068863_100151390
748 Ga0068863_100236304
749 Ga0068863_100333733
750 Ga0068863_100436764
751 Ga0068858_100001611
752 Ga0068858_100006776
753 Ga0068858_100022845
754 Ga0068858_100045627
755 Ga0068858_100048683
756 Ga0068858_100092828
757 Ga0068860_100007240
758 Ga0068860_100057739
759 Ga0068860_100079120
760 Ga0068860_100079712
761 Ga0068860_100208296
762 Ga0068860_100249041
763 Ga0068860_100362811
764 Ga0068862_100071240
765 Ga0068862_100087686
766 Ga0070715_10034157
767 Ga0070712_100055749
768 Ga0070712_100085159
769 Ga0070712_100170937
770 Ga0097621_100115448
771 Ga0097621_100234011
772 Ga0097621_100402755
773 Ga0068871_100010438
774 Ga0068871_100090750
775 Ga0075428_100098545
776 Ga0068865_100028179
777 Ga0068865_100101360
778 Ga0075436_100047548
779 Ga0097620_100003087
780 Ga0097620_100022655
781 Ga0097620_100154926
782 Ga0097620_100156180
783 Ga0097620_100293476
784 Ga0105251_10107883
785 Ga0105240_10013339
786 Ga0105240_10259893
787 Ga0111539_10122770
788 Ga0111539_10483861
789 Ga0105245_10224207
790 Ga0105245_10287087
791 Ga0105245_10287088
792 Ga0105241_10003656
793 Ga0105241_10075590
794 Ga0105242_10031465
795 Ga0105242_10238665
796 Ga0105248_10012962
797 Ga0105248_10059812
798 Ga0105248_10069045
799 Ga0105248_10276258
800 Ga0105238_10081316
801 Ga0105238_10160503
802 Ga0105249_10170549
803 Ga0105249_10192408
804 Ga0105249_10272761
805 Ga0105239_10132851
806 Ga0157373_10000824
807 Ga0157373_10009831
808 Ga0157373_10133456
809 Ga0157373_10189472
810 Ga0157371_10001585
811 Ga0157371_10028956
812 Ga0157370_10139480
813 Ga0157370_10141139
814 Ga0157370_10227355
815 Ga0157374_10001764
816 Ga0157374_10079725
817 Ga0157374_10269821
818 Ga0157378_10015183
819 Ga0157378_10068601
820 Ga0157378_10130260
821 Ga0157378_10278864
822 Ga0157378_10364173
823 Ga0163162_10143430
824 Ga0163162_10197867
825 Ga0163162_10350175
826 Ga0163162_10350176
827 Ga0157372_10002024
828 Ga0157372_10068759
829 Ga0157372_10255728
830 Ga0157372_10301715
831 Ga0157375_10000969
832 Ga0157375_10010250
833 Ga0157375_10139528
834 Ga0157375_10226484
835 Ga0157375_10657005
836 Ga0163163_10000609
837 Ga0163163_10026914
838 Ga0163163_10033032
839 Ga0163163_10126911
840 Ga0163163_10318977
841 Ga0157380_10270697
842 Ga0182008_10121891
843 Ga0157377_10033742
844 Ga0157377_10052022
845 Ga0157379_10003475
846 Ga0157379_10089270
847 Ga0157379_10212299
848 Ga0157376_10265429
849 Ga0157376_10272899
850 Ga0157376_10327734
851 Ga0163161_10026766
852 Ga0163161_10036247
853 Ga0163161_10059079
854 Ga0163161_10250424
855 Ga0197907_10542108
856 Ga0206350_10969186
857 Ga0206354_10597588
858 Ga0224712_10104951
859 Ga0207697_10008144
860 Ga0207656_10003450
861 Ga0207656_10035791
862 Ga0207682_10000037
863 Ga0207682_10000342
864 Ga0207692_10077274
865 Ga0207692_10114753
866 Ga0207692_10269063
867 Ga0207642_10003579
868 Ga0207642_10105177
869 Ga0207688_10002202
870 Ga0207680_10012372
871 Ga0207680_10037617
872 Ga0207699_10041054
873 Ga0207699_10091356
874 Ga0207645_10000187
875 Ga0207645_10006382
876 Ga0207643_10004724
877 Ga0207643_10013966
878 Ga0207643_10143704
879 Ga0207654_10047697
880 Ga0207654_10100519
881 Ga0207707_10068022
882 Ga0207707_10279440
883 Ga0207695_10041225
884 Ga0207695_10265073
885 Ga0207693_10000760
886 Ga0207693_10034342
887 Ga0207663_10100456
888 Ga0207663_10140156
889 Ga0207660_10085052
890 Ga0207662_10039249
891 Ga0207662_10068523
892 Ga0207657_10000102
893 Ga0207657_10002028
894 Ga0207657_10004073
895 Ga0207657_10041681
896 Ga0207649_10016589
897 Ga0207649_10033213
898 Ga0207652_10135050
899 Ga0207652_10141659
900 Ga0207681_10013883
901 Ga0207681_10025841
902 Ga0207681_10167046
903 Ga0207681_10532451
904 Ga0207694_10088426
905 Ga0207694_10188628
906 Ga0207694_10326195
907 Ga0207650_10009611
908 Ga0207659_10004018
909 Ga0207659_10006850
910 Ga0207659_10019966
911 Ga0207659_10041311
912 Ga0207687_10047794
913 Ga0207687_10151595
914 Ga0207687_10199197
915 Ga0207700_10000209
916 Ga0207700_10003286
917 Ga0207700_10019129
918 Ga0207664_10001754
919 Ga0207664_10012811
920 Ga0207664_10263695
921 Ga0207644_10002572
922 Ga0207644_10004748
923 Ga0207644_10011528
924 Ga0207644_10061970
925 Ga0207644_10081912
926 Ga0207644_10248937
927 Ga0207690_10000595
928 Ga0207706_10000095
929 Ga0207706_10008022
930 Ga0207706_10081372
931 Ga0207706_10288575
932 Ga0207686_10000568
933 Ga0207709_10210414
934 Ga0207670_10002662
935 Ga0207670_10015582
936 Ga0207669_10002058
937 Ga0207669_10007399
938 Ga0207669_10007629
939 Ga0207669_10209415
940 Ga0207704_10024471
941 Ga0207704_10156842
942 Ga0207665_10065700
943 Ga0207691_10000024
944 Ga0207691_10002234
945 Ga0207691_10014589
946 Ga0207691_10032052
947 Ga0207691_10043516
