F461023

General Info

Members Datasets Scaffolds Average Seq Length
538 217 1076 177

Family's Representative Sequence

Representative Sequence 3300035115|Ga0373941_0148646|Ga0373941_0148646_167_790
Length 207
Sequence MAGGGRHPEHSVGGGFCEGDSPRWDDFMKLISSKEITKNRIFTVTWDHAADPDGFEIERAIVHHRGSAVMMPVDEKGRILLVRQYRLSARQFLWELPAGTVDPGEKPLQTARRELVEETGYRAKKWTKLAEFYPSPGFLTEKMTIYLATGLTAGQAKPMEDERITTRWFTAEDLDEMIRTGKIKDAKTNIGFLRWKRYFAGAGRAGK

Samples

Sample ID Description Type Environment
1 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.67
Nodule 0
Rhizoplane 0.19
Rhizosphere 97.4
Stem 0
Stem Tuber 0
Unclassified 25.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373941_0148646 3300035115 Bacteria 858
2 Ga0070658_10021656 3300005327 Bacteria 5152
3 Ga0070683_100046161 3300005329 Bacteria 4023
4 Ga0070683_100138109 3300005329 Bacteria 2309
5 Ga0070690_100133792 3300005330 Bacteria 1677
6 Ga0068869_100158901 3300005334 Bacteria 1758
7 Ga0070666_10052738 3300005335 Bacteria 2741
8 Ga0070666_10196185 3300005335 Unclassified 1420
9 Ga0070666_10562568 3300005335 Bacteria 830
10 Ga0070680_100002378 3300005336 Bacteria 13909
11 Ga0070680_100414298 3300005336 Bacteria 1149
12 Ga0070682_100432577 3300005337 Unclassified 1003
13 Ga0068868_100155585 3300005338 Bacteria 1885
14 Ga0068868_100177918 3300005338 Unclassified 1763
15 Ga0070660_100098498 3300005339 Bacteria 2314
16 Ga0070660_100209896 3300005339 Bacteria 1581
17 Ga0070689_100231815 3300005340 Bacteria 1518
18 Ga0070689_101000302 3300005340 Unclassified 744
19 Ga0070691_10050894 3300005341 Bacteria 1977
20 Ga0070691_10143046 3300005341 Bacteria 1220
21 Ga0070661_100036342 3300005344 Bacteria 3581
22 Ga0070661_100276861 3300005344 Bacteria 1301
23 Ga0070692_10306596 3300005345 Bacteria 971
24 Ga0070671_100615615 3300005355 Unclassified 939
25 Ga0070674_100259680 3300005356 Unclassified 1368
26 Ga0070674_100490954 3300005356 Unclassified 1021
27 Ga0070674_101451484 3300005356 Bacteria 615
28 Ga0070673_100166333 3300005364 Bacteria 1879
29 Ga0070673_101694820 3300005364 Unclassified 598
30 Ga0070659_100196239 3300005366 Viruses 1660
31 Ga0070667_100074572 3300005367 Unclassified 2895
32 Ga0070667_100454074 3300005367 Unclassified 1171
33 Ga0070709_10022248 3300005434 Bacteria 3705
34 Ga0070709_10165740 3300005434 Bacteria 1540
35 Ga0070709_10806002 3300005434 Bacteria 737
36 Ga0070714_101501480 3300005435 Bacteria 658
37 Ga0070713_100017337 3300005436 Bacteria 5444
38 Ga0070713_100132088 3300005436 Bacteria 2203
39 Ga0070713_100246075 3300005436 Bacteria 1630
40 Ga0070713_100865066 3300005436 Bacteria 868
41 Ga0070713_101357259 3300005436 Unclassified 689
42 Ga0070710_10447459 3300005437 Unclassified 875
43 Ga0070711_100134825 3300005439 Bacteria 1844
44 Ga0070705_100162154 3300005440 Bacteria 1496
45 Ga0070700_100416468 3300005441 Bacteria 1014
46 Ga0070662_100012911 3300005457 Bacteria 5550
47 Ga0070681_10000569 3300005458 Bacteria 30428
48 Ga0070681_10004023 3300005458 Bacteria 13869
49 Ga0070681_10084952 3300005458 Bacteria 3117
