F464275

General Info

Members Datasets Scaffolds Average Seq Length
565 206 1130 251

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10105760|Ga0207703_101057602
Length 244
Sequence MRALILAGGEGSRLRPLTHTNAKQLIPVAGAPILFHALEAIRDAGITDVGIVIGQTGDEIRAAVGDGAAWGLSVTYVPQDRPLGLAHAVLTSRDFVAGEPFLMYLGDNVLLEGLRRFVEEFERTRPDAQIFLAKVPEPERFGVAEVHGERIVGIEEKPHQPKSNYAVTGIYMYDASVFDKIKTLVPSNRGELEITDVNNAYIREGTLSFSFLDGWWTDAGTFESLLRATNLVAQWAPKETRADL

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.06
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10105760 3300026035 Bacteria 2392
2 Ga0070658_10057173 3300005327 Bacteria 3172
3 Ga0070658_10113859 3300005327 Bacteria 2243
4 Ga0070683_100000018 3300005329 Bacteria 193063
5 Ga0070683_100000124 3300005329 Bacteria 50336
6 Ga0070683_100042296 3300005329 Bacteria 4195
7 Ga0070683_100044776 3300005329 Bacteria 4082
8 Ga0070683_100444366 3300005329 Bacteria 1237
9 Ga0068869_100043819 3300005334 Bacteria 3216
10 Ga0068869_100052134 3300005334 Bacteria 2970
11 Ga0068869_100513657 3300005334 Bacteria 1002
12 Ga0068869_100547867 3300005334 Bacteria 971
13 Ga0070666_10025278 3300005335 Bacteria 3870
14 Ga0070680_100075946 3300005336 Bacteria 2766
15 Ga0070680_100320268 3300005336 Bacteria 1316
16 Ga0070680_100456101 3300005336 Bacteria 1092
17 Ga0070682_100226055 3300005337 Bacteria 1335
18 Ga0068868_100303395 3300005338 Bacteria 1357
19 Ga0068868_100629819 3300005338 Bacteria 953
20 Ga0070689_100170761 3300005340 Bacteria 1762
21 Ga0070689_100329263 3300005340 Bacteria 1277
22 Ga0070691_10002532 3300005341 Bacteria 8138
23 Ga0070661_100373356 3300005344 Bacteria 1123
24 Ga0070675_100106933 3300005354 Bacteria 2362
25 Ga0070675_100229749 3300005354 Bacteria 1618
26 Ga0070671_100167032 3300005355 Bacteria 1861
27 Ga0070688_100077827 3300005365 Bacteria 2138
28 Ga0070659_100103653 3300005366 Bacteria 2291
29 Ga0070659_100142593 3300005366 Bacteria 1951
30 Ga0070667_100177652 3300005367 Bacteria 1882
31 Ga0070667_100262804 3300005367 Bacteria 1546
32 Ga0070709_10179961 3300005434 Bacteria 1484
33 Ga0070709_10598717 3300005434 Bacteria 848
34 Ga0070714_100834655 3300005435 Bacteria 893
35 Ga0070701_10180926 3300005438 Bacteria 1234
36 Ga0070711_100042413 3300005439 Bacteria 3075
37 Ga0070711_100086692 3300005439 Bacteria 2245
38 Ga0070711_100154811 3300005439 Bacteria 1732
39 Ga0070711_100255411 3300005439 Bacteria 1377
40 Ga0070694_100239928 3300005444 Bacteria 1367
41 Ga0070694_100335102 3300005444 Bacteria 1168
42 Ga0070708_100055414 3300005445 Bacteria 3526
43 Ga0070678_100401173 3300005456 Bacteria 1191
44 Ga0070662_100135497 3300005457 Bacteria 1903
45 Ga0070681_10001551 3300005458 Bacteria 20353
46 Ga0070681_10162924 3300005458 Bacteria 2154
47 Ga0070681_10192016 3300005458 Bacteria 1962
48 Ga0070681_10283753 3300005458 Bacteria 1567
49 Ga0070681_10389243 3300005458 Bacteria 1305
50 Ga0068867_100052865 3300005459 Bacteria 2999
51 Ga0068867_100159950 3300005459 Bacteria 1775
52 Ga0068867_100362155 3300005459 Bacteria 1213
53 Ga0070706_100015943 3300005467 Bacteria 6939
54 Ga0070706_100064804 3300005467 Bacteria 3378
55 Ga0070679_100001406 3300005530 Bacteria 21251
56 Ga0070679_100053121 3300005530 Bacteria 4034
57 Ga0070679_100143309 3300005530 Bacteria 2368
58 Ga0070679_100390816 3300005530 Bacteria 1337
59 Ga0070684_100000011 3300005535 Bacteria 170628
60 Ga0070684_100000231 3300005535 Bacteria 38761
61 Ga0070684_100024329 3300005535 Bacteria 5079
62 Ga0070684_100364670 3300005535 Bacteria 1330
63 Ga0070697_100097155 3300005536 Bacteria 2444
64 Ga0068853_100041797 3300005539 Bacteria 3918
65 Ga0068853_100085968 3300005539 Bacteria 2758
66 Ga0068853_100127504 3300005539 Bacteria 2275
67 Ga0068853_100238449 3300005539 Bacteria 1666
68 Ga0068853_100328010 3300005539 Bacteria 1420
69 Ga0068853_100392296 3300005539 Bacteria 1298
70 Ga0070672_100370103 3300005543 Bacteria 1224
71 Ga0070695_100108421 3300005545 Bacteria 1880
72 Ga0070695_100365439 3300005545 Bacteria 1085
73 Ga0070696_100026598 3300005546 Bacteria 3936
74 Ga0070693_100044015 3300005547 Bacteria 2524
75 Ga0070665_100199019 3300005548 Bacteria 2004
76 Ga0070665_100255072 3300005548 Bacteria 1755
77 Ga0070665_100377865 3300005548 Bacteria 1424
78 Ga0070665_100665699 3300005548 Bacteria 1054
79 Ga0070704_100062386 3300005549 Bacteria 2672
80 Ga0068855_100002547 3300005563 Bacteria 22453
81 Ga0068855_100013995 3300005563 Bacteria 9671
82 Ga0068855_100035122 3300005563 Bacteria 5972
83 Ga0068855_100207358 3300005563 Bacteria 2204
84 Ga0068855_100384471 3300005563 Bacteria 1540
85 Ga0068855_100925087 3300005563 Bacteria 920
86 Ga0070664_100049845 3300005564 Bacteria 3542
87 Ga0070664_100272196 3300005564 Bacteria 1526
88 Ga0068857_100000274 3300005577 Bacteria 35189
89 Ga0068857_100010760 3300005577 Bacteria 7963
90 Ga0068857_100061686 3300005577 Bacteria 3331
91 Ga0068854_100076162 3300005578 Bacteria 2465
92 Ga0068854_100192225 3300005578 Bacteria 1600
93 Ga0068856_100001029 3300005614 Bacteria 29689
94 Ga0068856_100005385 3300005614 Bacteria 12615
95 Ga0068856_100006645 3300005614 Bacteria 11333
96 Ga0068856_100007725 3300005614 Bacteria 10498
97 Ga0068856_100055288 3300005614 Bacteria 3917
98 Ga0068856_100055770 3300005614 Bacteria 3899
99 Ga0068856_100119247 3300005614 Bacteria 2639
