F464649

General Info

Members Datasets Scaffolds Average Seq Length
568 206 1136 221

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0257670|Ga0373937_0257670_795_1550
Length 251
Sequence VLPLLLEAPAGRPLSVLAIGAHPDDIEIGAGGLLLALAGRPLRVTYVVLTGTAERHEEARAAARAFLPDADLTVSLHQLPEGRLPAAWAQAKEILEDVARTCAGAVDVVLAPSHDDAHQDHRTIGEIVPSVFRDQLYLAYEIPKWDGDLSRPSLYVPLSDEIARHKVELLHKCFPSQRGRDWWDDEVFLGLARLRGMESRARYAEAFRCTKSLLLPVAASGAPDVSRPPAGGSYIRGDGTTGTSAADEVTR

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.05
Rhizosphere 93.84
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0257670 3300036401 Bacteria 1645
2 JGI25404J52841_10011895 3300003659 Bacteria 1881
3 Ga0070658_10167176 3300005327 Bacteria 1847
4 Ga0070683_100055517 3300005329 Bacteria 3676
5 Ga0068869_100013459 3300005334 Bacteria 5442
6 Ga0068869_100233573 3300005334 Bacteria 1462
7 Ga0070666_10097198 3300005335 Bacteria 2027
8 Ga0068868_100036911 3300005338 Bacteria 3786
9 Ga0070691_10034279 3300005341 Bacteria 2389
10 Ga0070692_10119033 3300005345 Bacteria 1470
11 Ga0070692_10269825 3300005345 Bacteria 1027
12 Ga0070675_100302619 3300005354 Bacteria 1409
13 Ga0070671_100086526 3300005355 Bacteria 2622
14 Ga0070673_100089627 3300005364 Bacteria 2511
15 Ga0070659_100344233 3300005366 Bacteria 1250
16 Ga0070667_100117161 3300005367 Bacteria 2314
17 Ga0070709_10003373 3300005434 Bacteria 8581
18 Ga0070709_10005183 3300005434 Bacteria 7050
19 Ga0070709_10029402 3300005434 Bacteria 3287
20 Ga0070709_10038522 3300005434 Bacteria 2927
21 Ga0070709_10046348 3300005434 Bacteria 2702
22 Ga0070709_10058744 3300005434 Unclassified 2440
23 Ga0070714_100000632 3300005435 Bacteria 25092
24 Ga0070714_100002887 3300005435 Bacteria 12712
25 Ga0070714_100003084 3300005435 Bacteria 12367
26 Ga0070714_100027801 3300005435 Bacteria 4686
27 Ga0070714_100068331 3300005435 Unclassified 3065
28 Ga0070714_100073322 3300005435 Bacteria 2966
29 Ga0070714_100083437 3300005435 Bacteria 2786
30 Ga0070714_100161687 3300005435 Bacteria 2026
31 Ga0070714_100193192 3300005435 Bacteria 1859
32 Ga0070714_100252381 3300005435 Bacteria 1631
33 Ga0070714_100266830 3300005435 Bacteria 1586
34 Ga0070714_100466079 3300005435 Bacteria 1202
35 Ga0070714_100475815 3300005435 Bacteria 1189
36 Ga0070714_100677567 3300005435 Bacteria 994
37 Ga0070713_100000485 3300005436 Bacteria 25311
38 Ga0070713_100001569 3300005436 Bacteria 14624
39 Ga0070713_100001803 3300005436 Bacteria 13808
40 Ga0070713_100002301 3300005436 Bacteria 12428
41 Ga0070713_100009842 3300005436 Bacteria 6875
42 Ga0070713_100015183 3300005436 Bacteria 5744
43 Ga0070713_100022304 3300005436 Bacteria 4891
44 Ga0070713_100147681 3300005436 Bacteria 2088
45 Ga0070713_100161150 3300005436 Bacteria 2003
46 Ga0070713_100236589 3300005436 Bacteria 1662
47 Ga0070713_100379708 3300005436 Bacteria 1316
48 Ga0070710_10000311 3300005437 Bacteria 23176
49 Ga0070710_10000537 3300005437 Bacteria 17951
50 Ga0070710_10003536 3300005437 Bacteria 7404
51 Ga0070710_10005891 3300005437 Bacteria 5853
52 Ga0070710_10010383 3300005437 Bacteria 4573
53 Ga0070710_10010652 3300005437 Bacteria 4520
54 Ga0070710_10025121 3300005437 Bacteria 3152
55 Ga0070710_10033220 3300005437 Bacteria 2800
56 Ga0070710_10035642 3300005437 Bacteria 2714
57 Ga0070710_10092205 3300005437 Bacteria 1788
58 Ga0070710_10473765 3300005437 Bacteria 853
59 Ga0070711_100008743 3300005439 Bacteria 6215
60 Ga0070711_100011658 3300005439 Bacteria 5464
61 Ga0070711_100093695 3300005439 Bacteria 2170
62 Ga0070711_100095250 3300005439 Bacteria 2154
63 Ga0070711_100124092 3300005439 Bacteria 1914
64 Ga0070711_100137571 3300005439 Bacteria 1827
65 Ga0070711_100147844 3300005439 Bacteria 1769
66 Ga0070711_100208567 3300005439 Bacteria 1512
67 Ga0070711_100285274 3300005439 Unclassified 1308
68 Ga0070711_100374373 3300005439 Bacteria 1150
69 Ga0070708_100118706 3300005445 Bacteria 2437
70 Ga0070663_100021753 3300005455 Bacteria 4272
71 Ga0070678_100005980 3300005456 Bacteria 7090
72 Ga0070681_10220633 3300005458 Bacteria 1811
73 Ga0070681_10326118 3300005458 Bacteria 1445
74 Ga0070706_100006803 3300005467 Bacteria 10793
75 Ga0070706_100041666 3300005467 Bacteria 4239
76 Ga0070706_100287003 3300005467 Bacteria 1536
77 Ga0070706_100287595 3300005467 Bacteria 1534
78 Ga0070707_100027059 3300005468 Bacteria 5453
79 Ga0070707_100064692 3300005468 Unclassified 3512
80 Ga0070707_100329838 3300005468 Bacteria 1483
81 Ga0070707_100619731 3300005468 Bacteria 1044
82 Ga0070698_100000840 3300005471 Bacteria 33618
83 Ga0070699_100304044 3300005518 Bacteria 1431
84 Ga0070684_100037868 3300005535 Bacteria 4140
85 Ga0070684_100310568 3300005535 Bacteria 1448
86 Ga0068853_100518905 3300005539 Bacteria 1126
87 Ga0070672_100101263 3300005543 Bacteria 2337
88 Ga0070695_100054276 3300005545 Bacteria 2579
89 Ga0070696_100033206 3300005546 Bacteria 3544
90 Ga0070665_100463762 3300005548 Bacteria 1277
91 Ga0070664_100703424 3300005564 Bacteria 942
92 Ga0068854_100147639 3300005578 Bacteria 1810
93 Ga0068856_100008878 3300005614 Bacteria 9780
94 Ga0068856_100044713 3300005614 Bacteria 4359
95 Ga0068856_100054045 3300005614 Bacteria 3960
96 Ga0068856_100223901 3300005614 Bacteria 1896
97 Ga0068856_100351317 3300005614 Bacteria 1493
98 Ga0068856_100361088 3300005614 Unclassified 1471