50 Ga0070681_10134645 3300005458 Unclassified 2402
51 Ga0070681_10482900 3300005458 Bacteria 1152
52 Ga0070681_10869283 3300005458 Unclassified 820
53 Ga0068867_100021087 3300005459 Bacteria 4647
54 Ga0068867_100218901 3300005459 Unclassified 1533
55 Ga0068867_100381847 3300005459 Bacteria 1183
56 Ga0070685_10715719 3300005466 Bacteria 731
57 Ga0070706_101419628 3300005467 Bacteria 635
58 Ga0070699_100484875 3300005518 Bacteria 1122
59 Ga0070679_100000840 3300005530 Bacteria 26739
60 Ga0070679_100374300 3300005530 Unclassified 1371
61 Ga0070679_100963725 3300005530 Bacteria 797
62 Ga0070684_100109001 3300005535 Bacteria 2481
63 Ga0070684_100238779 3300005535 Bacteria 1660
64 Ga0070684_100287886 3300005535 Bacteria 1506
65 Ga0070684_100288689 3300005535 Bacteria 1504
66 Ga0070697_100269892 3300005536 Bacteria 1458
67 Ga0068853_100157827 3300005539 Bacteria 2045
68 Ga0068853_100381753 3300005539 Unclassified 1316
69 Ga0068853_100397012 3300005539 Bacteria 1290
70 Ga0070672_100244433 3300005543 Bacteria 1510
71 Ga0070686_100296661 3300005544 Bacteria 1197
72 Ga0070695_100072655 3300005545 Bacteria 2256
73 Ga0070695_100157904 3300005545 Bacteria 1589
74 Ga0070665_100004984 3300005548 Bacteria 13774
75 Ga0070665_101549643 3300005548 Unclassified 671
76 Ga0068855_100015833 3300005563 Bacteria 9071
77 Ga0068855_100022164 3300005563 Bacteria 7611
78 Ga0068855_100039593 3300005563 Bacteria 5596
79 Ga0068855_100079538 3300005563 Bacteria 3802
80 Ga0068855_100162958 3300005563 Bacteria 2529
81 Ga0068855_100285434 3300005563 Bacteria 1831
82 Ga0070664_100144918 3300005564 Bacteria 2094
83 Ga0070664_100292151 3300005564 Unclassified 1472
84 Ga0068857_100001968 3300005577 Bacteria 16610
85 Ga0068857_100012396 3300005577 Bacteria 7420
86 Ga0068857_100099620 3300005577 Bacteria 2607
87 Ga0068857_100121734 3300005577 Bacteria 2350
88 Ga0068857_100198234 3300005577 Bacteria 1830
89 Ga0068857_101295290 3300005577 Unclassified 707
90 Ga0068856_100164537 3300005614 Bacteria 2229
91 Ga0068856_100446565 3300005614 Bacteria 1314
92 Ga0068856_100957724 3300005614 Bacteria 874
93 Ga0068856_101232314 3300005614 Bacteria 764
94 Ga0068856_101244676 3300005614 Bacteria 760
95 Ga0070702_100411102 3300005615 Bacteria 971
96 Ga0070702_100543098 3300005615 Unclassified 861
97 Ga0068852_100015536 3300005616 Bacteria 5910
98 Ga0068852_100127057 3300005616 Unclassified 2343
99 Ga0068852_100493077 3300005616 Unclassified 1219
100 Ga0068859_100150924 3300005617 Bacteria 2399
101 Ga0068859_100336407 3300005617 Bacteria 1604
102 Ga0068859_100388665 3300005617 Unclassified 1491
103 Ga0068859_102142979 3300005617 Unclassified 617
104 Ga0068864_101282290 3300005618 Viruses 733
105 Ga0068870_10038549 3300005840 Bacteria 2468
106 Ga0068863_100044238 3300005841 Bacteria 4227
107 Ga0068863_100057672 3300005841 Bacteria 3675
108 Ga0068863_100084439 3300005841 Bacteria 3009
109 Ga0068858_100051711 3300005842 Bacteria 3801
110 Ga0068858_100052611 3300005842 Bacteria 3767
111 Ga0068858_100058432 3300005842 Unclassified 3566
112 Ga0068858_100107948 3300005842 Bacteria 2599