100 Ga0068856_100203127 3300005614 Bacteria 1996
101 Ga0068856_100414777 3300005614 Bacteria 1367
102 Ga0068856_100537594 3300005614 Bacteria 1190
103 Ga0068852_100079228 3300005616 Bacteria 2909
104 Ga0068852_100139122 3300005616 Bacteria 2245
105 Ga0068859_100181758 3300005617 Bacteria 2186
106 Ga0068859_100755761 3300005617 Bacteria 1061
107 Ga0068859_101109938 3300005617 Bacteria 870
108 Ga0068864_100300803 3300005618 Bacteria 1502
109 Ga0068864_100343937 3300005618 Bacteria 1406
110 Ga0068864_100436419 3300005618 Bacteria 1250
111 Ga0068864_100775071 3300005618 Bacteria 941
112 Ga0068863_100076921 3300005841 Bacteria 3157
113 Ga0068863_100095139 3300005841 Viruses 2827
114 Ga0068863_100153789 3300005841 Bacteria 2202
115 Ga0068863_100332696 3300005841 Bacteria 1477
116 Ga0068863_100697527 3300005841 Bacteria 1009
117 Ga0068858_100003823 3300005842 Bacteria 14888
118 Ga0068858_100004214 3300005842 Bacteria 14160
119 Ga0068860_100024890 3300005843 Bacteria 5779
120 Ga0068860_100051322 3300005843 Bacteria 3925
121 Ga0068860_100560497 3300005843 Bacteria 1145
122 Ga0070717_10087646 3300006028 Bacteria 2622
123 Ga0070715_10212752 3300006163 Bacteria 989
124 Ga0097621_100016902 3300006237 Bacteria 5530
125 Ga0097621_100026490 3300006237 Bacteria 4548
126 Ga0097621_100033905 3300006237 Bacteria 4070
127 Ga0097621_100071032 3300006237 Bacteria 2876
128 Ga0097621_100085924 3300006237 Bacteria 2624
129 Ga0097621_100125810 3300006237 Bacteria 2177
130 Ga0097621_100162069 3300006237 Unclassified 1923
131 Ga0097621_100300133 3300006237 Bacteria 1418
132 Ga0068871_100023917 3300006358 Bacteria 4733
133 Ga0068871_100125078 3300006358 Bacteria 2176
134 Ga0068871_100130000 3300006358 Bacteria 2134
135 Ga0068871_100132171 3300006358 Unclassified 2117
136 Ga0068871_100165902 3300006358 Bacteria 1891
137 Ga0068871_100204328 3300006358 Bacteria 1707
138 Ga0068871_100214934 3300006358 Bacteria 1664
139 Ga0068871_100414764 3300006358 Bacteria 1201
140 Ga0075428_100103404 3300006844 Bacteria 3106
141 Ga0075434_100018068 3300006871 Bacteria 6804
142 Ga0068865_100152903 3300006881 Bacteria 1752
143 Ga0075436_100002682 3300006914 Bacteria 12246
144 Ga0097620_100181754 3300006931 Bacteria 2186
145 Ga0097620_100755712 3300006931 Bacteria 1061
146 Ga0097620_101109833 3300006931 Bacteria 870
147 Ga0105240_10000394 3300009093 Bacteria 81599
148 Ga0105240_10001614 3300009093 Bacteria 38227
149 Ga0105240_10019119 3300009093 Bacteria 9160
150 Ga0105240_10027748 3300009093 Bacteria 7410
151 Ga0105240_10088461 3300009093 Bacteria 3790
152 Ga0105240_10102507 3300009093 Bacteria 3478
153 Ga0105240_10190763 3300009093 Bacteria 2410
154 Ga0105240_10398640 3300009093 Bacteria 1550
155 Ga0105240_10594598 3300009093 Bacteria 1219
156 Ga0105240_10736416 3300009093 Bacteria 1073
157 Ga0105245_10000273 3300009098 Bacteria 49064
158 Ga0105245_10034206 3300009098 Bacteria 4506
159 Ga0105245_10048308 3300009098 Bacteria 3806
160 Ga0105245_10111940 3300009098 Bacteria 2539
161 Ga0105245_10233909 3300009098 Bacteria 1778
162 Ga0105245_10311079 3300009098 Bacteria 1549
163 Ga0105245_10416229 3300009098 Bacteria 1346
164 Ga0105247_10025736 3300009101 Bacteria 3551
165 Ga0105243_10180855 3300009148 Bacteria 1833
166 Ga0105243_10181240 3300009148 Bacteria 1832
167 Ga0105241_10018338 3300009174 Bacteria 5149
168 Ga0105241_10034600 3300009174 Bacteria 3796
169 Ga0105241_10058918 3300009174 Bacteria 2950
170 Ga0105241_10211466 3300009174 Bacteria 1625
171 Ga0105241_10214824 3300009174 Bacteria 1613
172 Ga0105241_10322382 3300009174 Bacteria 1333
173 Ga0105241_10385254 3300009174 Bacteria 1226
174 Ga0105242_10016742 3300009176 Bacteria 5704
175 Ga0105242_10041981 3300009176 Bacteria 3691
176 Ga0105242_10113751 3300009176 Bacteria 2311
177 Ga0105242_10144753 3300009176 Bacteria 2066
178 Ga0105242_10165089 3300009176 Bacteria 1942
179 Ga0105242_10452020 3300009176 Bacteria 1211
180 Ga0105242_10598137 3300009176 Bacteria 1065
181 Ga0105248_10013805 3300009177 Bacteria 8887
182 Ga0105248_10053500 3300009177 Bacteria 4530
183 Ga0105248_10194983 3300009177 Bacteria 2282
184 Ga0105248_10209690 3300009177 Bacteria 2195
185 Ga0105248_10260917 3300009177 Bacteria 1950
186 Ga0105248_10380655 3300009177 Bacteria 1589
187 Ga0105248_10389827 3300009177 Bacteria 1568
188 Ga0105248_10598171 3300009177 Bacteria 1244
189 Ga0105237_10004471 3300009545 Bacteria 16165
190 Ga0105237_10007781 3300009545 Bacteria 11686
191 Ga0105237_10040832 3300009545 Bacteria 4679
192 Ga0105237_10052164 3300009545 Bacteria 4106
193 Ga0105237_10312496 3300009545 Bacteria 1575
194 Ga0105238_10016542 3300009551 Bacteria 7466
195 Ga0105238_10016754 3300009551 Bacteria 7428
196 Ga0105238_10025696 3300009551 Bacteria 6004
197 Ga0105238_10059182 3300009551 Bacteria 3839
198 Ga0105238_10095629 3300009551 Bacteria 2957
199 Ga0105238_10105581 3300009551 Bacteria 2798
200 Ga0105238_10131763 3300009551 Bacteria 2478
201 Ga0105238_10308274 3300009551 Unclassified 1568
202 Ga0105238_10463168 3300009551 Bacteria 1266
203 Ga0105238_10505892 3300009551 Bacteria 1209
204 Ga0105249_10129097 3300009553 Bacteria 2411
205 Ga0105239_10019527 3300010375 Bacteria 7480
206 Ga0105239_10029619 3300010375 Bacteria 6018
207 Ga0105239_10039355 3300010375 Bacteria 5181
208 Ga0105239_10057353 3300010375 Bacteria 4271
