F463916

General Info

Members Datasets Scaffolds Average Seq Length
562 220 1124 67

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101583523|Ga0070716_1015835231
Length 69
Sequence MLLDSIVLGSLEAAYPMDSNAILHEVQQLYNVSDRLITISGSVRNTATLLEVLVATKMGLTSGLDPANA

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.34
Rhizosphere 94.66
Stem 0
Stem Tuber 0
Unclassified 49.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_101583523 3300006173 Unclassified 538
2 Ga0065712_10397757 3300005290 Bacteria 734
3 Ga0065715_10053279 3300005293 Unclassified 847
4 Ga0070658_10078332 3300005327 Unclassified 2712
5 Ga0070676_10431801 3300005328 Bacteria 922
6 Ga0070683_100321238 3300005329 Unclassified 1473
7 Ga0070683_100815692 3300005329 Bacteria 895
8 Ga0070690_100249200 3300005330 Unclassified 1255
9 Ga0070690_101211993 3300005330 Bacteria 602
10 Ga0070690_101519008 3300005330 Unclassified 541
11 Ga0070670_100004353 3300005331 Bacteria 11847
12 Ga0070670_100090035 3300005331 Unclassified 2637
13 Ga0068869_100003208 3300005334 Bacteria 9995
14 Ga0068869_100584831 3300005334 Unclassified 941
15 Ga0070666_10071005 3300005335 Bacteria 2369
16 Ga0070666_10778609 3300005335 Unclassified 704
17 Ga0070680_100167755 3300005336 Bacteria 1846
18 Ga0070680_100203674 3300005336 Bacteria 1669
19 Ga0070682_101010965 3300005337 Unclassified 691
20 Ga0070682_101054528 3300005337 Unclassified 678
21 Ga0070682_101947515 3300005337 Unclassified 516
22 Ga0068868_100005644 3300005338 Bacteria 8807
23 Ga0068868_100095105 3300005338 Bacteria 2404
24 Ga0070660_100284859 3300005339 Unclassified 1352
25 Ga0070660_100289321 3300005339 Bacteria 1342
26 Ga0070689_100026277 3300005340 Bacteria 4382
27 Ga0070689_100059966 3300005340 Bacteria 2957
28 Ga0070687_100598990 3300005343 Bacteria 757
29 Ga0070661_100201299 3300005344 Bacteria 1522
30 Ga0070661_100201692 3300005344 Unclassified 1520
31 Ga0070692_10605450 3300005345 Bacteria 725
32 Ga0070668_100407664 3300005347 Bacteria 1162
33 Ga0070675_100179940 3300005354 Unclassified 1828
34 Ga0070671_100264941 3300005355 Unclassified 1460
35 Ga0070673_100084673 3300005364 Bacteria 2579
36 Ga0070659_100086064 3300005366 Bacteria 2514
37 Ga0070659_100180229 3300005366 Unclassified 1733
38 Ga0070659_101235017 3300005366 Bacteria 661
39 Ga0070667_100379743 3300005367 Unclassified 1283
40 Ga0070667_102065036 3300005367 Bacteria 537
41 Ga0070703_10304878 3300005406 Unclassified 665
42 Ga0070709_10322277 3300005434 Bacteria 1134
43 Ga0070709_10405360 3300005434 Bacteria 1019
44 Ga0070709_10702836 3300005434 Unclassified 787
45 Ga0070709_11047793 3300005434 Unclassified 650
46 Ga0070709_11190909 3300005434 Bacteria 612
47 Ga0070709_11439127 3300005434 Unclassified 558
48 Ga0070709_11491008 3300005434 Unclassified 549
49 Ga0070714_100096104 3300005435 Unclassified 2602
50 Ga0070714_100384021 3300005435 Unclassified 1324
51 Ga0070714_100420826 3300005435 Unclassified 1265
52 Ga0070714_100619140 3300005435 Unclassified 1041
53 Ga0070714_100620213 3300005435 Bacteria 1040
54 Ga0070714_101242748 3300005435 Unclassified 727
55 Ga0070713_100141540 3300005436 Bacteria 2131
56 Ga0070713_100253663 3300005436 Unclassified 1605
57 Ga0070713_100255489 3300005436 Bacteria 1600
58 Ga0070713_100259874 3300005436 Bacteria 1586
59 Ga0070713_100632056 3300005436 Unclassified 1019
60 Ga0070713_100760244 3300005436 Bacteria 927
61 Ga0070713_100790108 3300005436 Unclassified 909
62 Ga0070713_101472500 3300005436 Bacteria 660
63 Ga0070710_10026072 3300005437 Bacteria 3102
64 Ga0070710_10075482 3300005437 Bacteria 1954
65 Ga0070710_10144311 3300005437 Bacteria 1462
66 Ga0070710_10227450 3300005437 Bacteria 1189
67 Ga0070710_10304647 3300005437 Unclassified 1041
68 Ga0070710_10383461 3300005437 Unclassified 938
69 Ga0070710_11172120 3300005437 Unclassified 567
70 Ga0070711_100004628 3300005439 Bacteria 8141
71 Ga0070711_100118807 3300005439 Bacteria 1952
72 Ga0070711_100249785 3300005439 Bacteria 1391
73 Ga0070711_100309572 3300005439 Unclassified 1258
74 Ga0070711_101309801 3300005439 Unclassified 629
75 Ga0070705_100301957 3300005440 Bacteria 1148
76 Ga0070708_102060329 3300005445 Unclassified 528
77 Ga0070678_100386289 3300005456 Unclassified 1212
78 Ga0070678_100877439 3300005456 Bacteria 819
79 Ga0070678_102013672 3300005456 Bacteria 546
80 Ga0070681_10075056 3300005458 Bacteria 3341
81 Ga0070681_10156911 3300005458 Bacteria 2200
82 Ga0068867_100007849 3300005459 Bacteria 7542
83 Ga0070685_10202717 3300005466 Unclassified 1290
84 Ga0070706_100092908 3300005467 Bacteria 2799
85 Ga0070706_100136388 3300005467 Bacteria 2291
86 Ga0070706_100305306 3300005467 Unclassified 1485
87 Ga0070706_100686802 3300005467 Unclassified 950
88 Ga0070706_100726711 3300005467 Unclassified 920
89 Ga0070706_102101901 3300005467 Bacteria 511
90 Ga0070707_100672858 3300005468 Bacteria 998
91 Ga0070698_100599516 3300005471 Bacteria 1042
92 Ga0070699_100023369 3300005518 Bacteria 5324
93 Ga0070699_100200839 3300005518 Unclassified 1773
94 Ga0070699_100439768 3300005518 Unclassified 1182
95 Ga0070699_101366556 3300005518 Bacteria 650
96 Ga0070679_100045966 3300005530 Bacteria 4350
97 Ga0070679_100243400 3300005530 Bacteria 1756
98 Ga0070684_100062435 3300005535 Bacteria 3264
99 Ga0070684_100145576 3300005535 Bacteria 2144
100 Ga0070697_100000111 3300005536 Bacteria 63543
101 Ga0070697_100289818 3300005536 Bacteria 1406
102 Ga0070697_100529220 3300005536 Unclassified 1032