113 Ga0068858_100269123 3300005842 Bacteria 1621
114 Ga0068860_100039616 3300005843 Bacteria 4507
115 Ga0068860_100909839 3300005843 Bacteria 896
116 Ga0068860_101306610 3300005843 Unclassified 746
117 Ga0081539_10035670 3300005985 Unclassified 2985
118 Ga0070717_10105127 3300006028 Unclassified 2403
119 Ga0075368_10065003 3300006042 Bacteria 1465
120 Ga0070712_100517296 3300006175 Unclassified 1002
121 Ga0075367_10035321 3300006178 Bacteria 2893
122 Ga0075369_10079381 3300006186 Bacteria 1454
123 Ga0075366_10242159 3300006195 Unclassified 1100
124 Ga0097621_100018965 3300006237 Bacteria 5272
125 Ga0097621_100035661 3300006237 Bacteria 3976
126 Ga0097621_100235980 3300006237 Bacteria 1597
127 Ga0097621_100321490 3300006237 Unclassified 1371
128 Ga0097621_100392667 3300006237 Unclassified 1241
129 Ga0097621_101376830 3300006237 Viruses 668
130 Ga0097621_101382706 3300006237 Bacteria 666
131 Ga0068871_100005713 3300006358 Bacteria 8733
132 Ga0068871_100009522 3300006358 Bacteria 7047
133 Ga0068871_100033202 3300006358 Unclassified 4084
134 Ga0068871_100179902 3300006358 Bacteria 1817
135 Ga0068871_100269682 3300006358 Unclassified 1487
136 Ga0068871_100712521 3300006358 Unclassified 920
137 Ga0075434_100490694 3300006871 Bacteria 1249
138 Ga0075434_101205599 3300006871 Unclassified 769
139 Ga0068865_100028331 3300006881 Bacteria 3707
140 Ga0068865_100042293 3300006881 Bacteria 3107
141 Ga0075436_100057460 3300006914 Bacteria 2687
142 Ga0097620_100150926 3300006931 Bacteria 2399
143 Ga0097620_100336400 3300006931 Bacteria 1604
144 Ga0097620_100388660 3300006931 Unclassified 1491
145 Ga0097620_102142622 3300006931 Unclassified 617
146 Ga0075435_100545244 3300007076 Bacteria 1004
147 Ga0075435_100682679 3300007076 Bacteria 892
148 Ga0105240_10006975 3300009093 Bacteria 16498
149 Ga0105240_10022789 3300009093 Bacteria 8296
150 Ga0105240_10165047 3300009093 Bacteria 2627
151 Ga0105240_10198034 3300009093 Bacteria 2356
152 Ga0105240_10200469 3300009093 Bacteria 2339
153 Ga0105240_10323275 3300009093 Bacteria 1758
154 Ga0105240_10342898 3300009093 Bacteria 1697
155 Ga0105240_10361989 3300009093 Bacteria 1643
156 Ga0105240_10429885 3300009093 Bacteria 1482
157 Ga0111539_11040034 3300009094 Unclassified 952
158 Ga0105245_10001023 3300009098 Bacteria 25396
159 Ga0105245_10001254 3300009098 Bacteria 22952
160 Ga0105245_10011245 3300009098 Bacteria 7793
161 Ga0105245_10015147 3300009098 Bacteria 6718
162 Ga0105245_10032644 3300009098 Bacteria 4609
163 Ga0105245_10037268 3300009098 Bacteria 4323
164 Ga0105245_10260005 3300009098 Unclassified 1689
165 Ga0105245_10365173 3300009098 Unclassified 1434
166 Ga0105245_10452803 3300009098 Bacteria 1292
167 Ga0105245_10550251 3300009098 Unclassified 1176
168 Ga0105245_10665457 3300009098 Bacteria 1072
169 Ga0105245_10716778 3300009098 Bacteria 1034
170 Ga0105245_11397480 3300009098 Bacteria 750
171 Ga0105245_11900586 3300009098 Unclassified 648
172 Ga0105247_10214680 3300009101 Unclassified 1299
173 Ga0105247_10596928 3300009101 Unclassified 818