99 Ga0068852_100069870 3300005616 Bacteria 3079
100 Ga0068859_100205766 3300005617 Bacteria 2053
101 Ga0068864_100028740 3300005618 Bacteria 4704
102 Ga0068863_100190195 3300005841 Bacteria 1972
103 Ga0068863_100483464 3300005841 Bacteria 1218
104 Ga0068860_100177374 3300005843 Bacteria 2059
105 Ga0068860_100773681 3300005843 Bacteria 973
106 Ga0081540_1000097 3300005983 Bacteria 92047
107 Ga0081540_1023493 3300005983 Bacteria 3603
108 Ga0070717_10005252 3300006028 Bacteria 9438
109 Ga0070717_10006941 3300006028 Bacteria 8368
110 Ga0070717_10010058 3300006028 Bacteria 7122
111 Ga0070717_10011328 3300006028 Bacteria 6767
112 Ga0070717_10018609 3300006028 Bacteria 5429
113 Ga0070717_10028556 3300006028 Bacteria 4467
114 Ga0070717_10029373 3300006028 Bacteria 4410
115 Ga0070717_10059060 3300006028 Bacteria 3172
116 Ga0070717_10138652 3300006028 Bacteria 2096
117 Ga0070715_10257872 3300006163 Bacteria 914
118 Ga0070716_100023623 3300006173 Bacteria 3262
119 Ga0070716_100030218 3300006173 Bacteria 2937
120 Ga0070716_100031469 3300006173 Bacteria 2886
121 Ga0070712_100001140 3300006175 Bacteria 16027
122 Ga0070712_100002585 3300006175 Bacteria 11186
123 Ga0070712_100002764 3300006175 Bacteria 10846
124 Ga0070712_100031081 3300006175 Bacteria 3594
125 Ga0070712_100036548 3300006175 Bacteria 3343
126 Ga0070712_100093863 3300006175 Bacteria 2203
127 Ga0070712_100094228 3300006175 Bacteria 2200
128 Ga0070712_100141646 3300006175 Bacteria 1836
129 Ga0097621_100016001 3300006237 Bacteria 5656
130 Ga0097621_100077369 3300006237 Bacteria 2761
131 Ga0068871_100026696 3300006358 Bacteria 4510
132 Ga0068871_100752815 3300006358 Bacteria 895
133 Ga0075428_100429401 3300006844 Bacteria 1416
134 Ga0075428_100655760 3300006844 Bacteria 1119
135 Ga0075433_10004443 3300006852 Bacteria 10923
136 Ga0075433_10005411 3300006852 Bacteria 10030
137 Ga0075434_100000613 3300006871 Bacteria 27602
138 Ga0075429_100188050 3300006880 Bacteria 1810
139 Ga0068865_100710243 3300006881 Bacteria 860
140 Ga0075436_100024485 3300006914 Bacteria 4149
141 Ga0075436_100041093 3300006914 Bacteria 3191
142 Ga0075436_100231778 3300006914 Unclassified 1312
143 Ga0097620_100205777 3300006931 Bacteria 2053
144 Ga0097620_100305565 3300006931 Bacteria 1684
145 Ga0075435_100007766 3300007076 Bacteria 7666
146 Ga0105240_10121725 3300009093 Bacteria 3141
147 Ga0111539_11034333 3300009094 Bacteria 955
148 Ga0105245_10037840 3300009098 Bacteria 4290
149 Ga0105245_10070560 3300009098 Bacteria 3171
150 Ga0105247_10218392 3300009101 Bacteria 1289
151 Ga0114129_10002954 3300009147 Bacteria 23787
152 Ga0114129_10029589 3300009147 Bacteria 7755
153 Ga0114129_10142132 3300009147 Bacteria 3289
154 Ga0114129_11230218 3300009147 Bacteria 931
155 Ga0105243_10012439 3300009148 Bacteria 6433
156 Ga0105241_10679957 3300009174 Bacteria 937
157 Ga0105242_10389112 3300009176 Bacteria 1298
158 Ga0105237_10015139 3300009545 Bacteria 8036
159 Ga0105237_10485463 3300009545 Bacteria 1242
160 Ga0105238_10282264 3300009551 Bacteria 1642
161 Ga0105249_10153290 3300009553 Bacteria 2220
162 Ga0105249_10477830 3300009553 Bacteria 1289
163 Ga0105239_10081987 3300010375 Bacteria 3551
164 Ga0105246_10010884 3300011119 Bacteria 5640
165 Ga0157371_10033429 3300013102 Bacteria 3695
166 Ga0157370_10179473 3300013104 Bacteria 1968
167 Ga0157370_10277471 3300013104 Unclassified 1549
168 Ga0157370_10441158 3300013104 Bacteria 1197
169 Ga0157370_10774094 3300013104 Bacteria 874
170 Ga0157369_10109692 3300013105 Bacteria 2934
171 Ga0157369_10917896 3300013105 Unclassified 898
172 Ga0157374_10030759 3300013296 Bacteria 4877
173 Ga0157378_10063051 3300013297 Bacteria 3311
174 Ga0157372_10212818 3300013307 Bacteria 2240
175 Ga0157375_10053139 3300013308 Bacteria 3985
176 Ga0157375_10688252 3300013308 Bacteria 1177
177 Ga0157375_11243614 3300013308 Bacteria 874
178 Ga0163163_10059047 3300014325 Bacteria 3793
179 Ga0163163_10124311 3300014325 Bacteria 2616
180 Ga0163163_10437680 3300014325 Bacteria 1367
181 Ga0157379_10031848 3300014968 Bacteria 4698
182 Ga0157379_10040382 3300014968 Bacteria 4164
183 Ga0157379_10177253 3300014968 Bacteria 1925
184 Ga0157376_10952070 3300014969 Bacteria 879
185 Ga0206354_10076865 3300020081 Bacteria 1044
186 Ga0206353_10058000 3300020082 Bacteria 2263
187 Ga0213875_10001000 3300021388 Bacteria 20116
188 Ga0213875_10030228 3300021388 Bacteria 2565
189 Ga0213875_10041403 3300021388 Bacteria 2167
190 Ga0224712_10019901 3300022467 Bacteria 2271
191 Ga0207692_10000224 3300025898 Bacteria 19184
192 Ga0207692_10000953 3300025898 Bacteria 10510
193 Ga0207692_10002010 3300025898 Bacteria 7764
194 Ga0207692_10011326 3300025898 Bacteria 3790
195 Ga0207692_10019195 3300025898 Bacteria 3085
196 Ga0207692_10059041 3300025898 Bacteria 1979
197 Ga0207692_10110410 3300025898 Bacteria 1524
198 Ga0207692_10143474 3300025898 Bacteria 1360
199 Ga0207692_10152359 3300025898 Bacteria 1325
200 Ga0207692_10322092 3300025898 Bacteria 946
201 Ga0207680_10047428 3300025903 Bacteria 2546
202 Ga0207699_10002800 3300025906 Bacteria 8243
203 Ga0207699_10003187 3300025906 Bacteria 7810
204 Ga0207699_10004517 3300025906 Bacteria 6646
205 Ga0207699_10006631 3300025906 Bacteria 5618
206 Ga0207699_10010475 3300025906 Bacteria 4655
207 Ga0207699_10032587 3300025906 Bacteria 2937