103 Ga0070697_101331252 3300005536 Unclassified 641
104 Ga0070697_101356390 3300005536 Unclassified 635
105 Ga0068853_100036469 3300005539 Bacteria 4182
106 Ga0068853_100387090 3300005539 Unclassified 1307
107 Ga0068853_100417033 3300005539 Bacteria 1258
108 Ga0068853_100748954 3300005539 Unclassified 934
109 Ga0070672_100368449 3300005543 Bacteria 1227
110 Ga0070672_101252625 3300005543 Bacteria 661
111 Ga0070672_101287176 3300005543 Unclassified 652
112 Ga0070686_100138391 3300005544 Unclassified 1692
113 Ga0070686_101450481 3300005544 Unclassified 577
114 Ga0070696_100345134 3300005546 Unclassified 1152
115 Ga0068855_100014007 3300005563 Bacteria 9667
116 Ga0068855_100100812 3300005563 Bacteria 3324
117 Ga0068855_101065588 3300005563 Unclassified 847
118 Ga0068855_101144334 3300005563 Unclassified 812
119 Ga0068855_101185017 3300005563 Unclassified 795
120 Ga0068855_101374565 3300005563 Bacteria 728
121 Ga0070664_100003973 3300005564 Bacteria 11895
122 Ga0070664_100100732 3300005564 Bacteria 2511
123 Ga0070664_100249460 3300005564 Unclassified 1595
124 Ga0070664_100314436 3300005564 Unclassified 1418
125 Ga0070664_102112251 3300005564 Bacteria 534
126 Ga0068857_100057829 3300005577 Bacteria 3442
127 Ga0068857_100264759 3300005577 Bacteria 1578
128 Ga0068857_101877531 3300005577 Unclassified 587
129 Ga0068854_100019742 3300005578 Plasmid 4548
130 Ga0068854_100044327 3300005578 Bacteria 3156
131 Ga0068854_100947500 3300005578 Bacteria 759
132 Ga0068854_101041327 3300005578 Bacteria 726
133 Ga0068856_100062716 3300005614 Bacteria 3671
134 Ga0068856_100115549 3300005614 Bacteria 2683
135 Ga0068856_100238566 3300005614 Unclassified 1833
136 Ga0068856_101117023 3300005614 Bacteria 805
137 Ga0070702_100177141 3300005615 Bacteria 1392
138 Ga0068852_100378739 3300005616 Bacteria 1388
139 Ga0068852_101087638 3300005616 Unclassified 820
140 Ga0068852_101116400 3300005616 Bacteria 809
141 Ga0068859_100007188 3300005617 Bacteria 11301
142 Ga0068859_100211824 3300005617 Unclassified 2024
143 Ga0068859_100943361 3300005617 Unclassified 946
144 Ga0068864_100015070 3300005618 Bacteria 6426
145 Ga0068864_100032190 3300005618 Bacteria 4454
146 Ga0068864_100262732 3300005618 Unclassified 1606
147 Ga0068866_10027840 3300005718 Unclassified 2687
148 Ga0068866_10049903 3300005718 Bacteria 2123
149 Ga0068866_10227735 3300005718 Unclassified 1129
150 Ga0068861_100212964 3300005719 Unclassified 1628
151 Ga0068851_10037087 3300005834 Unclassified 2444
152 Ga0068851_10097291 3300005834 Unclassified 1557
153 Ga0068851_10138910 3300005834 Bacteria 1320
154 Ga0068851_10288264 3300005834 Unclassified 941
155 Ga0068870_10066240 3300005840 Bacteria 1956
156 Ga0068870_10218864 3300005840 Unclassified 1164
157 Ga0068863_100577415 3300005841 Bacteria 1111
158 Ga0068863_101323675 3300005841 Unclassified 727
159 Ga0068863_101546821 3300005841 Unclassified 672
160 Ga0068863_101761143 3300005841 Unclassified 629
161 Ga0068858_100010508 3300005842 Bacteria 8770
162 Ga0068858_100011743 3300005842 Bacteria 8261
163 Ga0068858_100226792 3300005842 Unclassified 1770
164 Ga0068858_102448302 3300005842 Unclassified 516
165 Ga0068860_100011005 3300005843 Bacteria 8920
166 Ga0068860_100170621 3300005843 Unclassified 2101
167 Ga0068860_100865993 3300005843 Unclassified 919
168 Ga0068860_100983224 3300005843 Unclassified 861
169 Ga0068862_100201118 3300005844 Unclassified 1796
170 Ga0070717_10010222 3300006028 Bacteria 7070
171 Ga0070717_10027499 3300006028 Unclassified 4546
172 Ga0070717_10070421 3300006028 Bacteria 2915
173 Ga0070717_10261984 3300006028 Bacteria 1530
174 Ga0070717_10519918 3300006028 Bacteria 1077
175 Ga0070715_10058521 3300006163 Unclassified 1683
176 Ga0070716_100004156 3300006173 Bacteria 6877
177 Ga0070716_100224628 3300006173 Unclassified 1264
178 Ga0070716_100290959 3300006173 Bacteria 1132
179 Ga0070716_100410263 3300006173 Unclassified 977
180 Ga0070716_101091917 3300006173 Unclassified 636
181 Ga0070716_101124164 3300006173 Unclassified 628
182 Ga0070716_101595394 3300006173 Unclassified 536
183 Ga0070712_100016594 3300006175 Bacteria 4757
184 Ga0070712_100059376 3300006175 Bacteria 2694
185 Ga0070712_100322816 3300006175 Archaea 1256
186 Ga0070712_100955441 3300006175 Unclassified 740
187 Ga0097621_100051809 3300006237 Bacteria 3341
188 Ga0097621_100500491 3300006237 Unclassified 1100
189 Ga0068871_100030853 3300006358 Unclassified 4224
190 Ga0068871_100051542 3300006358 Bacteria 3332
191 Ga0068865_100152012 3300006881 Bacteria 1757
192 Ga0068865_100216998 3300006881 Unclassified 1493
193 Ga0068865_100244410 3300006881 Unclassified 1413
194 Ga0075436_100217755 3300006914 Unclassified 1354
195 Ga0097620_100007188 3300006931 Bacteria 11301
196 Ga0097620_100211819 3300006931 Unclassified 2024
197 Ga0097620_100943279 3300006931 Unclassified 946
198 Ga0075435_100082262 3300007076 Unclassified 2646
199 Ga0075435_100338781 3300007076 Unclassified 1288
200 Ga0105240_10081736 3300009093 Bacteria 3969
201 Ga0105240_10109166 3300009093 Bacteria 3351
202 Ga0105240_10415867 3300009093 Bacteria 1512
203 Ga0105240_10454616 3300009093 Bacteria 1432
204 Ga0105240_10551100 3300009093 Unclassified 1276
205 Ga0105240_11498217 3300009093 Unclassified 707
206 Ga0105240_11569687 3300009093 Unclassified 689
207 Ga0105240_11986813 3300009093 Unclassified 604
208 Ga0105245_10120134 3300009098 Unclassified 2454