209 Ga0105239_10087084 3300010375 Bacteria 3443
210 Ga0105239_10232365 3300010375 Bacteria 2069
211 Ga0105239_10444567 3300010375 Bacteria 1470
212 Ga0105239_10632016 3300010375 Bacteria 1222
213 Ga0105239_10743790 3300010375 Bacteria 1122
214 Ga0105246_10038295 3300011119 Bacteria 3223
215 Ga0157373_10059785 3300013100 Bacteria 2701
216 Ga0157370_10001200 3300013104 Bacteria 32372
217 Ga0157370_10176756 3300013104 Bacteria 1984
218 Ga0157369_10000903 3300013105 Bacteria 37889
219 Ga0157369_10003873 3300013105 Bacteria 17770
220 Ga0157369_10017504 3300013105 Bacteria 8054
221 Ga0157369_10070391 3300013105 Bacteria 3758
222 Ga0157369_10071019 3300013105 Bacteria 3739
223 Ga0157369_10160690 3300013105 Bacteria 2371
224 Ga0157369_10197309 3300013105 Bacteria 2113
225 Ga0157369_10377791 3300013105 Bacteria 1471
226 Ga0157374_10003874 3300013296 Bacteria 12561
227 Ga0157374_10006595 3300013296 Bacteria 9858
228 Ga0157374_10472318 3300013296 Unclassified 1257
229 Ga0157374_10494078 3300013296 Bacteria 1228
230 Ga0157374_10707316 3300013296 Unclassified 1021
231 Ga0157378_10005501 3300013297 Bacteria 11104
232 Ga0157378_10137768 3300013297 Bacteria 2264
233 Ga0157378_11002039 3300013297 Bacteria 870
234 Ga0163162_10072187 3300013306 Bacteria 3506
235 Ga0163162_10226834 3300013306 Bacteria 1998
236 Ga0163162_10269135 3300013306 Bacteria 1835
237 Ga0163162_10465996 3300013306 Bacteria 1395
238 Ga0157372_10018775 3300013307 Bacteria 7438
239 Ga0157372_10021237 3300013307 Bacteria 7013
240 Ga0157372_10043114 3300013307 Bacteria 4994
241 Ga0157372_10123118 3300013307 Bacteria 2981
242 Ga0157372_10194997 3300013307 Bacteria 2346
243 Ga0157372_10312539 3300013307 Bacteria 1829
244 Ga0157372_10698725 3300013307 Bacteria 1180
245 Ga0157375_10059925 3300013308 Bacteria 3773
246 Ga0157375_10084368 3300013308 Bacteria 3225
247 Ga0157375_10198059 3300013308 Bacteria 2164
248 Ga0157375_10264876 3300013308 Bacteria 1880
249 Ga0157375_10706199 3300013308 Bacteria 1162
250 Ga0163163_10011324 3300014325 Bacteria 8085
251 Ga0163163_10028970 3300014325 Bacteria 5323
252 Ga0163163_10076535 3300014325 Bacteria 3341
253 Ga0163163_10227789 3300014325 Bacteria 1913
254 Ga0163163_10851936 3300014325 Bacteria 975
255 Ga0157379_10050856 3300014968 Bacteria 3700
256 Ga0157376_10011010 3300014969 Bacteria 6646
257 Ga0157376_10026644 3300014969 Bacteria 4571
258 Ga0157376_10094064 3300014969 Bacteria 2603
259 Ga0157376_10404851 3300014969 Bacteria 1320
260 Ga0157376_10809180 3300014969 Bacteria 950
261 Ga0163161_10217236 3300017792 Bacteria 1479
262 Ga0213876_10017245 3300021384 Bacteria 3812
263 Ga0213875_10034507 3300021388 Bacteria 2389
264 Ga0213875_10127345 3300021388 Bacteria 1190
265 Ga0207680_10020410 3300025903 Bacteria 3565
266 Ga0207680_10255221 3300025903 Bacteria 1212
267 Ga0207699_10387544 3300025906 Bacteria 993
268 Ga0207705_10017258 3300025909 Bacteria 5168
269 Ga0207705_10231362 3300025909 Bacteria 1406
270 Ga0207705_10447718 3300025909 Bacteria 1001
271 Ga0207705_10508203 3300025909 Bacteria 936
272 Ga0207684_10007067 3300025910 Bacteria 10146
273 Ga0207684_10174259 3300025910 Bacteria 1854
274 Ga0207654_10020123 3300025911 Bacteria 3533
275 Ga0207654_10023317 3300025911 Bacteria 3314
276 Ga0207654_10058776 3300025911 Bacteria 2240
277 Ga0207654_10214931 3300025911 Bacteria 1272
278 Ga0207654_10469186 3300025911 Bacteria 885
279 Ga0207707_10000705 3300025912 Bacteria 33231
280 Ga0207707_10056059 3300025912 Bacteria 3428
281 Ga0207707_10168204 3300025912 Bacteria 1915
282 Ga0207707_10242215 3300025912 Bacteria 1568
283 Ga0207707_10635578 3300025912 Bacteria 901
284 Ga0207695_10000843 3300025913 Bacteria 56294
285 Ga0207695_10002906 3300025913 Bacteria 24790
286 Ga0207695_10003294 3300025913 Bacteria 22929
287 Ga0207695_10003468 3300025913 Bacteria 22191
288 Ga0207695_10011757 3300025913 Bacteria 10574
289 Ga0207695_10109550 3300025913 Bacteria 2743
290 Ga0207695_10240188 3300025913 Bacteria 1713
291 Ga0207695_10535059 3300025913 Bacteria 1053
292 Ga0207695_10562689 3300025913 Bacteria 1021
293 Ga0207695_10668738 3300025913 Bacteria 919
294 Ga0207671_10007144 3300025914 Bacteria 9743
295 Ga0207671_10007259 3300025914 Bacteria 9648
296 Ga0207671_10042184 3300025914 Bacteria 3377
297 Ga0207671_10080472 3300025914 Bacteria 2442
298 Ga0207663_10042273 3300025916 Bacteria 2784
299 Ga0207660_10049110 3300025917 Bacteria 2989
300 Ga0207660_10057622 3300025917 Bacteria 2783
301 Ga0207657_10004383 3300025919 Bacteria 14939
302 Ga0207657_10186793 3300025919 Bacteria 1673
303 Ga0207649_10041024 3300025920 Bacteria 2816
304 Ga0207652_10002444 3300025921 Bacteria 15685
305 Ga0207652_10056436 3300025921 Bacteria 3380
306 Ga0207652_10274441 3300025921 Bacteria 1521
307 Ga0207652_10425820 3300025921 Bacteria 1197
308 Ga0207646_10000042 3300025922 Bacteria 186121
309 Ga0207694_10005736 3300025924 Bacteria 9510
310 Ga0207694_10060172 3300025924 Bacteria 2956
311 Ga0207694_10067229 3300025924 Bacteria 2797
312 Ga0207694_10119432 3300025924 Bacteria 2104
313 Ga0207694_10193556 3300025924 Unclassified 1653
314 Ga0207694_10274669 3300025924 Bacteria 1383
315 Ga0207694_10351556 3300025924 Bacteria 1220
316 Ga0207694_10359930 3300025924 Bacteria 1205
317 Ga0207694_10418313 3300025924 Bacteria 1116
318 Ga0207650_10585654 3300025925 Bacteria 937