948 Ga0207691_10076482
949 Ga0207691_10400617
950 Ga0207711_10005936
951 Ga0207711_10024064
952 Ga0207711_10622032
953 Ga0207689_10007082
954 Ga0207689_10007473
955 Ga0207689_10010531
956 Ga0207689_10094801
957 Ga0207689_10106491
958 Ga0207661_10049322
959 Ga0207679_10003389
960 Ga0207679_10055414
961 Ga0207679_10066366
962 Ga0207679_10465131
963 Ga0207667_10000233
964 Ga0207651_10000505
965 Ga0207651_10013286
966 Ga0207651_10045979
967 Ga0207651_10048403
968 Ga0207651_10117016
969 Ga0207651_10133718
970 Ga0207651_10418941
971 Ga0207712_10118385
972 Ga0207668_10017089
973 Ga0207668_10032496
974 Ga0207668_10048095
975 Ga0207668_10058257
976 Ga0207668_10135517
977 Ga0207668_10166210
978 Ga0207640_10002755
979 Ga0207640_10043463
980 Ga0207640_10077951
981 Ga0207640_10204448
982 Ga0207658_10005413
983 Ga0207658_10061006
984 Ga0207658_10077827
985 Ga0207658_10087863
986 Ga0207658_10180087
987 Ga0207658_10185256
988 Ga0207658_10211364
989 Ga0207677_10000920
990 Ga0207677_10004579
991 Ga0207677_10212051
992 Ga0207677_10320204
993 Ga0207703_10001926
994 Ga0207703_10009771
995 Ga0207703_10014385
996 Ga0207703_10049145
997 Ga0207703_10097446
998 Ga0207639_10002255
999 Ga0207639_10006578
1000 Ga0207639_10020729
1001 Ga0207639_10478887
1002 Ga0207678_10002105
1003 Ga0207678_10025042
1004 Ga0207678_10041157
1005 Ga0207708_10004184
1006 Ga0207708_10012569
1007 Ga0207702_10006044
1008 Ga0207702_10160745
1009 Ga0207702_10214692
1010 Ga0207702_10514679
1011 Ga0207641_10008460
1012 Ga0207641_10016130
1013 Ga0207641_10227345
1014 Ga0207641_10247546
1015 Ga0207641_10259988
1016 Ga0207641_10340288
1017 Ga0207648_10010022
1018 Ga0207648_10012459
1019 Ga0207648_10020826
1020 Ga0207648_10025301
1021 Ga0207648_10028092
1022 Ga0207676_10000754
1023 Ga0207676_10039647
1024 Ga0207676_10054171
1025 Ga0207676_10075122
1026 Ga0207676_10111186
1027 Ga0207676_10128429
1028 Ga0207676_10320806
1029 Ga0207674_10000326
1030 Ga0207674_10003123
1031 Ga0207674_10094865
1032 Ga0207674_10146250
1033 Ga0207674_10206849
1034 Ga0207675_100006614
1035 Ga0207675_100032054
1036 Ga0207675_100033221
1037 Ga0207675_100036485
1038 Ga0207675_100047601
1039 Ga0207675_100063417
1040 Ga0207683_10000012
1041 Ga0207683_10001576
1042 Ga0207683_10052794
1043 Ga0207683_10109562
1044 Ga0207683_10283554
1045 Ga0207698_10008476
1046 Ga0207698_10058285
1047 Ga0207698_10177960
1048 Ga0207698_10203025
1049 Ga0209971_1010000
1050 Ga0268266_10148318
1051 Ga0268265_10138669
1052 Ga0268264_10002657
1053 Ga0268264_10011215
1054 Ga0268264_10058196
1055 Ga0268264_10202902
1056 Ga0268264_10263884
1057 Ga0268264_10273980
1058 Ga0265330_10001082
1059 Ga0265332_10006731
1060 Ga0265328_10028595
1061 Ga0265325_10039473
1062 Ga0265329_10001186
1063 Ga0265340_10100024
1064 Ga0265331_10000350
1065 Ga0265316_10057663
1066 Ga0307409_100019841
1067 Ga0373926_0087598
1068 Ga0373923_0005342
1069 Ga0373953_0014250
1070 Ga0373954_0034352
1071 Ga0373956_0003461
1072 Ga0373956_0054875
1073 Ga0373957_0023322
1074 Ga0373943_0141502
1075 Ga0373955_0003173
1076 Ga0373935_0131309
1077 Ga0373935_0285866
1078 Ga0373927_0008666
1079 Ga0373927_0013802
1080 Ga0373927_0031227
1081 Ga0373933_0003463
1082 Ga0373933_0037315
1083 Ga0373947_0013887
1084 Ga0373947_0097167
1085 Ga0373937_0006837
1086 Ga0373937_0203462
1087 Ga0373925_0014214
1088 Ga0373925_0014328
1089 Ga0373925_0158634
1090 Ga0395899_0126916
1091 Ga0466958_0195620
1092 Ga0495603_0106267
1093 Ga0495651_0185609
1094 Ga0495580_0037221
1095 Ga0495582_0104263
1096 Ga0495639_0010070
1097 Ga0495664_0007370
1098 Ga0495587_0019544
1099 Ga0495621_0017443
1100 Ga0495621_0074086
1101 Ga0495645_0011397
1102 Ga0495667_0095762
1103 Ga0495635_0017219
1104 Ga0495599_0024339
1105 Ga0495647_0022632
1106 Ga0495658_0191841
1107 Ga0495613_0035593
1108 Ga0495600_0149919
1109 Ga0495581_0006293
1110 Ga0495674_0095477
1111 Ga0495680_0079873
1112 Ga0495593_0024449
1113 Ga0496101_0038252
1114 Ga0496102_0002295
1115 Ga0496102_0034930
1116 Ga0496102_0110538
1117 Ga0496103_0216933
1118 Ga0496104_0009256
1119 Ga0496104_0072684
1120 Ga0496105_0004334
1121 Ga0496105_0170498
1122 Ga0496106_0002713
1123 Ga0496106_0012007
1124 Ga0496107_0042075
1125 Ga0496107_0080885
1126 Ga0496108_0003376
1127 Ga0496108_0461917
1128 Ga0496109_0006131
1129 Ga0496109_0299642
1130 Ga0496110_0014042
1131 Ga0496110_0177462
1132 Ga0496111_0018599
1133 Ga0496112_0000236
1134 Ga0496112_0017188
1135 Ga0496112_0081382
1136 Ga0496112_0473893
1137 Ga0496112_0595297
1138 Ga0496114_0101109
1139 Ga0496115_0247293
1140 Ga0501070_0004047
1141 Ga0501080_0001874
1142 Ga0501080_0089991
1143 nmdc:mga08y16_442659_c1
1144 nmdc:mga0n895_33870_c1
1145 2834644995
1146 8003401374