208 Ga0207699_10058914 3300025906 Bacteria 2299
209 Ga0207699_10147690 3300025906 Bacteria 1552
210 Ga0207699_10370080 3300025906 Bacteria 1015
211 Ga0207699_10424080 3300025906 Bacteria 951
212 Ga0207684_10071339 3300025910 Bacteria 2952
213 Ga0207684_10147263 3300025910 Bacteria 2025
214 Ga0207684_10178700 3300025910 Bacteria 1830
215 Ga0207707_10434925 3300025912 Archaea 1124
216 Ga0207671_10105208 3300025914 Bacteria 2141
217 Ga0207671_10184733 3300025914 Bacteria 1624
218 Ga0207693_10000573 3300025915 Bacteria 33111
219 Ga0207693_10003789 3300025915 Bacteria 12877
220 Ga0207693_10006097 3300025915 Bacteria 9986
221 Ga0207693_10015324 3300025915 Bacteria 6153
222 Ga0207693_10035502 3300025915 Bacteria 3930
223 Ga0207693_10065219 3300025915 Unclassified 2852
224 Ga0207693_10105301 3300025915 Bacteria 2212
225 Ga0207693_10111359 3300025915 Bacteria 2147
226 Ga0207693_10311175 3300025915 Bacteria 1233
227 Ga0207663_10001225 3300025916 Bacteria 11840
228 Ga0207663_10004839 3300025916 Bacteria 6736
229 Ga0207663_10015100 3300025916 Bacteria 4251
230 Ga0207663_10034386 3300025916 Bacteria 3030
231 Ga0207663_10046674 3300025916 Bacteria 2670
232 Ga0207663_10067463 3300025916 Bacteria 2294
233 Ga0207663_10074512 3300025916 Bacteria 2200
234 Ga0207663_10192634 3300025916 Bacteria 1465
235 Ga0207663_10357582 3300025916 Unclassified 1107
236 Ga0207662_10543498 3300025918 Bacteria 804
237 Ga0207646_10042551 3300025922 Bacteria 4080
238 Ga0207646_10057918 3300025922 Bacteria 3461
239 Ga0207646_10599265 3300025922 Bacteria 989
240 Ga0207700_10000444 3300025928 Bacteria 24358
241 Ga0207700_10002887 3300025928 Bacteria 9905
242 Ga0207700_10004702 3300025928 Bacteria 8092
243 Ga0207700_10017164 3300025928 Bacteria 4828
244 Ga0207700_10019260 3300025928 Bacteria 4606
245 Ga0207700_10025559 3300025928 Bacteria 4103
246 Ga0207700_10030878 3300025928 Bacteria 3800
247 Ga0207700_10068033 3300025928 Bacteria 2729
248 Ga0207700_10157480 3300025928 Bacteria 1883
249 Ga0207700_10160674 3300025928 Bacteria 1866
250 Ga0207700_10188174 3300025928 Bacteria 1733
251 Ga0207700_10622426 3300025928 Bacteria 961
252 Ga0207700_10744676 3300025928 Bacteria 876
253 Ga0207664_10001277 3300025929 Bacteria 16597
254 Ga0207664_10001370 3300025929 Bacteria 16011
255 Ga0207664_10001743 3300025929 Bacteria 14333
256 Ga0207664_10008935 3300025929 Bacteria 7017
257 Ga0207664_10017226 3300025929 Bacteria 5291
258 Ga0207664_10017497 3300025929 Bacteria 5257
259 Ga0207664_10023910 3300025929 Bacteria 4586
260 Ga0207664_10032119 3300025929 Bacteria 4022
261 Ga0207664_10036630 3300025929 Bacteria 3792
262 Ga0207664_10038719 3300025929 Bacteria 3698
263 Ga0207664_10136776 3300025929 Bacteria 2068
264 Ga0207664_10231648 3300025929 Bacteria 1606
265 Ga0207664_10282848 3300025929 Bacteria 1456
266 Ga0207664_10548420 3300025929 Bacteria 1037
267 Ga0207664_10812926 3300025929 Bacteria 841
268 Ga0207686_10519836 3300025934 Bacteria 926
269 Ga0207665_10009197 3300025939 Bacteria 6487
270 Ga0207665_10012891 3300025939 Bacteria 5497
271 Ga0207665_10023712 3300025939 Bacteria 4041
272 Ga0207665_10026817 3300025939 Bacteria 3805
273 Ga0207665_10051402 3300025939 Bacteria 2774
274 Ga0207665_10056771 3300025939 Bacteria 2643
275 Ga0207691_10118831 3300025940 Bacteria 2345
276 Ga0207689_10006643 3300025942 Bacteria 10199
277 Ga0207661_10141220 3300025944 Bacteria 2073
278 Ga0207661_10452179 3300025944 Bacteria 1170
279 Ga0207661_10482281 3300025944 Bacteria 1132
280 Ga0207679_10332169 3300025945 Bacteria 1319
281 Ga0207667_10291066 3300025949 Bacteria 1669
282 Ga0207651_10148804 3300025960 Bacteria 1820
283 Ga0207712_10262143 3300025961 Bacteria 1402
284 Ga0207640_10336800 3300025981 Bacteria 1207
285 Ga0207677_10041058 3300026023 Bacteria 3056
286 Ga0207677_10125409 3300026023 Bacteria 1940
287 Ga0207678_10033476 3300026067 Bacteria 4476
288 Ga0207702_10010741 3300026078 Bacteria 7646
289 Ga0207702_10052392 3300026078 Bacteria 3453
290 Ga0207702_10617791 3300026078 Bacteria 1064
291 Ga0207676_10031540 3300026095 Bacteria 3987
292 Ga0207674_10123479 3300026116 Bacteria 2555
293 Ga0207675_100039503 3300026118 Bacteria 4404
294 Ga0207683_10011299 3300026121 Bacteria 7614
295 Ga0207683_10576095 3300026121 Bacteria 1041
296 Ga0268266_10097558 3300028379 Bacteria 2585
297 Ga0268264_10199109 3300028381 Bacteria 1831
298 Ga0265337_1105353 3300028556 Bacteria 767
299 Ga0307508_10009267 3300031616 Bacteria 9060
300 Ga0307413_10588437 3300031824 Bacteria 909
301 Ga0307406_10056797 3300031901 Bacteria 2509
302 Ga0307406_10444388 3300031901 Bacteria 1039
303 Ga0373926_0158564 3300035083 Bacteria 863
304 Ga0373934_0017289 3300035086 Bacteria 2751
305 Ga0373934_0081116 3300035086 Bacteria 1303
306 Ga0373944_0057353 3300035089 Bacteria 1241
307 Ga0373923_0005560 3300035111 Bacteria 4286
308 Ga0373923_0026493 3300035111 Bacteria 2307
309 Ga0373923_0029637 3300035111 Bacteria 2196
310 Ga0373936_0000657 3300035113 Bacteria 11985
311 Ga0373936_0026284 3300035113 Bacteria 2280
312 Ga0373936_0037880 3300035113 Bacteria 1927
313 Ga0373945_0000133 3300035116 Bacteria 18677
314 Ga0373945_0013147 3300035116 Bacteria 2759
315 Ga0373945_0139543 3300035116 Bacteria 976
316 Ga0373953_0199609 3300035117 Bacteria 865
317 Ga0373954_0032718 3300035118 Bacteria 2405
318 Ga0373954_0077923 3300035118 Bacteria 1581