319 Ga0207659_10224261 3300025926 Bacteria 1513
320 Ga0207659_10567451 3300025926 Bacteria 966
321 Ga0207687_10001887 3300025927 Bacteria 14437
322 Ga0207687_10003676 3300025927 Bacteria 10328
323 Ga0207687_10085735 3300025927 Bacteria 2285
324 Ga0207687_10091738 3300025927 Bacteria 2216
325 Ga0207687_10179504 3300025927 Bacteria 1639
326 Ga0207687_10495168 3300025927 Bacteria 1019
327 Ga0207687_10593813 3300025927 Bacteria 933
328 Ga0207700_10113130 3300025928 Bacteria 2188
329 Ga0207700_10323268 3300025928 Bacteria 1337
330 Ga0207700_10348093 3300025928 Bacteria 1290
331 Ga0207690_10087899 3300025932 Bacteria 2188
332 Ga0207706_10419602 3300025933 Bacteria 1159
333 Ga0207686_10005996 3300025934 Bacteria 6523
334 Ga0207686_10008484 3300025934 Bacteria 5550
335 Ga0207686_10028060 3300025934 Bacteria 3304
336 Ga0207686_10028713 3300025934 Bacteria 3274
337 Ga0207686_10046518 3300025934 Bacteria 2677
338 Ga0207686_10124016 3300025934 Bacteria 1763
339 Ga0207709_10106610 3300025935 Bacteria 1864
340 Ga0207670_10324178 3300025936 Bacteria 1213
341 Ga0207704_10099096 3300025938 Bacteria 1938
342 Ga0207704_10151656 3300025938 Bacteria 1636
343 Ga0207665_10075595 3300025939 Bacteria 2308
344 Ga0207711_10001792 3300025941 Bacteria 19659
345 Ga0207711_10101547 3300025941 Bacteria 2545
346 Ga0207711_10266019 3300025941 Bacteria 1577
347 Ga0207711_10693014 3300025941 Bacteria 950
348 Ga0207711_10717411 3300025941 Bacteria 932
349 Ga0207689_10031789 3300025942 Bacteria 4390
350 Ga0207689_10042228 3300025942 Bacteria 3773
351 Ga0207689_10717352 3300025942 Bacteria 843
352 Ga0207661_10003395 3300025944 Bacteria 11052
353 Ga0207661_10018561 3300025944 Bacteria 5169
354 Ga0207661_10034326 3300025944 Bacteria 3944
355 Ga0207661_10072842 3300025944 Bacteria 2812
356 Ga0207679_10258258 3300025945 Bacteria 1485
357 Ga0207679_10265849 3300025945 Bacteria 1465
358 Ga0207667_10001948 3300025949 Bacteria 25866
359 Ga0207667_10002003 3300025949 Bacteria 25560
360 Ga0207667_10013270 3300025949 Bacteria 9440
361 Ga0207667_10018141 3300025949 Bacteria 7900
362 Ga0207667_10027507 3300025949 Bacteria 6188
363 Ga0207667_10066800 3300025949 Bacteria 3748
364 Ga0207667_10378020 3300025949 Bacteria 1443
365 Ga0207667_10384749 3300025949 Bacteria 1429
366 Ga0207667_10506348 3300025949 Bacteria 1224
367 Ga0207667_10621815 3300025949 Bacteria 1088
368 Ga0207667_10681626 3300025949 Bacteria 1031
369 Ga0207667_10803989 3300025949 Bacteria 937
370 Ga0207651_10575245 3300025960 Bacteria 982
371 Ga0207651_10855397 3300025960 Bacteria 808
372 Ga0207712_10521791 3300025961 Bacteria 1018
373 Ga0207640_10008984 3300025981 Bacteria 5570
374 Ga0207640_10082469 3300025981 Bacteria 2202
375 Ga0207658_10151531 3300025986 Bacteria 1890
376 Ga0207658_10765131 3300025986 Bacteria 875
377 Ga0207677_10273200 3300026023 Unclassified 1384
378 Ga0207677_10276483 3300026023 Bacteria 1376
379 Ga0207677_10571723 3300026023 Bacteria 988
380 Ga0207703_10003957 3300026035 Bacteria 12279
381 Ga0207703_10018953 3300026035 Bacteria 5375
382 Ga0207703_10117356 3300026035 Bacteria 2280
383 Ga0207639_10025331 3300026041 Bacteria 4301
384 Ga0207639_10033761 3300026041 Bacteria 3777
385 Ga0207639_10057417 3300026041 Bacteria 2988
386 Ga0207639_10241583 3300026041 Bacteria 1570
387 Ga0207639_10338498 3300026041 Bacteria 1341
388 Ga0207639_10368686 3300026041 Bacteria 1287
389 Ga0207639_10447941 3300026041 Bacteria 1171
390 Ga0207702_10006427 3300026078 Bacteria 10140
391 Ga0207702_10006641 3300026078 Bacteria 9950
392 Ga0207702_10009796 3300026078 Bacteria 8037
393 Ga0207702_10024177 3300026078 Bacteria 5040
394 Ga0207702_10046370 3300026078 Bacteria 3659
395 Ga0207702_10095374 3300026078 Bacteria 2614
396 Ga0207702_10107339 3300026078 Bacteria 2476
397 Ga0207702_10227288 3300026078 Bacteria 1742
398 Ga0207641_10056166 3300026088 Bacteria 3345
399 Ga0207641_10237203 3300026088 Unclassified 1698
400 Ga0207641_10246061 3300026088 Bacteria 1668
401 Ga0207641_10603956 3300026088 Bacteria 1074
402 Ga0207641_10875449 3300026088 Bacteria 891
403 Ga0207648_10092437 3300026089 Bacteria 2645
404 Ga0207648_10378183 3300026089 Bacteria 1280
405 Ga0207648_10459429 3300026089 Bacteria 1160
406 Ga0207676_10047153 3300026095 Bacteria 3338
407 Ga0207676_10232071 3300026095 Bacteria 1650
408 Ga0207676_10387242 3300026095 Bacteria 1303
409 Ga0207674_10000110 3300026116 Bacteria 94822
410 Ga0207674_10002493 3300026116 Bacteria 23214
411 Ga0207674_10003224 3300026116 Bacteria 20087
412 Ga0207674_10394610 3300026116 Bacteria 1337
413 Ga0207674_10428070 3300026116 Bacteria 1279
414 Ga0207674_10452557 3300026116 Bacteria 1241
415 Ga0207683_10249471 3300026121 Bacteria 1620
416 Ga0207698_10093038 3300026142 Bacteria 2474
417 Ga0207698_10455030 3300026142 Bacteria 1236
418 Ga0207698_11064880 3300026142 Bacteria 821
419 Ga0207428_10127811 3300027907 Bacteria 1946
420 Ga0268266_10181079 3300028379 Bacteria 1919
421 Ga0268266_10248373 3300028379 Bacteria 1645
422 Ga0268265_10613956 3300028380 Bacteria 1041
423 Ga0268264_10004329 3300028381 Bacteria 12119
424 Ga0268264_10079133 3300028381 Bacteria 2804
425 Ga0265338_10005795 3300028800 Bacteria 15955
426 Ga0265338_10228526 3300028800 Bacteria 1385
427 Ga0265324_10016056 3300029957 Bacteria 2743
428 Ga0265332_10128661 3300031238 Bacteria 1063