209 Ga0105245_10200466 3300009098 Bacteria 1916
210 Ga0105245_10659249 3300009098 Unclassified 1077
211 Ga0105247_10511282 3300009101 Unclassified 877
212 Ga0105243_11892236 3300009148 Unclassified 629
213 Ga0105243_12907035 3300009148 Unclassified 519
214 Ga0105241_10091036 3300009174 Bacteria 2406
215 Ga0105241_10232552 3300009174 Bacteria 1554
216 Ga0105241_10389567 3300009174 Unclassified 1220
217 Ga0105241_10711583 3300009174 Unclassified 918
218 Ga0105241_11072137 3300009174 Unclassified 757
219 Ga0105241_11440001 3300009174 Unclassified 661
220 Ga0105242_10017283 3300009176 Bacteria 5618
221 Ga0105242_10147494 3300009176 Bacteria 2048
222 Ga0105248_10139076 3300009177 Bacteria 2739
223 Ga0105248_10204053 3300009177 Bacteria 2227
224 Ga0105248_10626150 3300009177 Unclassified 1214
225 Ga0105237_10032868 3300009545 Bacteria 5252
226 Ga0105237_10165309 3300009545 Bacteria 2211
227 Ga0105237_10274431 3300009545 Unclassified 1689
228 Ga0105237_10401780 3300009545 Unclassified 1375
229 Ga0105237_10457368 3300009545 Unclassified 1282
230 Ga0105237_10915541 3300009545 Bacteria 884
231 Ga0105237_11757340 3300009545 Unclassified 628
232 Ga0105237_12516452 3300009545 Unclassified 525
233 Ga0105238_10077072 3300009551 Bacteria 3326
234 Ga0105238_11844432 3300009551 Bacteria 637
235 Ga0105249_10110496 3300009553 Unclassified 2597
236 Ga0105249_10275184 3300009553 Bacteria 1679
237 Ga0105249_12980436 3300009553 Unclassified 544
238 Ga0105239_10091976 3300010375 Bacteria 3348
239 Ga0105239_10138177 3300010375 Unclassified 2713
240 Ga0105239_10363615 3300010375 Bacteria 1634
241 Ga0105239_11512334 3300010375 Bacteria 776
242 Ga0105239_11554944 3300010375 Unclassified 765
243 Ga0105239_11925176 3300010375 Bacteria 686
244 Ga0105246_10747436 3300011119 Bacteria 862
245 Ga0157373_10024447 3300013100 Bacteria 4375
246 Ga0157373_10042007 3300013100 Bacteria 3269
247 Ga0157373_11003722 3300013100 Unclassified 623
248 Ga0157373_11094354 3300013100 Unclassified 598
249 Ga0157371_10024819 3300013102 Bacteria 4375
250 Ga0157371_10109839 3300013102 Unclassified 1957
251 Ga0157370_11327624 3300013104 Unclassified 648
252 Ga0157370_11572591 3300013104 Unclassified 591
253 Ga0157369_10077353 3300013105 Bacteria 3566
254 Ga0157369_10086531 3300013105 Bacteria 3347
255 Ga0157369_10100810 3300013105 Unclassified 3078
256 Ga0157369_10282738 3300013105 Unclassified 1728
257 Ga0157369_10326566 3300013105 Bacteria 1594
258 Ga0157374_10000593 3300013296 Bacteria 32025
259 Ga0157374_10026162 3300013296 Bacteria 5248
260 Ga0157374_10068134 3300013296 Bacteria 3347
261 Ga0157374_10385497 3300013296 Unclassified 1396
262 Ga0157374_10578867 3300013296 Unclassified 1132
263 Ga0157374_10984471 3300013296 Unclassified 862
264 Ga0157374_11080007 3300013296 Bacteria 823
265 Ga0157374_11363288 3300013296 Unclassified 732
266 Ga0157374_11986121 3300013296 Unclassified 608
267 Ga0157378_10005118 3300013297 Bacteria 11511
268 Ga0157378_10127606 3300013297 Bacteria 2351
269 Ga0157378_10488162 3300013297 Bacteria 1228
270 Ga0157378_10553698 3300013297 Unclassified 1156
271 Ga0163162_10278039 3300013306 Bacteria 1806
272 Ga0163162_11755767 3300013306 Unclassified 709
273 Ga0163162_12042445 3300013306 Unclassified 657
274 Ga0157372_10001312 3300013307 Bacteria 26932
275 Ga0157372_10022289 3300013307 Bacteria 6852
276 Ga0157372_10061706 3300013307 Bacteria 4199
277 Ga0157372_10121355 3300013307 Plasmid 3002
278 Ga0157372_10162992 3300013307 Bacteria 2577
279 Ga0157372_10165373 3300013307 Bacteria 2558
280 Ga0157372_10692181 3300013307 Unclassified 1186
281 Ga0157372_10768497 3300013307 Unclassified 1120
282 Ga0157372_11865548 3300013307 Bacteria 691
283 Ga0157372_12763758 3300013307 Unclassified 563
284 Ga0157372_13082655 3300013307 Unclassified 532
285 Ga0157375_10793001 3300013308 Bacteria 1096
286 Ga0157375_11744310 3300013308 Unclassified 738
287 Ga0157375_12456969 3300013308 Unclassified 622
288 Ga0163163_10450181 3300014325 Bacteria 1348
289 Ga0163163_10624239 3300014325 Bacteria 1141
290 Ga0163163_10949043 3300014325 Bacteria 923
291 Ga0157380_10610697 3300014326 Unclassified 1081
292 Ga0182008_10072146 3300014497 Bacteria 1699
293 Ga0182008_10171590 3300014497 Bacteria 1095
294 Ga0157377_10871443 3300014745 Bacteria 670
295 Ga0157379_10120982 3300014968 Bacteria 2355
296 Ga0157379_10488282 3300014968 Unclassified 1140
297 Ga0157379_10549364 3300014968 Bacteria 1074
298 Ga0157379_11450262 3300014968 Unclassified 666
299 Ga0157376_10078482 3300014969 Bacteria 2827
300 Ga0157376_10314531 3300014969 Bacteria 1487
301 Ga0157376_10337615 3300014969 Bacteria 1438
302 Ga0157376_10380608 3300014969 Bacteria 1359
303 Ga0157376_10594116 3300014969 Bacteria 1101
304 Ga0182006_1075822 3300015261 Unclassified 1237
305 Ga0182007_10020244 3300015262 Unclassified 2382
306 Ga0182007_10186825 3300015262 Bacteria 719
307 Ga0182005_1031288 3300015265 Bacteria 1450
308 Ga0182005_1063859 3300015265 Bacteria 1006
309 Ga0163161_10281808 3300017792 Bacteria 1304
310 Ga0207656_10141964 3300025321 Bacteria 1132
311 Ga0207656_10421808 3300025321 Unclassified 672
312 Ga0207692_10019962 3300025898 Bacteria 3039
313 Ga0207642_10396104 3300025899 Bacteria 825
314 Ga0207642_10420838 3300025899 Bacteria 803
315 Ga0207710_10153561 3300025900 Unclassified 1118
316 Ga0207710_10251122 3300025900 Unclassified 884
317 Ga0207688_10073352 3300025901 Unclassified 1945
318 Ga0207647_10042575 3300025904 Bacteria 2848