174 Ga0105247_10743635 3300009101 Unclassified 743
175 Ga0105247_10862498 3300009101 Unclassified 696
176 Ga0105243_10096006 3300009148 Bacteria 2451
177 Ga0105243_10358767 3300009148 Unclassified 1341
178 Ga0105243_10638708 3300009148 Bacteria 1030
179 Ga0105241_10037313 3300009174 Bacteria 3660
180 Ga0105241_10048360 3300009174 Bacteria 3237
181 Ga0105241_10074100 3300009174 Bacteria 2651
182 Ga0105241_10094511 3300009174 Bacteria 2364
183 Ga0105241_10126470 3300009174 Bacteria 2064
184 Ga0105241_10225458 3300009174 Unclassified 1577
185 Ga0105241_10256650 3300009174 Bacteria 1484
186 Ga0105241_11608578 3300009174 Bacteria 629
187 Ga0105242_10017839 3300009176 Bacteria 5539
188 Ga0105242_10021357 3300009176 Bacteria 5080
189 Ga0105242_10024178 3300009176 Bacteria 4795
190 Ga0105242_10024816 3300009176 Bacteria 4738
191 Ga0105242_10035923 3300009176 Bacteria 3973
192 Ga0105242_10097490 3300009176 Bacteria 2486
193 Ga0105242_10367388 3300009176 Bacteria 1333
194 Ga0105242_10374057 3300009176 Bacteria 1322
195 Ga0105242_10409595 3300009176 Bacteria 1268
196 Ga0105248_10002427 3300009177 Bacteria 20684
197 Ga0105248_10041586 3300009177 Bacteria 5153
198 Ga0105248_10077445 3300009177 Bacteria 3738
199 Ga0105248_10287590 3300009177 Bacteria 1851
200 Ga0105237_10004772 3300009545 Bacteria 15584
201 Ga0105237_10011618 3300009545 Bacteria 9318
202 Ga0105237_10023470 3300009545 Bacteria 6320
203 Ga0105237_10035726 3300009545 Bacteria 5027
204 Ga0105237_10164993 3300009545 Unclassified 2214
205 Ga0105237_10237189 3300009545 Bacteria 1825
206 Ga0105237_10261913 3300009545 Bacteria 1732
207 Ga0105237_10912658 3300009545 Unclassified 885
208 Ga0105237_11447879 3300009545 Unclassified 693
209 Ga0105238_10000748 3300009551 Bacteria 33846
210 Ga0105238_10004155 3300009551 Bacteria 14369
211 Ga0105238_10013307 3300009551 Bacteria 8300
212 Ga0105238_10014034 3300009551 Bacteria 8099
213 Ga0105238_10062230 3300009551 Bacteria 3733
214 Ga0105238_10216008 3300009551 Bacteria 1894
215 Ga0105238_10219159 3300009551 Bacteria 1879
216 Ga0105238_10488375 3300009551 Unclassified 1231
217 Ga0105238_10566174 3300009551 Bacteria 1142
218 Ga0105249_10171986 3300009553 Bacteria 2102
219 Ga0105249_10526974 3300009553 Unclassified 1229
220 Ga0105249_10860701 3300009553 Bacteria 972
221 Ga0105239_10023790 3300010375 Bacteria 6746
222 Ga0105239_10030581 3300010375 Bacteria 5921
223 Ga0105239_10032885 3300010375 Bacteria 5699
224 Ga0105239_10045242 3300010375 Bacteria 4824
225 Ga0105239_10117619 3300010375 Bacteria 2950
226 Ga0105239_10134986 3300010375 Unclassified 2747
227 Ga0105239_10273030 3300010375 Bacteria 1902
228 Ga0105239_10581788 3300010375 Unclassified 1276
229 Ga0105239_10609628 3300010375 Bacteria 1245
230 Ga0105239_10670474 3300010375 Unclassified 1185
231 Ga0105239_10680269 3300010375 Unclassified 1176
232 Ga0105239_11291012 3300010375 Unclassified 842
233 Ga0105239_11676155 3300010375 Unclassified 736
234 Ga0105246_10068375 3300011119 Bacteria 2491
235 Ga0105246_10220662 3300011119 Bacteria 1486