429 Ga0265325_10003158 3300031241 Bacteria 10833
430 Ga0265316_10013226 3300031344 Bacteria 7347
431 Ga0265316_10014815 3300031344 Bacteria 6842
432 Ga0265316_10088507 3300031344 Bacteria 2364
433 Ga0265316_10088790 3300031344 Bacteria 2360
434 Ga0265316_10228189 3300031344 Bacteria 1372
435 Ga0265316_10455839 3300031344 Bacteria 917
436 Ga0265313_10010108 3300031595 Bacteria 6035
437 Ga0265314_10001085 3300031711 Bacteria 31464
438 Ga0265314_10010255 3300031711 Bacteria 7836
439 Ga0265342_10048903 3300031712 Bacteria 2533
440 Ga0373926_0076246 3300035083 Bacteria 1236
441 Ga0373934_0007885 3300035086 Bacteria 3961
442 Ga0373953_0107948 3300035117 Bacteria 1175
443 Ga0373954_0019558 3300035118 Bacteria 3055
444 Ga0373954_0068503 3300035118 Bacteria 1683
445 Ga0373954_0149569 3300035118 Bacteria 1140
446 Ga0373957_0024449 3300035120 Bacteria 2170
447 Ga0373943_0022587 3300035170 Bacteria 2917
448 Ga0373935_0010626 3300035692 Bacteria 5526
449 Ga0373935_0188193 3300035692 Bacteria 1421
450 Ga0373927_0001164 3300035695 Bacteria 19889
451 Ga0373927_0002121 3300035695 Bacteria 14614
452 Ga0373927_0008114 3300035695 Bacteria 7084
453 Ga0373927_0143063 3300035695 Bacteria 1565
454 Ga0373927_0158493 3300035695 Bacteria 1483
455 Ga0373927_0322572 3300035695 Bacteria 1017
456 Ga0373933_0005940 3300035724 Bacteria 6643
457 Ga0373933_0044576 3300035724 Bacteria 2628
458 Ga0373947_0000671 3300035725 Bacteria 20338
459 Ga0373947_0014867 3300035725 Bacteria 4467
460 Ga0373947_0099547 3300035725 Bacteria 1825
461 Ga0373937_0025084 3300036401 Bacteria 5382
462 Ga0373937_0233279 3300036401 Bacteria 1733
463 Ga0373937_0256561 3300036401 Bacteria 1648
464 Ga0373937_0753975 3300036401 Bacteria 921
465 Ga0316584_0008299 3300036712 Bacteria 7155
466 Ga0373925_0000163 3300037068 Bacteria 71614
467 Ga0373925_0014261 3300037068 Bacteria 5749
468 Ga0373925_0130800 3300037068 Bacteria 1957
469 Ga0373925_0520860 3300037068 Bacteria 977
470 Ga0316581_0010471 3300037588 Bacteria 2572
471 Ga0436364_0420833 3300037853 Bacteria 7134
472 Ga0436364_0579258 3300037853 Bacteria 1520
473 Ga0436364_0587740 3300037853 Bacteria 3623
474 Ga0436364_0829415 3300037853 Bacteria 1052
475 Ga0436364_1209217 3300037853 Bacteria 2234
476 Ga0436364_1477067 3300037853 Bacteria 1951
477 Ga0436365_0039697 3300039437 Bacteria 2520
478 Ga0436365_0134859 3300039437 Bacteria 12602
479 Ga0451577_0448752 3300042876 Bacteria 1171
480 Ga0451577_0518903 3300042876 Bacteria 1082
481 Ga0451576_0053190 3300045051 Bacteria 4242
482 Ga0451576_0264179 3300045051 Bacteria 1799
483 Ga0451576_0562480 3300045051 Bacteria 1198
484 Ga0451576_1319398 3300045051 Bacteria 752
485 Ga0466958_0170180 3300045836 Bacteria 1379
486 Ga0495592_0047868 3300046454 Bacteria 3183
487 Ga0495603_0161816 3300046455 Bacteria 1298
488 Ga0495629_0106413 3300046459 Bacteria 1957
489 Ga0495653_0177946 3300046463 Bacteria 1462
490 Ga0495580_0015334 3300046472 Bacteria 5782
491 Ga0495580_0057940 3300046472 Bacteria 2726
492 Ga0495580_0081724 3300046472 Bacteria 2252
493 Ga0495580_0246736 3300046472 Bacteria 1223
494 Ga0495582_0058618 3300046473 Bacteria 2123
495 Ga0495639_0046922 3300046475 Bacteria 1956
496 Ga0495662_0011178 3300046476 Bacteria 4386
497 Ga0495664_0233978 3300046477 Bacteria 1111
498 Ga0495594_0075977 3300046499 Bacteria 1873
499 Ga0495628_0097863 3300046516 Bacteria 2266
500 Ga0495628_0411302 3300046516 Bacteria 987
501 Ga0495630_0057686 3300046517 Bacteria 2910
502 Ga0495666_0202639 3300046526 Bacteria 912
503 Ga0495652_0010010 3300046529 Bacteria 8594
504 Ga0495652_0095452 3300046529 Bacteria 2423
505 Ga0495652_0569047 3300046529 Bacteria 777
506 Ga0495665_0014251 3300046531 Bacteria 4289
507 Ga0495640_0035498 3300046533 Bacteria 3529
508 Ga0495640_0199962 3300046533 Bacteria 1267
509 Ga0495586_0056703 3300046535 Bacteria 2125
510 Ga0495586_0236659 3300046535 Bacteria 1040
511 Ga0495587_0001333 3300046536 Bacteria 16400
512 Ga0495587_0095545 3300046536 Bacteria 1715
513 Ga0495645_0007046 3300046543 Bacteria 7822
514 Ga0495645_0078135 3300046543 Bacteria 2379
515 Ga0495645_0112188 3300046543 Bacteria 1928
516 Ga0495645_0145375 3300046543 Bacteria 1652
517 Ga0495645_0168854 3300046543 Bacteria 1507
518 Ga0495667_0155883 3300046559 Bacteria 1470
519 Ga0495667_0184637 3300046559 Bacteria 1337
520 Ga0495657_0097805 3300046675 Bacteria 1874
521 Ga0495657_0280326 3300046675 Bacteria 997
522 Ga0495599_0109305 3300046678 Bacteria 1722
523 Ga0495599_0110110 3300046678 Bacteria 1716
524 Ga0495599_0236118 3300046678 Bacteria 1116
525 Ga0495623_0059026 3300046679 Bacteria 2411
526 Ga0495623_0089231 3300046679 Bacteria 1895
527 Ga0495600_0035034 3300046809 Bacteria 3260
528 Ga0495604_0101745 3300047317 Bacteria 2110
529 Ga0495604_0269788 3300047317 Bacteria 1153
530 Ga0495604_0513562 3300047317 Bacteria 776
531 Ga0495674_0035471 3300047319 Bacteria 4500
532 Ga0495674_0078590 3300047319 Bacteria 2834
533 Ga0495674_0125430 3300047319 Bacteria 2167
534 Ga0495674_0401807 3300047319 Bacteria 1106
535 Ga0495680_0186184 3300047322 Bacteria 1496
536 Ga0495680_0418187 3300047322 Bacteria 923
537 Ga0495675_0205030 3300047444 Bacteria 1199
538 Ga0495684_0009642 3300047471 Bacteria 7447
539 Ga0495684_0018454 3300047471 Bacteria 5375
540 Ga0495684_0039634 3300047471 Bacteria 3611