319 Ga0207647_10091063 3300025904 Bacteria 1819
320 Ga0207685_10037571 3300025905 Unclassified 1784
321 Ga0207685_10121368 3300025905 Unclassified 1148
322 Ga0207699_10088389 3300025906 Bacteria 1939
323 Ga0207699_10302466 3300025906 Unclassified 1117
324 Ga0207699_10366398 3300025906 Bacteria 1020
325 Ga0207699_10606804 3300025906 Unclassified 797
326 Ga0207699_10956849 3300025906 Unclassified 632
327 Ga0207643_10049994 3300025908 Unclassified 2370
328 Ga0207705_10231529 3300025909 Unclassified 1405
329 Ga0207684_10031943 3300025910 Bacteria 4479
330 Ga0207684_10152126 3300025910 Unclassified 1991
331 Ga0207684_10299511 3300025910 Bacteria 1386
332 Ga0207684_10416834 3300025910 Unclassified 1154
333 Ga0207684_10835374 3300025910 Unclassified 777
334 Ga0207654_10181910 3300025911 Bacteria 1372
335 Ga0207654_10306835 3300025911 Unclassified 1081
336 Ga0207654_10344708 3300025911 Unclassified 1024
337 Ga0207654_10562653 3300025911 Unclassified 811
338 Ga0207654_10800045 3300025911 Unclassified 681
339 Ga0207707_10278776 3300025912 Bacteria 1448
340 Ga0207707_11604663 3300025912 Unclassified 512
341 Ga0207695_10025665 3300025913 Bacteria 6592
342 Ga0207695_10441493 3300025913 Bacteria 1185
343 Ga0207695_10663641 3300025913 Unclassified 924
344 Ga0207695_10868111 3300025913 Bacteria 782
345 Ga0207671_10051841 3300025914 Bacteria 3040
346 Ga0207671_10512028 3300025914 Unclassified 957
347 Ga0207671_10707290 3300025914 Unclassified 801
348 Ga0207693_10004203 3300025915 Bacteria 12211
349 Ga0207693_10025164 3300025915 Bacteria 4721
350 Ga0207693_10030150 3300025915 Bacteria 4284
351 Ga0207693_10115150 3300025915 Bacteria 2110
352 Ga0207693_10180963 3300025915 Unclassified 1659
353 Ga0207693_10723210 3300025915 Unclassified 770
354 Ga0207693_11444138 3300025915 Unclassified 509
355 Ga0207663_10003064 3300025916 Bacteria 8099
356 Ga0207663_10080588 3300025916 Bacteria 2129
357 Ga0207663_10298833 3300025916 Unclassified 1202
358 Ga0207660_10051655 3300025917 Bacteria 2923
359 Ga0207660_10147049 3300025917 Bacteria 1807
360 Ga0207662_10256856 3300025918 Bacteria 1149
361 Ga0207657_10046009 3300025919 Bacteria 3824
362 Ga0207657_10373602 3300025919 Bacteria 1123
363 Ga0207649_10139269 3300025920 Unclassified 1658
364 Ga0207649_10448194 3300025920 Unclassified 974
365 Ga0207649_11084309 3300025920 Bacteria 631
366 Ga0207652_10049339 3300025921 Bacteria 3603
367 Ga0207652_10155301 3300025921 Bacteria 2050
368 Ga0207646_10969652 3300025922 Unclassified 752
369 Ga0207681_11556103 3300025923 Bacteria 554
370 Ga0207694_10047336 3300025924 Bacteria 3327
371 Ga0207650_10000090 3300025925 Bacteria 118973
372 Ga0207650_10187228 3300025925 Unclassified 1652
373 Ga0207650_10968537 3300025925 Unclassified 723
374 Ga0207687_10539955 3300025927 Bacteria 977
375 Ga0207687_10760658 3300025927 Unclassified 825
376 Ga0207700_10034688 3300025928 Bacteria 3625
377 Ga0207700_10105720 3300025928 Bacteria 2255
378 Ga0207700_10199644 3300025928 Bacteria 1685
379 Ga0207700_10207450 3300025928 Bacteria 1655
380 Ga0207700_10444966 3300025928 Unclassified 1141
381 Ga0207700_10511853 3300025928 Unclassified 1063
382 Ga0207700_10575438 3300025928 Bacteria 1001
383 Ga0207700_11311212 3300025928 Bacteria 645
384 Ga0207664_10038465 3300025929 Unclassified 3710
385 Ga0207664_10218836 3300025929 Unclassified 1651
386 Ga0207664_10248914 3300025929 Bacteria 1550
387 Ga0207664_10413746 3300025929 Bacteria 1200
388 Ga0207664_10571955 3300025929 Bacteria 1014
389 Ga0207664_10613003 3300025929 Unclassified 978
390 Ga0207664_11056350 3300025929 Unclassified 727
391 Ga0207664_11242909 3300025929 Bacteria 663
392 Ga0207644_10533844 3300025931 Unclassified 970
393 Ga0207644_10585658 3300025931 Bacteria 925
394 Ga0207644_11617973 3300025931 Bacteria 543
395 Ga0207706_10321464 3300025933 Unclassified 1347
396 Ga0207686_10035429 3300025934 Unclassified 2996
397 Ga0207686_10509983 3300025934 Unclassified 934
398 Ga0207709_10449767 3300025935 Unclassified 995
399 Ga0207670_10158913 3300025936 Unclassified 1685
400 Ga0207670_10425451 3300025936 Unclassified 1066
401 Ga0207670_10956184 3300025936 Unclassified 719
402 Ga0207669_10510357 3300025937 Unclassified 964
403 Ga0207704_11190370 3300025938 Unclassified 649
404 Ga0207665_10001318 3300025939 Bacteria 16739
405 Ga0207665_10026156 3300025939 Unclassified 3851
406 Ga0207665_10137953 3300025939 Bacteria 1737
407 Ga0207665_10295960 3300025939 Unclassified 1208
408 Ga0207665_10421392 3300025939 Bacteria 1020
409 Ga0207691_10873347 3300025940 Unclassified 754
410 Ga0207691_11144520 3300025940 Unclassified 646
411 Ga0207711_10130084 3300025941 Unclassified 2256
412 Ga0207711_10297825 3300025941 Unclassified 1487
413 Ga0207711_11437800 3300025941 Unclassified 632
414 Ga0207661_10362546 3300025944 Unclassified 1309
415 Ga0207661_10964349 3300025944 Unclassified 785
416 Ga0207679_10004118 3300025945 Bacteria 9029
417 Ga0207679_10136445 3300025945 Bacteria 1976
418 Ga0207679_10478546 3300025945 Bacteria 1108
419 Ga0207667_10001721 3300025949 Bacteria 27566
420 Ga0207667_10053768 3300025949 Unclassified 4236
421 Ga0207667_10229668 3300025949 Unclassified 1900
422 Ga0207667_10812888 3300025949 Bacteria 931
423 Ga0207667_10839565 3300025949 Bacteria 913
424 Ga0207651_10291396 3300025960 Bacteria 1353
425 Ga0207651_11365376 3300025960 Unclassified 637
426 Ga0207668_11613430 3300025972 Unclassified 586