319 Ga0373954_0125155 3300035118 Bacteria 1249
320 Ga0373956_0002271 3300035119 Bacteria 7910
321 Ga0373956_0136731 3300035119 Bacteria 1149
322 Ga0373957_0021305 3300035120 Bacteria 2300
323 Ga0373943_0000073 3300035170 Bacteria 35361
324 Ga0373943_0025501 3300035170 Bacteria 2763
325 Ga0373943_0031013 3300035170 Bacteria 2534
326 Ga0373943_0208063 3300035170 Bacteria 1085
327 Ga0373943_0312272 3300035170 Bacteria 895
328 Ga0373943_0349261 3300035170 Bacteria 847
329 Ga0373946_0000104 3300035171 Bacteria 23948
330 Ga0373946_0007342 3300035171 Bacteria 4025
331 Ga0373946_0007898 3300035171 Bacteria 3906
332 Ga0373955_0003394 3300035172 Bacteria 6998
333 Ga0373955_0018022 3300035172 Bacteria 3503
334 Ga0373955_0023536 3300035172 Bacteria 3139
335 Ga0373955_0138806 3300035172 Bacteria 1424
336 Ga0373924_0013286 3300035410 Bacteria 3092
337 Ga0373924_0018472 3300035410 Bacteria 2687
338 Ga0373931_0014391 3300035691 Bacteria 3866
339 Ga0373935_0006706 3300035692 Bacteria 6883
340 Ga0373935_0025912 3300035692 Bacteria 3614
341 Ga0373935_0062809 3300035692 Bacteria 2379
342 Ga0373935_0067951 3300035692 Bacteria 2292
343 Ga0373935_0164766 3300035692 Bacteria 1513
344 Ga0373935_0670499 3300035692 Bacteria 761
345 Ga0373927_0010732 3300035695 Bacteria 6101
346 Ga0373933_0004080 3300035724 Bacteria 8045
347 Ga0373933_0019194 3300035724 Bacteria 3857
348 Ga0373933_0023465 3300035724 Bacteria 3525
349 Ga0373933_0039975 3300035724 Bacteria 2761
350 Ga0373933_0089613 3300035724 Bacteria 1896
351 Ga0373947_0004235 3300035725 Bacteria 8412
352 Ga0373947_0020177 3300035725 Bacteria 3846
353 Ga0373947_0034355 3300035725 Bacteria 2998
354 Ga0373947_0145224 3300035725 Bacteria 1525
355 Ga0373947_0155314 3300035725 Bacteria 1476
356 Ga0373947_0187439 3300035725 Bacteria 1349
357 Ga0373947_0221859 3300035725 Bacteria 1243
358 Ga0373937_0001941 3300036401 Bacteria 17308
359 Ga0373937_0005918 3300036401 Bacteria 10520
360 Ga0373937_0010554 3300036401 Bacteria 8068
361 Ga0373937_0020297 3300036401 Bacteria 5956
362 Ga0373937_0030539 3300036401 Bacteria 4880
363 Ga0373937_0079118 3300036401 Bacteria 3038
364 Ga0373937_0307626 3300036401 Bacteria 1499
365 Ga0373925_0001641 3300037068 Bacteria 18843
366 Ga0373925_0004358 3300037068 Bacteria 10705
367 Ga0373925_0008699 3300037068 Bacteria 7394
368 Ga0373925_0046084 3300037068 Bacteria 3241
369 Ga0373925_0046264 3300037068 Bacteria 3235
370 Ga0436364_0891793 3300037853 Bacteria 11674
371 Ga0436364_1005089 3300037853 Bacteria 1765
372 Ga0436364_1387239 3300037853 Bacteria 4606
373 Ga0436364_1548394 3300037853 Bacteria 98245
374 Ga0436363_0552937 3300039450 Bacteria 1051
375 Ga0466963_0020439 3300044694 Bacteria 4163
376 Ga0466959_0378314 3300045049 Bacteria 964
377 Ga0466958_0289912 3300045836 Bacteria 1050
378 Ga0466967_0004548 3300045976 Bacteria 9390
379 Ga0495592_0000814 3300046454 Bacteria 21607
380 Ga0495592_0005700 3300046454 Bacteria 9214
381 Ga0495592_0015336 3300046454 Bacteria 5815
382 Ga0495592_0343600 3300046454 Bacteria 959
383 Ga0495603_0066886 3300046455 Bacteria 2116
384 Ga0495629_0047658 3300046459 Bacteria 3006
385 Ga0495641_0013507 3300046461 Bacteria 4481
386 Ga0495641_0023629 3300046461 Bacteria 3049
387 Ga0495641_0026425 3300046461 Bacteria 2832
388 Ga0495641_0095743 3300046461 Bacteria 1325
389 Ga0495651_0009916 3300046462 Bacteria 7326
390 Ga0495651_0022999 3300046462 Bacteria 4847
391 Ga0495651_0029943 3300046462 Bacteria 4245
392 Ga0495651_0182477 3300046462 Bacteria 1484
393 Ga0495653_0001679 3300046463 Bacteria 17414
394 Ga0495653_0003013 3300046463 Bacteria 13501
395 Ga0495653_0005079 3300046463 Bacteria 10678
396 Ga0495653_0006645 3300046463 Bacteria 9490
397 Ga0495653_0017011 3300046463 Bacteria 5915
398 Ga0495653_0065714 3300046463 Bacteria 2729
399 Ga0495653_0069025 3300046463 Bacteria 2649
400 Ga0495580_0174521 3300046472 Bacteria 1485
401 Ga0495639_0032364 3300046475 Bacteria 2332
402 Ga0495639_0200090 3300046475 Bacteria 978
403 Ga0495662_0009534 3300046476 Bacteria 4763
404 Ga0495662_0030474 3300046476 Bacteria 2604
405 Ga0495664_0000635 3300046477 Bacteria 17885
406 Ga0495664_0002910 3300046477 Bacteria 9234
407 Ga0495664_0024881 3300046477 Bacteria 3482
408 Ga0495664_0030409 3300046477 Bacteria 3163
409 Ga0495664_0084193 3300046477 Bacteria 1908
410 Ga0495664_0145148 3300046477 Bacteria 1439
411 Ga0495608_0002262 3300046511 Bacteria 13901
412 Ga0495608_0006582 3300046511 Bacteria 8243
413 Ga0495608_0008175 3300046511 Bacteria 7346
414 Ga0495608_0017687 3300046511 Bacteria 4929
415 Ga0495608_0037446 3300046511 Bacteria 3262
416 Ga0495608_0108836 3300046511 Bacteria 1782
417 Ga0495618_0002161 3300046514 Bacteria 12869
418 Ga0495618_0006814 3300046514 Bacteria 6920
419 Ga0495618_0054738 3300046514 Bacteria 2526
420 Ga0495618_0227033 3300046514 Bacteria 1176
421 Ga0495618_0389870 3300046514 Bacteria 853
422 Ga0495628_0002958 3300046516 Bacteria 15238
423 Ga0495628_0007633 3300046516 Bacteria 9346
424 Ga0495628_0008990 3300046516 Bacteria 8547
425 Ga0495628_0043131 3300046516 Bacteria 3595
426 Ga0495628_0061780 3300046516 Bacteria 2938
427 Ga0495628_0309830 3300046516 Bacteria 1167
428 Ga0495630_0001802 3300046517 Bacteria 14941
429 Ga0495630_0002750 3300046517 Bacteria 12213
430 Ga0495630_0107181 3300046517 Bacteria 2116