236 Ga0105246_10238316 3300011119 Bacteria 1437
237 Ga0105246_10465418 3300011119 Bacteria 1066
238 Ga0105246_10658439 3300011119 Unclassified 913
239 Ga0157373_10688813 3300013100 Bacteria 748
240 Ga0157370_10003059 3300013104 Bacteria 19840
241 Ga0157370_10005245 3300013104 Bacteria 14575
242 Ga0157370_10049132 3300013104 Bacteria 4039
243 Ga0157370_10166213 3300013104 Unclassified 2052
244 Ga0157370_10313500 3300013104 Bacteria 1447
245 Ga0157369_10002292 3300013105 Bacteria 23011
246 Ga0157369_10006604 3300013105 Bacteria 13416
247 Ga0157369_10035885 3300013105 Bacteria 5435
248 Ga0157369_10318027 3300013105 Bacteria 1618
249 Ga0157369_10414395 3300013105 Bacteria 1397
250 Ga0157369_11102463 3300013105 Unclassified 811
251 Ga0157374_10050065 3300013296 Bacteria 3882
252 Ga0157374_10209186 3300013296 Bacteria 1912
253 Ga0157374_10289793 3300013296 Bacteria 1618
254 Ga0157374_10299305 3300013296 Bacteria 1591
255 Ga0157374_10501631 3300013296 Unclassified 1218
256 Ga0157374_10579588 3300013296 Unclassified 1131
257 Ga0157378_10007063 3300013297 Bacteria 9803
258 Ga0157378_10063339 3300013297 Bacteria 3304
259 Ga0157378_10084993 3300013297 Bacteria 2866
260 Ga0157378_10146764 3300013297 Bacteria 2195
261 Ga0157378_10440082 3300013297 Unclassified 1292
262 Ga0157378_11278712 3300013297 Unclassified 774
263 Ga0163162_10016917 3300013306 Bacteria 7132
264 Ga0163162_10060676 3300013306 Bacteria 3818
265 Ga0163162_10556236 3300013306 Bacteria 1275
266 Ga0163162_10695432 3300013306 Unclassified 1139
267 Ga0163162_10876486 3300013306 Bacteria 1012
268 Ga0163162_12432884 3300013306 Bacteria 602
269 Ga0157372_10003445 3300013307 Bacteria 17066
270 Ga0157372_10010545 3300013307 Bacteria 9830
271 Ga0157372_10090316 3300013307 Bacteria 3482
272 Ga0157372_10332918 3300013307 Bacteria 1768
273 Ga0157372_10376247 3300013307 Bacteria 1655
274 Ga0157375_10005612 3300013308 Bacteria 10923
275 Ga0157375_10035966 3300013308 Unclassified 4732
276 Ga0157375_10513388 3300013308 Bacteria 1362
277 Ga0157375_10613076 3300013308 Unclassified 1247
278 Ga0163163_10022492 3300014325 Bacteria 5971
279 Ga0163163_10093349 3300014325 Bacteria 3026
280 Ga0163163_10245938 3300014325 Bacteria 1839
281 Ga0163163_10346449 3300014325 Bacteria 1541
282 Ga0163163_10391796 3300014325 Bacteria 1447
283 Ga0163163_10518958 3300014325 Bacteria 1254
284 Ga0163163_10819266 3300014325 Unclassified 994
285 Ga0163163_10941004 3300014325 Bacteria 927
286 Ga0163163_11657738 3300014325 Unclassified 700
287 Ga0157380_10038330 3300014326 Unclassified 3720
288 Ga0157380_10892897 3300014326 Bacteria 914
289 Ga0157379_10059796 3300014968 Unclassified 3408
290 Ga0157379_10066472 3300014968 Unclassified 3223
291 Ga0157379_10113841 3300014968 Bacteria 2431
292 Ga0157379_10185203 3300014968 Bacteria 1881
293 Ga0157379_10387822 3300014968 Bacteria 1282
294 Ga0157376_10017973 3300014969 Bacteria 5408
295 Ga0157376_10205836 3300014969 Bacteria 1813
296 Ga0157376_10801010 3300014969 Unclassified 955
297 Ga0163161_10973727 3300017792 Unclassified 723