541 Ga0495684_0163570 3300047471 Bacteria 1659
542 Ga0495684_0185018 3300047471 Bacteria 1543
543 Ga0495602_0002734 3300048088 Bacteria 18021
544 Ga0495602_0045067 3300048088 Bacteria 3994
545 Ga0495602_0127795 3300048088 Bacteria 2033
546 Ga0495602_0283312 3300048088 Bacteria 1220
547 Ga0496104_0252066 3300048907 Bacteria 1678
548 Ga0496112_0006624 3300048915 Bacteria 10198
549 Ga0496113_0080786 3300048916 Bacteria 2491
550 Ga0496114_0451908 3300048917 Bacteria 1138
551 Ga0496115_0006544 3300048918 Bacteria 8541
552 Ga0496115_0312432 3300048918 Bacteria 1287
553 Ga0501032_0014722 3300049569 Bacteria 5535
554 Ga0501038_0004170 3300049574 Bacteria 13442
555 Ga0501039_0003394 3300049575 Bacteria 11907
556 Ga0501042_0005007 3300049578 Bacteria 8486
557 Ga0501043_0138128 3300049579 Bacteria 1909
558 Ga0501046_0000857 3300049580 Bacteria 29579
559 Ga0501048_0006194 3300049582 Bacteria 9103
560 Ga0501035_0004990 3300049822 Bacteria 12571
561 nmdc:mga0n895_5862_c1 3300050512 Bacteria 10325
562 nmdc:mga0rr50_303743_c1 3300050513 Bacteria 1335
563 nmdc:mga08x19_7164_c1 3300050514 Bacteria 6625
564 Ga0495612_0025313 3300053078 Bacteria 2383
565 Ga0501082_0001662 3300060353 Bacteria 19587
566 Ga0207703_10105760
567 Ga0070658_10057173
568 Ga0070658_10113859
569 Ga0070683_100000018
570 Ga0070683_100000124
571 Ga0070683_100042296
572 Ga0070683_100044776
573 Ga0070683_100444366
574 Ga0068869_100043819
575 Ga0068869_100052134
576 Ga0068869_100513657
577 Ga0068869_100547867
578 Ga0070666_10025278
579 Ga0070680_100075946
580 Ga0070680_100320268
581 Ga0070680_100456101
582 Ga0070682_100226055
583 Ga0068868_100303395
584 Ga0068868_100629819
585 Ga0070689_100170761
586 Ga0070689_100329263
587 Ga0070691_10002532
588 Ga0070661_100373356
589 Ga0070675_100106933
590 Ga0070675_100229749
591 Ga0070671_100167032
592 Ga0070688_100077827
593 Ga0070659_100103653
594 Ga0070659_100142593
595 Ga0070667_100177652
596 Ga0070667_100262804
597 Ga0070709_10179961
598 Ga0070709_10598717
599 Ga0070714_100834655
600 Ga0070701_10180926
601 Ga0070711_100042413
602 Ga0070711_100086692
603 Ga0070711_100154811
604 Ga0070711_100255411
605 Ga0070694_100239928
606 Ga0070694_100335102
607 Ga0070708_100055414
608 Ga0070678_100401173
609 Ga0070662_100135497
610 Ga0070681_10001551
611 Ga0070681_10162924
612 Ga0070681_10192016
613 Ga0070681_10283753
614 Ga0070681_10389243
615 Ga0068867_100052865
616 Ga0068867_100159950
617 Ga0068867_100362155
618 Ga0070706_100015943
619 Ga0070706_100064804
620 Ga0070679_100001406
621 Ga0070679_100053121
622 Ga0070679_100143309
623 Ga0070679_100390816
624 Ga0070684_100000011
625 Ga0070684_100000231
626 Ga0070684_100024329
627 Ga0070684_100364670
628 Ga0070697_100097155
629 Ga0068853_100041797
630 Ga0068853_100085968
631 Ga0068853_100127504
632 Ga0068853_100238449
633 Ga0068853_100328010
634 Ga0068853_100392296
635 Ga0070672_100370103
636 Ga0070695_100108421
637 Ga0070695_100365439
638 Ga0070696_100026598
639 Ga0070693_100044015
640 Ga0070665_100199019
641 Ga0070665_100255072
642 Ga0070665_100377865
643 Ga0070665_100665699
644 Ga0070704_100062386
645 Ga0068855_100002547
646 Ga0068855_100013995
647 Ga0068855_100035122
648 Ga0068855_100207358
649 Ga0068855_100384471
650 Ga0068855_100925087
651 Ga0070664_100049845
652 Ga0070664_100272196
653 Ga0068857_100000274
654 Ga0068857_100010760
655 Ga0068857_100061686
656 Ga0068854_100076162
657 Ga0068854_100192225
658 Ga0068856_100001029
659 Ga0068856_100005385
660 Ga0068856_100006645
661 Ga0068856_100007725
662 Ga0068856_100055288
663 Ga0068856_100055770
664 Ga0068856_100119247
665 Ga0068856_100203127
666 Ga0068856_100414777
667 Ga0068856_100537594
668 Ga0068852_100079228
669 Ga0068852_100139122
670 Ga0068859_100181758
671 Ga0068859_100755761
672 Ga0068859_101109938
673 Ga0068864_100300803
674 Ga0068864_100343937
675 Ga0068864_100436419
676 Ga0068864_100775071
677 Ga0068863_100076921
678 Ga0068863_100095139
679 Ga0068863_100153789
680 Ga0068863_100332696
681 Ga0068863_100697527
682 Ga0068858_100003823
683 Ga0068858_100004214
684 Ga0068860_100024890
685 Ga0068860_100051322
686 Ga0068860_100560497
687 Ga0070717_10087646
688 Ga0070715_10212752
689 Ga0097621_100016902
690 Ga0097621_100026490
691 Ga0097621_100033905
692 Ga0097621_100071032
693 Ga0097621_100085924
694 Ga0097621_100125810
695 Ga0097621_100162069
696 Ga0097621_100300133
697 Ga0068871_100023917
698 Ga0068871_100125078
699 Ga0068871_100130000
700 Ga0068871_100132171
701 Ga0068871_100165902
702 Ga0068871_100204328
703 Ga0068871_100214934
704 Ga0068871_100414764
705 Ga0075428_100103404
706 Ga0075434_100018068
707 Ga0068865_100152903
708 Ga0075436_100002682
709 Ga0097620_100181754
710 Ga0097620_100755712
711 Ga0097620_101109833
712 Ga0105240_10000394
713 Ga0105240_10001614
714 Ga0105240_10019119
715 Ga0105240_10027748
716 Ga0105240_10088461
717 Ga0105240_10102507
718 Ga0105240_10190763
719 Ga0105240_10398640
720 Ga0105240_10594598
721 Ga0105240_10736416
722 Ga0105245_10000273
723 Ga0105245_10034206
724 Ga0105245_10048308
725 Ga0105245_10111940
726 Ga0105245_10233909
727 Ga0105245_10311079
728 Ga0105245_10416229
729 Ga0105247_10025736
730 Ga0105243_10180855
731 Ga0105243_10181240
732 Ga0105241_10018338
733 Ga0105241_10034600
734 Ga0105241_10058918
735 Ga0105241_10211466
736 Ga0105241_10214824