431 Ga0495652_0001329 3300046529 Bacteria 27555
432 Ga0495652_0007962 3300046529 Bacteria 9729
433 Ga0495652_0008725 3300046529 Bacteria 9231
434 Ga0495652_0009414 3300046529 Bacteria 8878
435 Ga0495652_0032935 3300046529 Bacteria 4529
436 Ga0495652_0068875 3300046529 Bacteria 2963
437 Ga0495652_0135998 3300046529 Bacteria 1939
438 Ga0495665_0007667 3300046531 Bacteria 5842
439 Ga0495665_0021709 3300046531 Bacteria 3452
440 Ga0495665_0138852 3300046531 Bacteria 1271
441 Ga0495640_0005680 3300046533 Bacteria 9916
442 Ga0495640_0011284 3300046533 Bacteria 6878
443 Ga0495640_0024077 3300046533 Bacteria 4430
444 Ga0495586_0179623 3300046535 Bacteria 1197
445 Ga0495587_0015974 3300046536 Bacteria 4673
446 Ga0495587_0027595 3300046536 Bacteria 3457
447 Ga0495587_0088208 3300046536 Bacteria 1795
448 Ga0495645_0003366 3300046543 Bacteria 10834
449 Ga0495645_0014838 3300046543 Bacteria 5536
450 Ga0495645_0049620 3300046543 Bacteria 3056
451 Ga0495645_0057909 3300046543 Bacteria 2812
452 Ga0495645_0280610 3300046543 Bacteria 1095
453 Ga0495667_0003044 3300046559 Bacteria 11248
454 Ga0495667_0003133 3300046559 Bacteria 11091
455 Ga0495667_0006033 3300046559 Bacteria 8199
456 Ga0495667_0009221 3300046559 Bacteria 6695
457 Ga0495667_0013532 3300046559 Bacteria 5518
458 Ga0495667_0021837 3300046559 Bacteria 4317
459 Ga0495667_0269722 3300046559 Bacteria 1081
460 Ga0495634_0021777 3300046642 Bacteria 4525
461 Ga0495634_0032533 3300046642 Bacteria 3587
462 Ga0495634_0130562 3300046642 Bacteria 1602
463 Ga0495635_0001396 3300046663 Bacteria 16118
464 Ga0495635_0001665 3300046663 Bacteria 14971
465 Ga0495635_0004927 3300046663 Bacteria 9292
466 Ga0495635_0006234 3300046663 Bacteria 8309
467 Ga0495635_0014724 3300046663 Bacteria 5472
468 Ga0495635_0185911 3300046663 Bacteria 1411
469 Ga0495657_0006244 3300046675 Bacteria 9344
470 Ga0495657_0010129 3300046675 Bacteria 7103
471 Ga0495657_0012880 3300046675 Bacteria 6194
472 Ga0495657_0018859 3300046675 Bacteria 4986
473 Ga0495657_0027692 3300046675 Bacteria 3996
474 Ga0495657_0291640 3300046675 Bacteria 974
475 Ga0495599_0000975 3300046678 Bacteria 16018
476 Ga0495599_0002174 3300046678 Bacteria 11394
477 Ga0495599_0015329 3300046678 Bacteria 4756
478 Ga0495599_0266285 3300046678 Bacteria 1040
479 Ga0495623_0016516 3300046679 Bacteria 4769
480 Ga0495623_0125994 3300046679 Bacteria 1538
481 Ga0495646_0002834 3300046680 Bacteria 10727
482 Ga0495646_0003145 3300046680 Bacteria 10246
483 Ga0495646_0005704 3300046680 Bacteria 7885
484 Ga0495647_0181674 3300046681 Bacteria 915
485 Ga0495624_0006076 3300046690 Bacteria 8605
486 Ga0495624_0021112 3300046690 Bacteria 4324
487 Ga0495624_0105624 3300046690 Bacteria 1733
488 Ga0495624_0252838 3300046690 Bacteria 1066
489 Ga0495600_0021877 3300046809 Bacteria 4100
490 Ga0495600_0029919 3300046809 Bacteria 3527
491 Ga0495600_0031774 3300046809 Bacteria 3422
492 Ga0495581_0013652 3300047315 Bacteria 4710
493 Ga0495581_0076448 3300047315 Bacteria 1937
494 Ga0495604_0040001 3300047317 Bacteria 3683
495 Ga0495674_0000118 3300047319 Bacteria 59873
496 Ga0495674_0007141 3300047319 Bacteria 10688
497 Ga0495674_0008159 3300047319 Bacteria 9991
498 Ga0495674_0009843 3300047319 Bacteria 9073
499 Ga0495674_0063158 3300047319 Bacteria 3222
500 Ga0495674_0097196 3300047319 Bacteria 2508
501 Ga0495674_0278442 3300047319 Bacteria 1371
502 Ga0495676_0008136 3300047321 Bacteria 9618
503 Ga0495676_0045045 3300047321 Bacteria 3595
504 Ga0495676_0060972 3300047321 Bacteria 2953
505 Ga0495676_0131818 3300047321 Bacteria 1803
506 Ga0495680_0002889 3300047322 Bacteria 17262
507 Ga0495680_0003517 3300047322 Bacteria 15371
508 Ga0495680_0005124 3300047322 Bacteria 12375
509 Ga0495680_0011627 3300047322 Bacteria 7779
510 Ga0495680_0020517 3300047322 Bacteria 5558
511 Ga0495680_0141956 3300047322 Bacteria 1756
512 Ga0495675_0299242 3300047444 Bacteria 956
513 Ga0495684_0000934 3300047471 Bacteria 23721
514 Ga0495684_0001006 3300047471 Bacteria 22952
515 Ga0495684_0002604 3300047471 Bacteria 14332
516 Ga0495684_0005169 3300047471 Bacteria 10170
517 Ga0495684_0008489 3300047471 Bacteria 7955
518 Ga0495684_0184897 3300047471 Bacteria 1543
519 Ga0495593_0116989 3300047673 Bacteria 1358
520 Ga0495602_0007103 3300048088 Bacteria 11756
521 Ga0495602_0020202 3300048088 Bacteria 6586
522 Ga0495602_0035049 3300048088 Bacteria 4685
523 Ga0495602_0050332 3300048088 Bacteria 3723
524 Ga0495602_0061455 3300048088 Bacteria 3267
525 Ga0495602_0157743 3300048088 Bacteria 1775
526 Ga0496101_0054317 3300048904 Bacteria 2892
527 Ga0496102_0063482 3300048905 Bacteria 3382
528 Ga0496104_0034992 3300048907 Bacteria 4687
529 Ga0496104_0262963 3300048907 Bacteria 1638
530 Ga0496104_0280251 3300048907 Bacteria 1580
531 Ga0496105_0024748 3300048908 Bacteria 4880
532 Ga0496106_0071843 3300048909 Bacteria 2645
533 Ga0496106_0261073 3300048909 Bacteria 1386
534 Ga0496108_0014674 3300048911 Bacteria 6395
535 Ga0496108_0028631 3300048911 Bacteria 4610
536 Ga0496108_0206773 3300048911 Bacteria 1703
537 Ga0496109_0054645 3300048912 Bacteria 3642
538 Ga0496109_0063062 3300048912 Bacteria 3390
539 Ga0496109_0080205 3300048912 Bacteria 3007
540 Ga0496110_0094212 3300048913 Bacteria 2681
541 Ga0496110_0347813 3300048913 Bacteria 1350
542 Ga0496111_0081377 3300048914 Bacteria 2364