427 Ga0207640_10101538 3300025981 Bacteria 2019
428 Ga0207640_10147504 3300025981 Unclassified 1724
429 Ga0207640_11369566 3300025981 Bacteria 633
430 Ga0207658_10307247 3300025986 Unclassified 1368
431 Ga0207677_10080573 3300026023 Bacteria 2333
432 Ga0207677_10299356 3300026023 Bacteria 1328
433 Ga0207677_10744372 3300026023 Bacteria 873
434 Ga0207703_10025148 3300026035 Unclassified 4683
435 Ga0207703_11769177 3300026035 Unclassified 594
436 Ga0207639_10036614 3300026041 Bacteria 3638
437 Ga0207678_10170180 3300026067 Bacteria 1860
438 Ga0207678_10849149 3300026067 Bacteria 807
439 Ga0207702_10009489 3300026078 Bacteria 8176
440 Ga0207702_10233263 3300026078 Unclassified 1721
441 Ga0207702_10503770 3300026078 Bacteria 1180
442 Ga0207702_10515115 3300026078 Bacteria 1167
443 Ga0207702_10895342 3300026078 Bacteria 879
444 Ga0207702_11878424 3300026078 Bacteria 590
445 Ga0207641_10001842 3300026088 Bacteria 20372
446 Ga0207641_10131198 3300026088 Unclassified 2250
447 Ga0207641_10273188 3300026088 Bacteria 1587
448 Ga0207641_10298812 3300026088 Unclassified 1520
449 Ga0207641_10814242 3300026088 Bacteria 924
450 Ga0207641_12567392 3300026088 Bacteria 507
451 Ga0207648_10016409 3300026089 Bacteria 6767
452 Ga0207648_10621886 3300026089 Unclassified 997
453 Ga0207676_10004619 3300026095 Bacteria 9750
454 Ga0207676_10349158 3300026095 Unclassified 1367
455 Ga0207676_10803863 3300026095 Bacteria 917
456 Ga0207674_10002922 3300026116 Bacteria 21218
457 Ga0207674_10050671 3300026116 Unclassified 4240
458 Ga0207674_10108038 3300026116 Unclassified 2759
459 Ga0207675_100082245 3300026118 Unclassified 3020
460 Ga0207675_100174321 3300026118 Bacteria 2057
461 Ga0207683_10465853 3300026121 Unclassified 1166
462 Ga0207683_10785995 3300026121 Bacteria 883
463 Ga0207683_11722189 3300026121 Unclassified 576
464 Ga0207698_10218282 3300026142 Bacteria 1721
465 Ga0268266_10007211 3300028379 Bacteria 10055
466 Ga0268264_10013168 3300028381 Bacteria 6804
467 Ga0268264_10056111 3300028381 Bacteria 3292
468 Ga0268264_11210933 3300028381 Unclassified 765
469 Ga0265334_10323644 3300028573 Unclassified 527
470 Ga0265338_10034712 3300028800 Bacteria 4868
471 Ga0265328_10040337 3300031239 Unclassified 1720
472 Ga0265340_10005861 3300031247 Bacteria 6796
473 Ga0265339_10141300 3300031249 Bacteria 1225
474 Ga0265331_10079153 3300031250 Unclassified 1529
475 Ga0265331_10560252 3300031250 Unclassified 515
476 Ga0265316_10053653 3300031344 Plasmid 3158
477 Ga0265316_10651946 3300031344 Unclassified 744
478 Ga0265313_10006915 3300031595 Bacteria 7882
479 Ga0373926_0171875 3300035083 Unclassified 829
480 Ga0373923_0195418 3300035111 Bacteria 934
481 Ga0373945_0126327 3300035116 Unclassified 1021
482 Ga0373943_0029999 3300035170 Bacteria 2572
483 Ga0373943_0372011 3300035170 Unclassified 822
484 Ga0373946_0023423 3300035171 Unclassified 2412
485 Ga0373931_0144615 3300035691 Bacteria 1381
486 Ga0373931_0208785 3300035691 Bacteria 1170
487 Ga0373935_0045391 3300035692 Unclassified 2773
488 Ga0373935_0723869 3300035692 Unclassified 732
489 Ga0373927_0102407 3300035695 Bacteria 1863
490 Ga0373927_0594554 3300035695 Unclassified 731
491 Ga0373933_0497301 3300035724 Unclassified 799
492 Ga0373947_0014130 3300035725 Bacteria 4577
493 Ga0373947_0026438 3300035725 Plasmid 3392
494 Ga0373937_0136475 3300036401 Bacteria 2294
495 Ga0373937_0979479 3300036401 Unclassified 794
496 Ga0373937_1486736 3300036401 Unclassified 625
497 Ga0373925_0003174 3300037068 Bacteria 12856
498 Ga0373925_0156612 3300037068 Unclassified 1792
499 Ga0373925_0237410 3300037068 Bacteria 1459
500 Ga0373925_0802676 3300037068 Unclassified 776
501 Ga0373925_1207197 3300037068 Unclassified 621
502 Ga0395900_0279748 3300037418 Bacteria 1661
503 Ga0495603_0174130 3300046455 Unclassified 1246
504 Ga0495629_0272332 3300046459 Unclassified 1163
505 Ga0495580_0003037 3300046472 Bacteria 14369
506 Ga0495580_0007572 3300046472 Bacteria 8711
507 Ga0495580_0011978 3300046472 Bacteria 6683
508 Ga0495580_0019113 3300046472 Bacteria 5093
509 Ga0495580_0060193 3300046472 Bacteria 2668
510 Ga0495580_0102817 3300046472 Unclassified 1986
511 Ga0495580_0186138 3300046472 Bacteria 1433
512 Ga0495582_0004941 3300046473 Bacteria 7474
513 Ga0495639_0060211 3300046475 Unclassified 1739
514 Ga0495584_0581513 3300046491 Unclassified 571
515 Ga0495630_0818380 3300046517 Unclassified 711
516 Ga0495666_0509971 3300046526 Unclassified 537
517 Ga0495665_0449127 3300046531 Unclassified 652
518 Ga0495586_0376024 3300046535 Unclassified 817
519 Ga0495586_0539714 3300046535 Unclassified 673
520 Ga0495623_0082725 3300046679 Bacteria 1984
521 Ga0495658_0336723 3300046683 Unclassified 958
522 Ga0495658_0548640 3300046683 Unclassified 740
523 Ga0495669_0052566 3300046684 Bacteria 1831
524 Ga0495624_0383556 3300046690 Unclassified 844
525 Ga0495670_0283758 3300046691 Bacteria 886
526 Ga0495581_0760362 3300047315 Unclassified 557
527 Ga0495674_0123338 3300047319 Unclassified 2188
528 Ga0495674_0675887 3300047319 Unclassified 812
529 Ga0495676_0765375 3300047321 Unclassified 623
530 Ga0496100_0803152 3300048903 Unclassified 737
531 Ga0496101_0133921 3300048904 Bacteria 1884
532 Ga0496101_0447550 3300048904 Unclassified 1019
533 Ga0496102_0009871 3300048905 Bacteria 8208
534 Ga0496102_0097754 3300048905 Bacteria 2723
535 Ga0496102_1137441 3300048905 Unclassified 700
536 Ga0496103_0410023 3300048906 Unclassified 870
537 Ga0496103_0517751 3300048906 Unclassified 763