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15916

DUF4743

Domain of unknown function (DUF4743)

46

158

0.97

PF00293

NUDIX

NUDIX domain

158

296

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dup-assembly1.cif.gz_B crystal structure of mutt/nudix family hydrolase from rhodospirillum rubrum atcc 11170 0.9377 9 273
3dup-assembly1.cif.gz_B crystal structure of mutt/nudix family hydrolase from rhodospirillum rubrum atcc 11170 0.8705 9 273
2fkb-assembly2.cif.gz_B crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 0.8275 81 258
2fkb-assembly2.cif.gz_B crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12 0.8089 81 258
3dku-assembly8.cif.gz_H crystal structure of nudix hydrolase orf153, ymfb, from escherichia coli k-1 0.7966 108 252
ID Description Score Start End Superfamily
af_I1L4F2_205_385_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9508 97 273 3.90.79.10
af_Q1LYN2_114_295_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9487 97 273 3.90.79.10
3dupB02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9443 9 106 3.30.750.160
af_Q7PLS1_121_302_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.927 97 275 3.90.79.10
af_A0A1D6I1Y6_1_121_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9107 155 273 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A536XGE4-F1-model_v4 DUF4743 domain-containing protein 0.9788 5 274
AF-A0A7X1P044-F1-model_v4 DUF4743 domain-containing protein 0.975 8 258
AF-A0A536UT32-F1-model_v4 DUF4743 domain-containing protein 0.9747 2 274
AF-A0A7W0X402-F1-model_v4 DUF4743 domain-containing protein 0.9676 2 260
AF-A0A7T8J2N5-F1-model_v4 Nudix hydrolase domain-containing protein 0.9672 131 255

Map