543 Ga0496111_0243060 3300048914 Bacteria 1336
544 Ga0496112_0038645 3300048915 Bacteria 4661
545 Ga0496112_0048655 3300048915 Bacteria 4156
546 Ga0496112_0794876 3300048915 Bacteria 871
547 Ga0496113_0200152 3300048916 Bacteria 1587
548 Ga0496114_0394510 3300048917 Bacteria 1226
549 Ga0496126_0037425 3300048929 Bacteria 4528
550 Ga0496126_0311933 3300048929 Bacteria 1295
551 Ga0496126_0393208 3300048929 Bacteria 1126
552 nmdc:mga05p37_14160_c1 3300050507 Bacteria 9573
553 nmdc:mga05p37_24679_c1 3300050507 Bacteria 7308
554 nmdc:mga06r32_67083_c1 3300050510 Bacteria 3463
555 nmdc:mga08y16_667062_c1 3300050511 Bacteria 1042
556 nmdc:mga0n895_2314_c1 3300050512 Bacteria 14828
557 nmdc:mga0n895_532_c1 3300050512 Bacteria 25953
558 nmdc:mga0rr50_11978_c1 3300050513 Bacteria 5581
559 nmdc:mga08x19_191848_c1 3300050514 Unclassified 1398
560 nmdc:mga08x19_256639_c1 3300050514 Bacteria 1208
561 nmdc:mga08x19_350890_c1 3300050514 Unclassified 1030
562 nmdc:mga0a205_3649_c1 3300050515 Bacteria 13787
563 Ga0495601_0021190 3300053077 Bacteria 3979
564 Ga0495601_0026209 3300053077 Bacteria 3598
565 Ga0495601_0113378 3300053077 Bacteria 1757
566 Ga0495619_0034311 3300053085 Bacteria 3299
567 Ga0495619_0063264 3300053085 Bacteria 2465
568 Ga0530510_0153849 3300061734 Bacteria 1699
569 Ga0373937_0257670
570 JGI25404J52841_10011895
571 Ga0070658_10167176
572 Ga0070683_100055517
573 Ga0068869_100013459
574 Ga0068869_100233573
575 Ga0070666_10097198
576 Ga0068868_100036911
577 Ga0070691_10034279
578 Ga0070692_10119033
579 Ga0070692_10269825
580 Ga0070675_100302619
581 Ga0070671_100086526
582 Ga0070673_100089627
583 Ga0070659_100344233
584 Ga0070667_100117161
585 Ga0070709_10003373
586 Ga0070709_10005183
587 Ga0070709_10029402
588 Ga0070709_10038522
589 Ga0070709_10046348
590 Ga0070709_10058744
591 Ga0070714_100000632
592 Ga0070714_100002887
593 Ga0070714_100003084
594 Ga0070714_100027801
595 Ga0070714_100068331
596 Ga0070714_100073322
597 Ga0070714_100083437
598 Ga0070714_100161687
599 Ga0070714_100193192
600 Ga0070714_100252381
601 Ga0070714_100266830
602 Ga0070714_100466079
603 Ga0070714_100475815
604 Ga0070714_100677567
605 Ga0070713_100000485
606 Ga0070713_100001569
607 Ga0070713_100001803
608 Ga0070713_100002301
609 Ga0070713_100009842
610 Ga0070713_100015183
611 Ga0070713_100022304
612 Ga0070713_100147681
613 Ga0070713_100161150
614 Ga0070713_100236589
615 Ga0070713_100379708
616 Ga0070710_10000311
617 Ga0070710_10000537
618 Ga0070710_10003536
619 Ga0070710_10005891
620 Ga0070710_10010383
621 Ga0070710_10010652
622 Ga0070710_10025121
623 Ga0070710_10033220
624 Ga0070710_10035642
625 Ga0070710_10092205
626 Ga0070710_10473765
627 Ga0070711_100008743
628 Ga0070711_100011658
629 Ga0070711_100093695
630 Ga0070711_100095250
631 Ga0070711_100124092
632 Ga0070711_100137571
633 Ga0070711_100147844
634 Ga0070711_100208567
635 Ga0070711_100285274
636 Ga0070711_100374373
637 Ga0070708_100118706
638 Ga0070663_100021753
639 Ga0070678_100005980
640 Ga0070681_10220633
641 Ga0070681_10326118
642 Ga0070706_100006803
643 Ga0070706_100041666
644 Ga0070706_100287003
645 Ga0070706_100287595
646 Ga0070707_100027059
647 Ga0070707_100064692
648 Ga0070707_100329838
649 Ga0070707_100619731
650 Ga0070698_100000840
651 Ga0070699_100304044
652 Ga0070684_100037868
653 Ga0070684_100310568
654 Ga0068853_100518905
655 Ga0070672_100101263
656 Ga0070695_100054276
657 Ga0070696_100033206
658 Ga0070665_100463762
659 Ga0070664_100703424
660 Ga0068854_100147639
661 Ga0068856_100008878
662 Ga0068856_100044713
663 Ga0068856_100054045
664 Ga0068856_100223901
665 Ga0068856_100351317
666 Ga0068856_100361088
667 Ga0068852_100069870
668 Ga0068859_100205766
669 Ga0068864_100028740
670 Ga0068863_100190195
671 Ga0068863_100483464
672 Ga0068860_100177374
673 Ga0068860_100773681
674 Ga0081540_1000097
675 Ga0081540_1023493
676 Ga0070717_10005252
677 Ga0070717_10006941
678 Ga0070717_10010058
679 Ga0070717_10011328
680 Ga0070717_10018609
681 Ga0070717_10028556
682 Ga0070717_10029373
683 Ga0070717_10059060
684 Ga0070717_10138652
685 Ga0070715_10257872
686 Ga0070716_100023623
687 Ga0070716_100030218
688 Ga0070716_100031469
689 Ga0070712_100001140
690 Ga0070712_100002585
691 Ga0070712_100002764
692 Ga0070712_100031081
693 Ga0070712_100036548
694 Ga0070712_100093863
695 Ga0070712_100094228
696 Ga0070712_100141646
697 Ga0097621_100016001
698 Ga0097621_100077369
699 Ga0068871_100026696
700 Ga0068871_100752815
701 Ga0075428_100429401
702 Ga0075428_100655760
703 Ga0075433_10004443
704 Ga0075433_10005411
705 Ga0075434_100000613
706 Ga0075429_100188050
707 Ga0068865_100710243
708 Ga0075436_100024485
709 Ga0075436_100041093
710 Ga0075436_100231778
711 Ga0097620_100205777
712 Ga0097620_100305565
713 Ga0075435_100007766
714 Ga0105240_10121725
715 Ga0111539_11034333
716 Ga0105245_10037840
717 Ga0105245_10070560
718 Ga0105247_10218392
719 Ga0114129_10002954
720 Ga0114129_10029589
721 Ga0114129_10142132
722 Ga0114129_11230218
723 Ga0105243_10012439
724 Ga0105241_10679957
725 Ga0105242_10389112
726 Ga0105237_10015139
727 Ga0105237_10485463
728 Ga0105238_10282264
729 Ga0105249_10153290
730 Ga0105249_10477830
731 Ga0105239_10081987
732 Ga0105246_10010884
733 Ga0157371_10033429
734 Ga0157370_10179473
735 Ga0157370_10277471
736 Ga0157370_10441158