538 Ga0496104_0128790 3300048907 Unclassified 2431
539 Ga0496104_0953856 3300048907 Bacteria 762
540 Ga0496106_0308372 3300048909 Unclassified 1270
541 Ga0496106_0405325 3300048909 Unclassified 1096
542 Ga0496106_0574029 3300048909 Bacteria 904
543 Ga0496107_0236602 3300048910 Bacteria 1359
544 Ga0496108_0123920 3300048911 Unclassified 2218
545 Ga0496108_0640005 3300048911 Bacteria 925
546 Ga0496109_0075967 3300048912 Unclassified 3089
547 Ga0496109_0284979 3300048912 Bacteria 1557
548 Ga0496109_0429980 3300048912 Bacteria 1247
549 Ga0496109_1567118 3300048912 Unclassified 593
550 Ga0496110_0165289 3300048913 Bacteria 2007
551 Ga0496110_0515045 3300048913 Unclassified 1088
552 Ga0496111_0127274 3300048914 Unclassified 1884
553 Ga0496112_0014309 3300048915 Bacteria 7351
554 Ga0496112_0104299 3300048915 Bacteria 2805
555 Ga0496112_0372105 3300048915 Unclassified 1370
556 Ga0496112_0876156 3300048915 Unclassified 820
557 Ga0496113_0038535 3300048916 Bacteria 3515
558 Ga0496113_0189997 3300048916 Bacteria 1630
559 Ga0496115_0842757 3300048918 Unclassified 711
560 nmdc:mga0rr50_1570129_c1 3300050513 Unclassified 556
561 nmdc:mga08x19_64675_c1 3300050514 Unclassified 2375
562 Ga0495601_0572571 3300053077 Unclassified 726
563 Ga0070716_101583523
564 Ga0065712_10397757
565 Ga0065715_10053279
566 Ga0070658_10078332
567 Ga0070676_10431801
568 Ga0070683_100321238
569 Ga0070683_100815692
570 Ga0070690_100249200
571 Ga0070690_101211993
572 Ga0070690_101519008
573 Ga0070670_100004353
574 Ga0070670_100090035
575 Ga0068869_100003208
576 Ga0068869_100584831
577 Ga0070666_10071005
578 Ga0070666_10778609
579 Ga0070680_100167755
580 Ga0070680_100203674
581 Ga0070682_101010965
582 Ga0070682_101054528
583 Ga0070682_101947515
584 Ga0068868_100005644
585 Ga0068868_100095105
586 Ga0070660_100284859
587 Ga0070660_100289321
588 Ga0070689_100026277
589 Ga0070689_100059966
590 Ga0070687_100598990
591 Ga0070661_100201299
592 Ga0070661_100201692
593 Ga0070692_10605450
594 Ga0070668_100407664
595 Ga0070675_100179940
596 Ga0070671_100264941
597 Ga0070673_100084673
598 Ga0070659_100086064
599 Ga0070659_100180229
600 Ga0070659_101235017
601 Ga0070667_100379743
602 Ga0070667_102065036
603 Ga0070703_10304878
604 Ga0070709_10322277
605 Ga0070709_10405360
606 Ga0070709_10702836
607 Ga0070709_11047793
608 Ga0070709_11190909
609 Ga0070709_11439127
610 Ga0070709_11491008
611 Ga0070714_100096104
612 Ga0070714_100384021
613 Ga0070714_100420826
614 Ga0070714_100619140
615 Ga0070714_100620213
616 Ga0070714_101242748
617 Ga0070713_100141540
618 Ga0070713_100253663
619 Ga0070713_100255489
620 Ga0070713_100259874
621 Ga0070713_100632056
622 Ga0070713_100760244
623 Ga0070713_100790108
624 Ga0070713_101472500
625 Ga0070710_10026072
626 Ga0070710_10075482
627 Ga0070710_10144311
628 Ga0070710_10227450
629 Ga0070710_10304647
630 Ga0070710_10383461
631 Ga0070710_11172120
632 Ga0070711_100004628
633 Ga0070711_100118807
634 Ga0070711_100249785
635 Ga0070711_100309572
636 Ga0070711_101309801
637 Ga0070705_100301957
638 Ga0070708_102060329
639 Ga0070678_100386289
640 Ga0070678_100877439
641 Ga0070678_102013672
642 Ga0070681_10075056
643 Ga0070681_10156911
644 Ga0068867_100007849
645 Ga0070685_10202717
646 Ga0070706_100092908
647 Ga0070706_100136388
648 Ga0070706_100305306
649 Ga0070706_100686802
650 Ga0070706_100726711
651 Ga0070706_102101901
652 Ga0070707_100672858
653 Ga0070698_100599516
654 Ga0070699_100023369
655 Ga0070699_100200839
656 Ga0070699_100439768
657 Ga0070699_101366556
658 Ga0070679_100045966
659 Ga0070679_100243400
660 Ga0070684_100062435
661 Ga0070684_100145576
662 Ga0070697_100000111
663 Ga0070697_100289818
664 Ga0070697_100529220
665 Ga0070697_101331252
666 Ga0070697_101356390
667 Ga0068853_100036469
668 Ga0068853_100387090
669 Ga0068853_100417033
670 Ga0068853_100748954
671 Ga0070672_100368449
672 Ga0070672_101252625
673 Ga0070672_101287176
674 Ga0070686_100138391
675 Ga0070686_101450481
676 Ga0070696_100345134
677 Ga0068855_100014007
678 Ga0068855_100100812
679 Ga0068855_101065588
680 Ga0068855_101144334
681 Ga0068855_101185017
682 Ga0068855_101374565
683 Ga0070664_100003973
684 Ga0070664_100100732
685 Ga0070664_100249460
686 Ga0070664_100314436
687 Ga0070664_102112251
688 Ga0068857_100057829
689 Ga0068857_100264759
690 Ga0068857_101877531
691 Ga0068854_100019742
692 Ga0068854_100044327
693 Ga0068854_100947500
694 Ga0068854_101041327
695 Ga0068856_100062716
696 Ga0068856_100115549
697 Ga0068856_100238566
698 Ga0068856_101117023
699 Ga0070702_100177141
700 Ga0068852_100378739
701 Ga0068852_101087638
702 Ga0068852_101116400
703 Ga0068859_100007188
704 Ga0068859_100211824
705 Ga0068859_100943361
706 Ga0068864_100015070
707 Ga0068864_100032190
708 Ga0068864_100262732
709 Ga0068866_10027840
710 Ga0068866_10049903
711 Ga0068866_10227735
712 Ga0068861_100212964
713 Ga0068851_10037087
714 Ga0068851_10097291
715 Ga0068851_10138910
716 Ga0068851_10288264
717 Ga0068870_10066240
718 Ga0068870_10218864
719 Ga0068863_100577415
720 Ga0068863_101323675
721 Ga0068863_101546821
722 Ga0068863_101761143
723 Ga0068858_100010508
724 Ga0068858_100011743
725 Ga0068858_100226792
726 Ga0068858_102448302
727 Ga0068860_100011005
728 Ga0068860_100170621
729 Ga0068860_100865993
730 Ga0068860_100983224
731 Ga0068862_100201118
732 Ga0070717_10010222
733 Ga0070717_10027499
734 Ga0070717_10070421
735 Ga0070717_10261984
736 Ga0070717_10519918