737 Ga0105241_10322382
738 Ga0105241_10385254
739 Ga0105242_10016742
740 Ga0105242_10041981
741 Ga0105242_10113751
742 Ga0105242_10144753
743 Ga0105242_10165089
744 Ga0105242_10452020
745 Ga0105242_10598137
746 Ga0105248_10013805
747 Ga0105248_10053500
748 Ga0105248_10194983
749 Ga0105248_10209690
750 Ga0105248_10260917
751 Ga0105248_10380655
752 Ga0105248_10389827
753 Ga0105248_10598171
754 Ga0105237_10004471
755 Ga0105237_10007781
756 Ga0105237_10040832
757 Ga0105237_10052164
758 Ga0105237_10312496
759 Ga0105238_10016542
760 Ga0105238_10016754
761 Ga0105238_10025696
762 Ga0105238_10059182
763 Ga0105238_10095629
764 Ga0105238_10105581
765 Ga0105238_10131763
766 Ga0105238_10308274
767 Ga0105238_10463168
768 Ga0105238_10505892
769 Ga0105249_10129097
770 Ga0105239_10019527
771 Ga0105239_10029619
772 Ga0105239_10039355
773 Ga0105239_10057353
774 Ga0105239_10087084
775 Ga0105239_10232365
776 Ga0105239_10444567
777 Ga0105239_10632016
778 Ga0105239_10743790
779 Ga0105246_10038295
780 Ga0157373_10059785
781 Ga0157370_10001200
782 Ga0157370_10176756
783 Ga0157369_10000903
784 Ga0157369_10003873
785 Ga0157369_10017504
786 Ga0157369_10070391
787 Ga0157369_10071019
788 Ga0157369_10160690
789 Ga0157369_10197309
790 Ga0157369_10377791
791 Ga0157374_10003874
792 Ga0157374_10006595
793 Ga0157374_10472318
794 Ga0157374_10494078
795 Ga0157374_10707316
796 Ga0157378_10005501
797 Ga0157378_10137768
798 Ga0157378_11002039
799 Ga0163162_10072187
800 Ga0163162_10226834
801 Ga0163162_10269135
802 Ga0163162_10465996
803 Ga0157372_10018775
804 Ga0157372_10021237
805 Ga0157372_10043114
806 Ga0157372_10123118
807 Ga0157372_10194997
808 Ga0157372_10312539
809 Ga0157372_10698725
810 Ga0157375_10059925
811 Ga0157375_10084368
812 Ga0157375_10198059
813 Ga0157375_10264876
814 Ga0157375_10706199
815 Ga0163163_10011324
816 Ga0163163_10028970
817 Ga0163163_10076535
818 Ga0163163_10227789
819 Ga0163163_10851936
820 Ga0157379_10050856
821 Ga0157376_10011010
822 Ga0157376_10026644
823 Ga0157376_10094064
824 Ga0157376_10404851
825 Ga0157376_10809180
826 Ga0163161_10217236
827 Ga0213876_10017245
828 Ga0213875_10034507
829 Ga0213875_10127345
830 Ga0207680_10020410
831 Ga0207680_10255221
832 Ga0207699_10387544
833 Ga0207705_10017258
834 Ga0207705_10231362
835 Ga0207705_10447718
836 Ga0207705_10508203
837 Ga0207684_10007067
838 Ga0207684_10174259
839 Ga0207654_10020123
840 Ga0207654_10023317
841 Ga0207654_10058776
842 Ga0207654_10214931
843 Ga0207654_10469186
844 Ga0207707_10000705
845 Ga0207707_10056059
846 Ga0207707_10168204
847 Ga0207707_10242215
848 Ga0207707_10635578
849 Ga0207695_10000843
850 Ga0207695_10002906
851 Ga0207695_10003294
852 Ga0207695_10003468
853 Ga0207695_10011757
854 Ga0207695_10109550
855 Ga0207695_10240188
856 Ga0207695_10535059
857 Ga0207695_10562689
858 Ga0207695_10668738
859 Ga0207671_10007144
860 Ga0207671_10007259
861 Ga0207671_10042184
862 Ga0207671_10080472
863 Ga0207663_10042273
864 Ga0207660_10049110
865 Ga0207660_10057622
866 Ga0207657_10004383
867 Ga0207657_10186793
868 Ga0207649_10041024
869 Ga0207652_10002444
870 Ga0207652_10056436
871 Ga0207652_10274441
872 Ga0207652_10425820
873 Ga0207646_10000042
874 Ga0207694_10005736
875 Ga0207694_10060172
876 Ga0207694_10067229
877 Ga0207694_10119432
878 Ga0207694_10193556
879 Ga0207694_10274669
880 Ga0207694_10351556
881 Ga0207694_10359930
882 Ga0207694_10418313
883 Ga0207650_10585654
884 Ga0207659_10224261
885 Ga0207659_10567451
886 Ga0207687_10001887
887 Ga0207687_10003676
888 Ga0207687_10085735
889 Ga0207687_10091738
890 Ga0207687_10179504
891 Ga0207687_10495168
892 Ga0207687_10593813
893 Ga0207700_10113130
894 Ga0207700_10323268
895 Ga0207700_10348093
896 Ga0207690_10087899
897 Ga0207706_10419602
898 Ga0207686_10005996
899 Ga0207686_10008484
900 Ga0207686_10028060
901 Ga0207686_10028713
902 Ga0207686_10046518
903 Ga0207686_10124016
904 Ga0207709_10106610
905 Ga0207670_10324178
906 Ga0207704_10099096
907 Ga0207704_10151656
908 Ga0207665_10075595
909 Ga0207711_10001792
910 Ga0207711_10101547
911 Ga0207711_10266019
912 Ga0207711_10693014
913 Ga0207711_10717411
914 Ga0207689_10031789
915 Ga0207689_10042228
916 Ga0207689_10717352
917 Ga0207661_10003395
918 Ga0207661_10018561
919 Ga0207661_10034326
920 Ga0207661_10072842
921 Ga0207679_10258258
922 Ga0207679_10265849
923 Ga0207667_10001948
924 Ga0207667_10002003
925 Ga0207667_10013270
926 Ga0207667_10018141
927 Ga0207667_10027507
928 Ga0207667_10066800
929 Ga0207667_10378020
930 Ga0207667_10384749
931 Ga0207667_10506348
932 Ga0207667_10621815
933 Ga0207667_10681626
934 Ga0207667_10803989
935 Ga0207651_10575245
936 Ga0207651_10855397
937 Ga0207712_10521791
938 Ga0207640_10008984
939 Ga0207640_10082469
940 Ga0207658_10151531
941 Ga0207658_10765131
942 Ga0207677_10273200
943 Ga0207677_10276483
944 Ga0207677_10571723
945 Ga0207703_10003957
946 Ga0207703_10018953
947 Ga0207703_10117356
948 Ga0207639_10025331
949 Ga0207639_10033761
950 Ga0207639_10057417
951 Ga0207639_10241583
952 Ga0207639_10338498
953 Ga0207639_10368686
954 Ga0207639_10447941
955 Ga0207702_10006427
956 Ga0207702_10006641
957 Ga0207702_10009796
958 Ga0207702_10024177
959 Ga0207702_10046370
960 Ga0207702_10095374
961 Ga0207702_10107339
962 Ga0207702_10227288
963 Ga0207641_10056166
964 Ga0207641_10237203
965 Ga0207641_10246061
966 Ga0207641_10603956