737 Ga0157370_10774094
738 Ga0157369_10109692
739 Ga0157369_10917896
740 Ga0157374_10030759
741 Ga0157378_10063051
742 Ga0157372_10212818
743 Ga0157375_10053139
744 Ga0157375_10688252
745 Ga0157375_11243614
746 Ga0163163_10059047
747 Ga0163163_10124311
748 Ga0163163_10437680
749 Ga0157379_10031848
750 Ga0157379_10040382
751 Ga0157379_10177253
752 Ga0157376_10952070
753 Ga0206354_10076865
754 Ga0206353_10058000
755 Ga0213875_10001000
756 Ga0213875_10030228
757 Ga0213875_10041403
758 Ga0224712_10019901
759 Ga0207692_10000224
760 Ga0207692_10000953
761 Ga0207692_10002010
762 Ga0207692_10011326
763 Ga0207692_10019195
764 Ga0207692_10059041
765 Ga0207692_10110410
766 Ga0207692_10143474
767 Ga0207692_10152359
768 Ga0207692_10322092
769 Ga0207680_10047428
770 Ga0207699_10002800
771 Ga0207699_10003187
772 Ga0207699_10004517
773 Ga0207699_10006631
774 Ga0207699_10010475
775 Ga0207699_10032587
776 Ga0207699_10058914
777 Ga0207699_10147690
778 Ga0207699_10370080
779 Ga0207699_10424080
780 Ga0207684_10071339
781 Ga0207684_10147263
782 Ga0207684_10178700
783 Ga0207707_10434925
784 Ga0207671_10105208
785 Ga0207671_10184733
786 Ga0207693_10000573
787 Ga0207693_10003789
788 Ga0207693_10006097
789 Ga0207693_10015324
790 Ga0207693_10035502
791 Ga0207693_10065219
792 Ga0207693_10105301
793 Ga0207693_10111359
794 Ga0207693_10311175
795 Ga0207663_10001225
796 Ga0207663_10004839
797 Ga0207663_10015100
798 Ga0207663_10034386
799 Ga0207663_10046674
800 Ga0207663_10067463
801 Ga0207663_10074512
802 Ga0207663_10192634
803 Ga0207663_10357582
804 Ga0207662_10543498
805 Ga0207646_10042551
806 Ga0207646_10057918
807 Ga0207646_10599265
808 Ga0207700_10000444
809 Ga0207700_10002887
810 Ga0207700_10004702
811 Ga0207700_10017164
812 Ga0207700_10019260
813 Ga0207700_10025559
814 Ga0207700_10030878
815 Ga0207700_10068033
816 Ga0207700_10157480
817 Ga0207700_10160674
818 Ga0207700_10188174
819 Ga0207700_10622426
820 Ga0207700_10744676
821 Ga0207664_10001277
822 Ga0207664_10001370
823 Ga0207664_10001743
824 Ga0207664_10008935
825 Ga0207664_10017226
826 Ga0207664_10017497
827 Ga0207664_10023910
828 Ga0207664_10032119
829 Ga0207664_10036630
830 Ga0207664_10038719
831 Ga0207664_10136776
832 Ga0207664_10231648
833 Ga0207664_10282848
834 Ga0207664_10548420
835 Ga0207664_10812926
836 Ga0207686_10519836
837 Ga0207665_10009197
838 Ga0207665_10012891
839 Ga0207665_10023712
840 Ga0207665_10026817
841 Ga0207665_10051402
842 Ga0207665_10056771
843 Ga0207691_10118831
844 Ga0207689_10006643
845 Ga0207661_10141220
846 Ga0207661_10452179
847 Ga0207661_10482281
848 Ga0207679_10332169
849 Ga0207667_10291066
850 Ga0207651_10148804
851 Ga0207712_10262143
852 Ga0207640_10336800
853 Ga0207677_10041058
854 Ga0207677_10125409
855 Ga0207678_10033476
856 Ga0207702_10010741
857 Ga0207702_10052392
858 Ga0207702_10617791
859 Ga0207676_10031540
860 Ga0207674_10123479
861 Ga0207675_100039503
862 Ga0207683_10011299
863 Ga0207683_10576095
864 Ga0268266_10097558
865 Ga0268264_10199109
866 Ga0265337_1105353
867 Ga0307508_10009267
868 Ga0307413_10588437
869 Ga0307406_10056797
870 Ga0307406_10444388
871 Ga0373926_0158564
872 Ga0373934_0017289
873 Ga0373934_0081116
874 Ga0373944_0057353
875 Ga0373923_0005560
876 Ga0373923_0026493
877 Ga0373923_0029637
878 Ga0373936_0000657
879 Ga0373936_0026284
880 Ga0373936_0037880
881 Ga0373945_0000133
882 Ga0373945_0013147
883 Ga0373945_0139543
884 Ga0373953_0199609
885 Ga0373954_0032718
886 Ga0373954_0077923
887 Ga0373954_0125155
888 Ga0373956_0002271
889 Ga0373956_0136731
890 Ga0373957_0021305
891 Ga0373943_0000073
892 Ga0373943_0025501
893 Ga0373943_0031013
894 Ga0373943_0208063
895 Ga0373943_0312272
896 Ga0373943_0349261
897 Ga0373946_0000104
898 Ga0373946_0007342
899 Ga0373946_0007898
900 Ga0373955_0003394
901 Ga0373955_0018022
902 Ga0373955_0023536
903 Ga0373955_0138806
904 Ga0373924_0013286
905 Ga0373924_0018472
906 Ga0373931_0014391
907 Ga0373935_0006706
908 Ga0373935_0025912
909 Ga0373935_0062809
910 Ga0373935_0067951
911 Ga0373935_0164766
912 Ga0373935_0670499
913 Ga0373927_0010732
914 Ga0373933_0004080
915 Ga0373933_0019194
916 Ga0373933_0023465
917 Ga0373933_0039975
918 Ga0373933_0089613
919 Ga0373947_0004235
920 Ga0373947_0020177
921 Ga0373947_0034355
922 Ga0373947_0145224
923 Ga0373947_0155314
924 Ga0373947_0187439
925 Ga0373947_0221859
926 Ga0373937_0001941
927 Ga0373937_0005918
928 Ga0373937_0010554
929 Ga0373937_0020297
930 Ga0373937_0030539
931 Ga0373937_0079118
932 Ga0373937_0307626
933 Ga0373925_0001641
934 Ga0373925_0004358
935 Ga0373925_0008699
936 Ga0373925_0046084
937 Ga0373925_0046264
938 Ga0436364_0891793
939 Ga0436364_1005089
940 Ga0436364_1387239
941 Ga0436364_1548394
942 Ga0436363_0552937
943 Ga0466963_0020439
944 Ga0466959_0378314
945 Ga0466958_0289912
946 Ga0466967_0004548
947 Ga0495592_0000814
948 Ga0495592_0005700
949 Ga0495592_0015336
950 Ga0495592_0343600
951 Ga0495603_0066886
952 Ga0495629_0047658
953 Ga0495641_0013507
954 Ga0495641_0023629
955 Ga0495641_0026425
956 Ga0495641_0095743
957 Ga0495651_0009916
958 Ga0495651_0022999
959 Ga0495651_0029943
960 Ga0495651_0182477
961 Ga0495653_0001679
962 Ga0495653_0003013
963 Ga0495653_0005079
964 Ga0495653_0006645
965 Ga0495653_0017011
966 Ga0495653_0065714
967 Ga0495653_0069025
968 Ga0495580_0174521
969 Ga0495639_0032364
970 Ga0495639_0200090