737 Ga0070715_10058521
738 Ga0070716_100004156
739 Ga0070716_100224628
740 Ga0070716_100290959
741 Ga0070716_100410263
742 Ga0070716_101091917
743 Ga0070716_101124164
744 Ga0070716_101595394
745 Ga0070712_100016594
746 Ga0070712_100059376
747 Ga0070712_100322816
748 Ga0070712_100955441
749 Ga0097621_100051809
750 Ga0097621_100500491
751 Ga0068871_100030853
752 Ga0068871_100051542
753 Ga0068865_100152012
754 Ga0068865_100216998
755 Ga0068865_100244410
756 Ga0075436_100217755
757 Ga0097620_100007188
758 Ga0097620_100211819
759 Ga0097620_100943279
760 Ga0075435_100082262
761 Ga0075435_100338781
762 Ga0105240_10081736
763 Ga0105240_10109166
764 Ga0105240_10415867
765 Ga0105240_10454616
766 Ga0105240_10551100
767 Ga0105240_11498217
768 Ga0105240_11569687
769 Ga0105240_11986813
770 Ga0105245_10120134
771 Ga0105245_10200466
772 Ga0105245_10659249
773 Ga0105247_10511282
774 Ga0105243_11892236
775 Ga0105243_12907035
776 Ga0105241_10091036
777 Ga0105241_10232552
778 Ga0105241_10389567
779 Ga0105241_10711583
780 Ga0105241_11072137
781 Ga0105241_11440001
782 Ga0105242_10017283
783 Ga0105242_10147494
784 Ga0105248_10139076
785 Ga0105248_10204053
786 Ga0105248_10626150
787 Ga0105237_10032868
788 Ga0105237_10165309
789 Ga0105237_10274431
790 Ga0105237_10401780
791 Ga0105237_10457368
792 Ga0105237_10915541
793 Ga0105237_11757340
794 Ga0105237_12516452
795 Ga0105238_10077072
796 Ga0105238_11844432
797 Ga0105249_10110496
798 Ga0105249_10275184
799 Ga0105249_12980436
800 Ga0105239_10091976
801 Ga0105239_10138177
802 Ga0105239_10363615
803 Ga0105239_11512334
804 Ga0105239_11554944
805 Ga0105239_11925176
806 Ga0105246_10747436
807 Ga0157373_10024447
808 Ga0157373_10042007
809 Ga0157373_11003722
810 Ga0157373_11094354
811 Ga0157371_10024819
812 Ga0157371_10109839
813 Ga0157370_11327624
814 Ga0157370_11572591
815 Ga0157369_10077353
816 Ga0157369_10086531
817 Ga0157369_10100810
818 Ga0157369_10282738
819 Ga0157369_10326566
820 Ga0157374_10000593
821 Ga0157374_10026162
822 Ga0157374_10068134
823 Ga0157374_10385497
824 Ga0157374_10578867
825 Ga0157374_10984471
826 Ga0157374_11080007
827 Ga0157374_11363288
828 Ga0157374_11986121
829 Ga0157378_10005118
830 Ga0157378_10127606
831 Ga0157378_10488162
832 Ga0157378_10553698
833 Ga0163162_10278039
834 Ga0163162_11755767
835 Ga0163162_12042445
836 Ga0157372_10001312
837 Ga0157372_10022289
838 Ga0157372_10061706
839 Ga0157372_10121355
840 Ga0157372_10162992
841 Ga0157372_10165373
842 Ga0157372_10692181
843 Ga0157372_10768497
844 Ga0157372_11865548
845 Ga0157372_12763758
846 Ga0157372_13082655
847 Ga0157375_10793001
848 Ga0157375_11744310
849 Ga0157375_12456969
850 Ga0163163_10450181
851 Ga0163163_10624239
852 Ga0163163_10949043
853 Ga0157380_10610697
854 Ga0182008_10072146
855 Ga0182008_10171590
856 Ga0157377_10871443
857 Ga0157379_10120982
858 Ga0157379_10488282
859 Ga0157379_10549364
860 Ga0157379_11450262
861 Ga0157376_10078482
862 Ga0157376_10314531
863 Ga0157376_10337615
864 Ga0157376_10380608
865 Ga0157376_10594116
866 Ga0182006_1075822
867 Ga0182007_10020244
868 Ga0182007_10186825
869 Ga0182005_1031288
870 Ga0182005_1063859
871 Ga0163161_10281808
872 Ga0207656_10141964
873 Ga0207656_10421808
874 Ga0207692_10019962
875 Ga0207642_10396104
876 Ga0207642_10420838
877 Ga0207710_10153561
878 Ga0207710_10251122
879 Ga0207688_10073352
880 Ga0207647_10042575
881 Ga0207647_10091063
882 Ga0207685_10037571
883 Ga0207685_10121368
884 Ga0207699_10088389
885 Ga0207699_10302466
886 Ga0207699_10366398
887 Ga0207699_10606804
888 Ga0207699_10956849
889 Ga0207643_10049994
890 Ga0207705_10231529
891 Ga0207684_10031943
892 Ga0207684_10152126
893 Ga0207684_10299511
894 Ga0207684_10416834
895 Ga0207684_10835374
896 Ga0207654_10181910
897 Ga0207654_10306835
898 Ga0207654_10344708
899 Ga0207654_10562653
900 Ga0207654_10800045
901 Ga0207707_10278776
902 Ga0207707_11604663
903 Ga0207695_10025665
904 Ga0207695_10441493
905 Ga0207695_10663641
906 Ga0207695_10868111
907 Ga0207671_10051841
908 Ga0207671_10512028
909 Ga0207671_10707290
910 Ga0207693_10004203
911 Ga0207693_10025164
912 Ga0207693_10030150
913 Ga0207693_10115150
914 Ga0207693_10180963
915 Ga0207693_10723210
916 Ga0207693_11444138
917 Ga0207663_10003064
918 Ga0207663_10080588
919 Ga0207663_10298833
920 Ga0207660_10051655
921 Ga0207660_10147049
922 Ga0207662_10256856
923 Ga0207657_10046009
924 Ga0207657_10373602
925 Ga0207649_10139269
926 Ga0207649_10448194
927 Ga0207649_11084309
928 Ga0207652_10049339
929 Ga0207652_10155301
930 Ga0207646_10969652
931 Ga0207681_11556103
932 Ga0207694_10047336
933 Ga0207650_10000090
934 Ga0207650_10187228
935 Ga0207650_10968537
936 Ga0207687_10539955
937 Ga0207687_10760658
938 Ga0207700_10034688
939 Ga0207700_10105720
940 Ga0207700_10199644
941 Ga0207700_10207450
942 Ga0207700_10444966
943 Ga0207700_10511853
944 Ga0207700_10575438
945 Ga0207700_11311212
946 Ga0207664_10038465
947 Ga0207664_10218836
948 Ga0207664_10248914
949 Ga0207664_10413746
950 Ga0207664_10571955
951 Ga0207664_10613003
952 Ga0207664_11056350
953 Ga0207664_11242909
954 Ga0207644_10533844
955 Ga0207644_10585658
956 Ga0207644_11617973
957 Ga0207706_10321464
958 Ga0207686_10035429
959 Ga0207686_10509983
960 Ga0207709_10449767
961 Ga0207670_10158913
962 Ga0207670_10425451
963 Ga0207670_10956184
964 Ga0207669_10510357
965 Ga0207704_11190370
966 Ga0207665_10001318
967 Ga0207665_10026156
968 Ga0207665_10137953
969 Ga0207665_10295960
970 Ga0207665_10421392
971 Ga0207691_10873347