967 Ga0207641_10875449
968 Ga0207648_10092437
969 Ga0207648_10378183
970 Ga0207648_10459429
971 Ga0207676_10047153
972 Ga0207676_10232071
973 Ga0207676_10387242
974 Ga0207674_10000110
975 Ga0207674_10002493
976 Ga0207674_10003224
977 Ga0207674_10394610
978 Ga0207674_10428070
979 Ga0207674_10452557
980 Ga0207683_10249471
981 Ga0207698_10093038
982 Ga0207698_10455030
983 Ga0207698_11064880
984 Ga0207428_10127811
985 Ga0268266_10181079
986 Ga0268266_10248373
987 Ga0268265_10613956
988 Ga0268264_10004329
989 Ga0268264_10079133
990 Ga0265338_10005795
991 Ga0265338_10228526
992 Ga0265324_10016056
993 Ga0265332_10128661
994 Ga0265325_10003158
995 Ga0265316_10013226
996 Ga0265316_10014815
997 Ga0265316_10088507
998 Ga0265316_10088790
999 Ga0265316_10228189
1000 Ga0265316_10455839
1001 Ga0265313_10010108
1002 Ga0265314_10001085
1003 Ga0265314_10010255
1004 Ga0265342_10048903
1005 Ga0373926_0076246
1006 Ga0373934_0007885
1007 Ga0373953_0107948
1008 Ga0373954_0019558
1009 Ga0373954_0068503
1010 Ga0373954_0149569
1011 Ga0373957_0024449
1012 Ga0373943_0022587
1013 Ga0373935_0010626
1014 Ga0373935_0188193
1015 Ga0373927_0001164
1016 Ga0373927_0002121
1017 Ga0373927_0008114
1018 Ga0373927_0143063
1019 Ga0373927_0158493
1020 Ga0373927_0322572
1021 Ga0373933_0005940
1022 Ga0373933_0044576
1023 Ga0373947_0000671
1024 Ga0373947_0014867
1025 Ga0373947_0099547
1026 Ga0373937_0025084
1027 Ga0373937_0233279
1028 Ga0373937_0256561
1029 Ga0373937_0753975
1030 Ga0316584_0008299
1031 Ga0373925_0000163
1032 Ga0373925_0014261
1033 Ga0373925_0130800
1034 Ga0373925_0520860
1035 Ga0316581_0010471
1036 Ga0436364_0420833
1037 Ga0436364_0579258
1038 Ga0436364_0587740
1039 Ga0436364_0829415
1040 Ga0436364_1209217
1041 Ga0436364_1477067
1042 Ga0436365_0039697
1043 Ga0436365_0134859
1044 Ga0451577_0448752
1045 Ga0451577_0518903
1046 Ga0451576_0053190
1047 Ga0451576_0264179
1048 Ga0451576_0562480
1049 Ga0451576_1319398
1050 Ga0466958_0170180
1051 Ga0495592_0047868
1052 Ga0495603_0161816
1053 Ga0495629_0106413
1054 Ga0495653_0177946
1055 Ga0495580_0015334
1056 Ga0495580_0057940
1057 Ga0495580_0081724
1058 Ga0495580_0246736
1059 Ga0495582_0058618
1060 Ga0495639_0046922
1061 Ga0495662_0011178
1062 Ga0495664_0233978
1063 Ga0495594_0075977
1064 Ga0495628_0097863
1065 Ga0495628_0411302
1066 Ga0495630_0057686
1067 Ga0495666_0202639
1068 Ga0495652_0010010
1069 Ga0495652_0095452
1070 Ga0495652_0569047
1071 Ga0495665_0014251
1072 Ga0495640_0035498
1073 Ga0495640_0199962
1074 Ga0495586_0056703
1075 Ga0495586_0236659
1076 Ga0495587_0001333
1077 Ga0495587_0095545
1078 Ga0495645_0007046
1079 Ga0495645_0078135
1080 Ga0495645_0112188
1081 Ga0495645_0145375
1082 Ga0495645_0168854
1083 Ga0495667_0155883
1084 Ga0495667_0184637
1085 Ga0495657_0097805
1086 Ga0495657_0280326
1087 Ga0495599_0109305
1088 Ga0495599_0110110
1089 Ga0495599_0236118
1090 Ga0495623_0059026
1091 Ga0495623_0089231
1092 Ga0495600_0035034
1093 Ga0495604_0101745
1094 Ga0495604_0269788
1095 Ga0495604_0513562
1096 Ga0495674_0035471
1097 Ga0495674_0078590
1098 Ga0495674_0125430
1099 Ga0495674_0401807
1100 Ga0495680_0186184
1101 Ga0495680_0418187
1102 Ga0495675_0205030
1103 Ga0495684_0009642
1104 Ga0495684_0018454
1105 Ga0495684_0039634
1106 Ga0495684_0163570
1107 Ga0495684_0185018
1108 Ga0495602_0002734
1109 Ga0495602_0045067
1110 Ga0495602_0127795
1111 Ga0495602_0283312
1112 Ga0496104_0252066
1113 Ga0496112_0006624
1114 Ga0496113_0080786
1115 Ga0496114_0451908
1116 Ga0496115_0006544
1117 Ga0496115_0312432
1118 Ga0501032_0014722
1119 Ga0501038_0004170
1120 Ga0501039_0003394
1121 Ga0501042_0005007
1122 Ga0501043_0138128
1123 Ga0501046_0000857
1124 Ga0501048_0006194
1125 Ga0501035_0004990
1126 nmdc:mga0n895_5862_c1
1127 nmdc:mga0rr50_303743_c1
1128 nmdc:mga08x19_7164_c1
1129 Ga0495612_0025313
1130 Ga0501082_0001662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

234

0.96

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

194

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hl3-assembly1.cif.gz_A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. 0.962 1 235
1mc3-assembly1.cif.gz_A crystal structure of rffh 0.9469 1 238
1mp3-assembly1.cif.gz_A l89t variant of s. enterica rmla 0.9462 2 236
1iim-assembly1.cif.gz_A thymidylyltransferase complexed with ttp 0.9447 2 236
1h5t-assembly1.cif.gz_C thymidylyltransferase complexed with thymidylyldiphosphate-glucose 0.9444 2 236
ID Description Score Start End Superfamily
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9797 1 235 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9438 2 236 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9434 1 220 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9304 1 220 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.903 2 236 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V9BEQ1-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.993 1 124 GO:0008879
GO:0045226
AF-A0A4P5WH85-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9926 14 237 GO:0008879
GO:0045226
AF-A0A2V9BQR4-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9921 1 238 GO:0008879
GO:0045226
AF-A0A7V3C5W4-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.992 1 237 GO:0008879
GO:0045226
AF-A0A7C5UBV5-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9909 1 237 GO:0008879
GO:0045226

Map