971 Ga0495662_0009534
972 Ga0495662_0030474
973 Ga0495664_0000635
974 Ga0495664_0002910
975 Ga0495664_0024881
976 Ga0495664_0030409
977 Ga0495664_0084193
978 Ga0495664_0145148
979 Ga0495608_0002262
980 Ga0495608_0006582
981 Ga0495608_0008175
982 Ga0495608_0017687
983 Ga0495608_0037446
984 Ga0495608_0108836
985 Ga0495618_0002161
986 Ga0495618_0006814
987 Ga0495618_0054738
988 Ga0495618_0227033
989 Ga0495618_0389870
990 Ga0495628_0002958
991 Ga0495628_0007633
992 Ga0495628_0008990
993 Ga0495628_0043131
994 Ga0495628_0061780
995 Ga0495628_0309830
996 Ga0495630_0001802
997 Ga0495630_0002750
998 Ga0495630_0107181
999 Ga0495652_0001329
1000 Ga0495652_0007962
1001 Ga0495652_0008725
1002 Ga0495652_0009414
1003 Ga0495652_0032935
1004 Ga0495652_0068875
1005 Ga0495652_0135998
1006 Ga0495665_0007667
1007 Ga0495665_0021709
1008 Ga0495665_0138852
1009 Ga0495640_0005680
1010 Ga0495640_0011284
1011 Ga0495640_0024077
1012 Ga0495586_0179623
1013 Ga0495587_0015974
1014 Ga0495587_0027595
1015 Ga0495587_0088208
1016 Ga0495645_0003366
1017 Ga0495645_0014838
1018 Ga0495645_0049620
1019 Ga0495645_0057909
1020 Ga0495645_0280610
1021 Ga0495667_0003044
1022 Ga0495667_0003133
1023 Ga0495667_0006033
1024 Ga0495667_0009221
1025 Ga0495667_0013532
1026 Ga0495667_0021837
1027 Ga0495667_0269722
1028 Ga0495634_0021777
1029 Ga0495634_0032533
1030 Ga0495634_0130562
1031 Ga0495635_0001396
1032 Ga0495635_0001665
1033 Ga0495635_0004927
1034 Ga0495635_0006234
1035 Ga0495635_0014724
1036 Ga0495635_0185911
1037 Ga0495657_0006244
1038 Ga0495657_0010129
1039 Ga0495657_0012880
1040 Ga0495657_0018859
1041 Ga0495657_0027692
1042 Ga0495657_0291640
1043 Ga0495599_0000975
1044 Ga0495599_0002174
1045 Ga0495599_0015329
1046 Ga0495599_0266285
1047 Ga0495623_0016516
1048 Ga0495623_0125994
1049 Ga0495646_0002834
1050 Ga0495646_0003145
1051 Ga0495646_0005704
1052 Ga0495647_0181674
1053 Ga0495624_0006076
1054 Ga0495624_0021112
1055 Ga0495624_0105624
1056 Ga0495624_0252838
1057 Ga0495600_0021877
1058 Ga0495600_0029919
1059 Ga0495600_0031774
1060 Ga0495581_0013652
1061 Ga0495581_0076448
1062 Ga0495604_0040001
1063 Ga0495674_0000118
1064 Ga0495674_0007141
1065 Ga0495674_0008159
1066 Ga0495674_0009843
1067 Ga0495674_0063158
1068 Ga0495674_0097196
1069 Ga0495674_0278442
1070 Ga0495676_0008136
1071 Ga0495676_0045045
1072 Ga0495676_0060972
1073 Ga0495676_0131818
1074 Ga0495680_0002889
1075 Ga0495680_0003517
1076 Ga0495680_0005124
1077 Ga0495680_0011627
1078 Ga0495680_0020517
1079 Ga0495680_0141956
1080 Ga0495675_0299242
1081 Ga0495684_0000934
1082 Ga0495684_0001006
1083 Ga0495684_0002604
1084 Ga0495684_0005169
1085 Ga0495684_0008489
1086 Ga0495684_0184897
1087 Ga0495593_0116989
1088 Ga0495602_0007103
1089 Ga0495602_0020202
1090 Ga0495602_0035049
1091 Ga0495602_0050332
1092 Ga0495602_0061455
1093 Ga0495602_0157743
1094 Ga0496101_0054317
1095 Ga0496102_0063482
1096 Ga0496104_0034992
1097 Ga0496104_0262963
1098 Ga0496104_0280251
1099 Ga0496105_0024748
1100 Ga0496106_0071843
1101 Ga0496106_0261073
1102 Ga0496108_0014674
1103 Ga0496108_0028631
1104 Ga0496108_0206773
1105 Ga0496109_0054645
1106 Ga0496109_0063062
1107 Ga0496109_0080205
1108 Ga0496110_0094212
1109 Ga0496110_0347813
1110 Ga0496111_0081377
1111 Ga0496111_0243060
1112 Ga0496112_0038645
1113 Ga0496112_0048655
1114 Ga0496112_0794876
1115 Ga0496113_0200152
1116 Ga0496114_0394510
1117 Ga0496126_0037425
1118 Ga0496126_0311933
1119 Ga0496126_0393208
1120 nmdc:mga05p37_14160_c1
1121 nmdc:mga05p37_24679_c1
1122 nmdc:mga06r32_67083_c1
1123 nmdc:mga08y16_667062_c1
1124 nmdc:mga0n895_2314_c1
1125 nmdc:mga0n895_532_c1
1126 nmdc:mga0rr50_11978_c1
1127 nmdc:mga08x19_191848_c1
1128 nmdc:mga08x19_256639_c1
1129 nmdc:mga08x19_350890_c1
1130 nmdc:mga0a205_3649_c1
1131 Ga0495601_0021190
1132 Ga0495601_0026209
1133 Ga0495601_0113378
1134 Ga0495619_0034311
1135 Ga0495619_0063264
1136 Ga0530510_0153849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

17

132

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.8229 12 214
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.8085 16 214
5cgz-assembly1.cif.gz_A crystal structure of galb, the 4-carboxy-2-hydroxymuconate hydratase, from pseuodomonas putida kt2440 0.8006 14 214
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.7774 14 216
3dfm-assembly1.cif.gz_A the crystal structure of the zinc inhibited form of teicoplanin deacetylase orf2 0.7761 15 207
ID Description Score Start End Superfamily
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8403 15 170 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8229 12 214 3.40.50.10320
5cgzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8006 14 214 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7856 5 207 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7734 14 214 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A1C6SXS2-F1-model_v4 N-acetylglucosaminyl deacetylase, LmbE family 0.9831 15 214 GO:0016137
GO:0016811
AF-A0A7K2MV46-F1-model_v4 PIG-L family deacetylase 0.9781 62 213 GO:0016137
AF-A0A656Z3R4-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9724 12 199 GO:0016811
AF-A0A1H2BMI6-F1-model_v4 N-acetylglucosaminyl deacetylase, LmbE family 0.9712 2 214 GO:0016137
GO:0016811
AF-A0A1H2BMI6-F1-model_v4 N-acetylglucosaminyl deacetylase, LmbE family 0.9667 2 214 GO:0016137
GO:0016811

Map