972 Ga0207691_11144520
973 Ga0207711_10130084
974 Ga0207711_10297825
975 Ga0207711_11437800
976 Ga0207661_10362546
977 Ga0207661_10964349
978 Ga0207679_10004118
979 Ga0207679_10136445
980 Ga0207679_10478546
981 Ga0207667_10001721
982 Ga0207667_10053768
983 Ga0207667_10229668
984 Ga0207667_10812888
985 Ga0207667_10839565
986 Ga0207651_10291396
987 Ga0207651_11365376
988 Ga0207668_11613430
989 Ga0207640_10101538
990 Ga0207640_10147504
991 Ga0207640_11369566
992 Ga0207658_10307247
993 Ga0207677_10080573
994 Ga0207677_10299356
995 Ga0207677_10744372
996 Ga0207703_10025148
997 Ga0207703_11769177
998 Ga0207639_10036614
999 Ga0207678_10170180
1000 Ga0207678_10849149
1001 Ga0207702_10009489
1002 Ga0207702_10233263
1003 Ga0207702_10503770
1004 Ga0207702_10515115
1005 Ga0207702_10895342
1006 Ga0207702_11878424
1007 Ga0207641_10001842
1008 Ga0207641_10131198
1009 Ga0207641_10273188
1010 Ga0207641_10298812
1011 Ga0207641_10814242
1012 Ga0207641_12567392
1013 Ga0207648_10016409
1014 Ga0207648_10621886
1015 Ga0207676_10004619
1016 Ga0207676_10349158
1017 Ga0207676_10803863
1018 Ga0207674_10002922
1019 Ga0207674_10050671
1020 Ga0207674_10108038
1021 Ga0207675_100082245
1022 Ga0207675_100174321
1023 Ga0207683_10465853
1024 Ga0207683_10785995
1025 Ga0207683_11722189
1026 Ga0207698_10218282
1027 Ga0268266_10007211
1028 Ga0268264_10013168
1029 Ga0268264_10056111
1030 Ga0268264_11210933
1031 Ga0265334_10323644
1032 Ga0265338_10034712
1033 Ga0265328_10040337
1034 Ga0265340_10005861
1035 Ga0265339_10141300
1036 Ga0265331_10079153
1037 Ga0265331_10560252
1038 Ga0265316_10053653
1039 Ga0265316_10651946
1040 Ga0265313_10006915
1041 Ga0373926_0171875
1042 Ga0373923_0195418
1043 Ga0373945_0126327
1044 Ga0373943_0029999
1045 Ga0373943_0372011
1046 Ga0373946_0023423
1047 Ga0373931_0144615
1048 Ga0373931_0208785
1049 Ga0373935_0045391
1050 Ga0373935_0723869
1051 Ga0373927_0102407
1052 Ga0373927_0594554
1053 Ga0373933_0497301
1054 Ga0373947_0014130
1055 Ga0373947_0026438
1056 Ga0373937_0136475
1057 Ga0373937_0979479
1058 Ga0373937_1486736
1059 Ga0373925_0003174
1060 Ga0373925_0156612
1061 Ga0373925_0237410
1062 Ga0373925_0802676
1063 Ga0373925_1207197
1064 Ga0395900_0279748
1065 Ga0495603_0174130
1066 Ga0495629_0272332
1067 Ga0495580_0003037
1068 Ga0495580_0007572
1069 Ga0495580_0011978
1070 Ga0495580_0019113
1071 Ga0495580_0060193
1072 Ga0495580_0102817
1073 Ga0495580_0186138
1074 Ga0495582_0004941
1075 Ga0495639_0060211
1076 Ga0495584_0581513
1077 Ga0495630_0818380
1078 Ga0495666_0509971
1079 Ga0495665_0449127
1080 Ga0495586_0376024
1081 Ga0495586_0539714
1082 Ga0495623_0082725
1083 Ga0495658_0336723
1084 Ga0495658_0548640
1085 Ga0495669_0052566
1086 Ga0495624_0383556
1087 Ga0495670_0283758
1088 Ga0495581_0760362
1089 Ga0495674_0123338
1090 Ga0495674_0675887
1091 Ga0495676_0765375
1092 Ga0496100_0803152
1093 Ga0496101_0133921
1094 Ga0496101_0447550
1095 Ga0496102_0009871
1096 Ga0496102_0097754
1097 Ga0496102_1137441
1098 Ga0496103_0410023
1099 Ga0496103_0517751
1100 Ga0496104_0128790
1101 Ga0496104_0953856
1102 Ga0496106_0308372
1103 Ga0496106_0405325
1104 Ga0496106_0574029
1105 Ga0496107_0236602
1106 Ga0496108_0123920
1107 Ga0496108_0640005
1108 Ga0496109_0075967
1109 Ga0496109_0284979
1110 Ga0496109_0429980
1111 Ga0496109_1567118
1112 Ga0496110_0165289
1113 Ga0496110_0515045
1114 Ga0496111_0127274
1115 Ga0496112_0014309
1116 Ga0496112_0104299
1117 Ga0496112_0372105
1118 Ga0496112_0876156
1119 Ga0496113_0038535
1120 Ga0496113_0189997
1121 Ga0496115_0842757
1122 nmdc:mga0rr50_1570129_c1
1123 nmdc:mga08x19_64675_c1
1124 Ga0495601_0572571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gn8-assembly1.cif.gz_B structure of a 48-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.9705 3 53
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.9639 3 53
5gou-assembly1.cif.gz_E structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.9635 3 53
6h5i-assembly1.cif.gz_Aj single particle cryo-em map of human transferrin receptor 1 - h-ferritin complex. 0.9581 4 53
5z8u-assembly1.cif.gz_A human mitochondrial ferritin mutant - c102a/c130a 0.9579 3 53
ID Description Score Start End Superfamily
af_P34445_89_288_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.979 3 53 1.20.1270.60
af_P34586_224_351_1.20.140.90 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Malonyl-CoA decarboxylase, oligemerization domain 0.959 10 50 1.20.140.90
af_Q9VGQ8_135_333_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9534 3 53 1.20.1270.60
af_K7KQ58_1_128_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9316 2 48 1.20.1250.20
5gouO00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9296 3 53 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A353A0S5-F1-model_v4 YdbS-like PH domain-containing protein 1.008 3 50 GO:0016020
AF-K1V6S1-F1-model_v4 Sorting nexin-4 (Autophagy-related protein 24) 0.9946 3 53 GO:0000407
GO:0000422
GO:0005769
GO:0015031
GO:0016020
GO:0032456
GO:0034727
GO:0035091
GO:0061709
AF-A0A0C9UPI9-F1-model_v4 Sorting nexin-4 (Autophagy-related protein 24) 0.994 3 58 GO:0000407
GO:0000422
GO:0005769
GO:0015031
GO:0016020
GO:0032456
GO:0034727
GO:0035091
GO:0061709
AF-A0A0C2G791-F1-model_v4 Arfaptin-like domain protein 0.9938 3 51 GO:0005543
GO:0006886
GO:0019904
GO:0032588
GO:0034315
AF-A0A671Z4A8-F1-model_v4 ArfGAP with SH3 domain, ankyrin repeat and PH domain 1a 0.9923 3 53 GO:0005096
GO:0005737
GO:0046872

Map