298 Ga0213875_10015108 3300021388 Bacteria 3759
299 Ga0213875_10072175 3300021388 Unclassified 1611
300 Ga0207680_10016140 3300025903 Bacteria 3913
301 Ga0207680_10277433 3300025903 Unclassified 1164
302 Ga0207680_10733912 3300025903 Bacteria 708
303 Ga0207705_10133433 3300025909 Bacteria 1849
304 Ga0207684_10772873 3300025910 Bacteria 813
305 Ga0207654_10028156 3300025911 Bacteria 3062
306 Ga0207654_10048709 3300025911 Bacteria 2426
307 Ga0207654_10068859 3300025911 Bacteria 2095
308 Ga0207654_10076704 3300025911 Bacteria 2001
309 Ga0207654_10081631 3300025911 Bacteria 1947
310 Ga0207654_10083584 3300025911 Unclassified 1928
311 Ga0207654_10145394 3300025911 Bacteria 1516
312 Ga0207707_10012079 3300025912 Bacteria 7510
313 Ga0207707_10012837 3300025912 Bacteria 7288
314 Ga0207707_10184452 3300025912 Bacteria 1821
315 Ga0207707_10393895 3300025912 Bacteria 1190
316 Ga0207707_10419608 3300025912 Unclassified 1147
317 Ga0207695_10000597 3300025913 Bacteria 72390
318 Ga0207695_10033536 3300025913 Bacteria 5598
319 Ga0207695_10089537 3300025913 Bacteria 3094
320 Ga0207695_10130141 3300025913 Bacteria 2475
321 Ga0207695_10402904 3300025913 Bacteria 1252
322 Ga0207671_10017070 3300025914 Bacteria 5612
323 Ga0207671_10033570 3300025914 Bacteria 3816
324 Ga0207671_10055669 3300025914 Bacteria 2930
325 Ga0207671_10369685 3300025914 Unclassified 1138
326 Ga0207693_10375808 3300025915 Bacteria 1112
327 Ga0207663_10103221 3300025916 Bacteria 1920
328 Ga0207660_10006515 3300025917 Bacteria 7574
329 Ga0207660_10171273 3300025917 Bacteria 1681
330 Ga0207657_10000879 3300025919 Bacteria 31764
331 Ga0207657_10097094 3300025919 Bacteria 2450
332 Ga0207657_10723531 3300025919 Unclassified 772
333 Ga0207649_10024044 3300025920 Bacteria 3536
334 Ga0207649_10052101 3300025920 Bacteria 2538
335 Ga0207652_10000972 3300025921 Bacteria 26766
336 Ga0207652_10345241 3300025921 Unclassified 1344
337 Ga0207652_11046323 3300025921 Bacteria 716
338 Ga0207681_10353822 3300025923 Bacteria 1176
339 Ga0207694_10000375 3300025924 Bacteria 41549
340 Ga0207694_10021258 3300025924 Bacteria 4916
341 Ga0207694_10055217 3300025924 Bacteria 3083
342 Ga0207694_10058456 3300025924 Bacteria 2999
343 Ga0207694_10203722 3300025924 Unclassified 1610
344 Ga0207687_10003346 3300025927 Bacteria 10834
345 Ga0207687_10007990 3300025927 Bacteria 6926
346 Ga0207687_10067782 3300025927 Unclassified 2540
347 Ga0207687_10114097 3300025927 Unclassified 2011
348 Ga0207687_10255480 3300025927 Unclassified 1395
349 Ga0207687_10261848 3300025927 Bacteria 1379
350 Ga0207687_10395469 3300025927 Unclassified 1135
351 Ga0207687_10490850 3300025927 Bacteria 1024
352 Ga0207687_10508569 3300025927 Unclassified 1006
353 Ga0207700_10032107 3300025928 Bacteria 3741
354 Ga0207700_10109263 3300025928 Bacteria 2222
355 Ga0207700_10476430 3300025928 Unclassified 1102
356 Ga0207700_10602121 3300025928 Bacteria 978
357 Ga0207690_10204824 3300025932 Bacteria 1501
358 Ga0207706_10010093 3300025933 Bacteria 8648
359 Ga0207686_10003448 3300025934 Bacteria 8492
360 Ga0207686_10004613 3300025934 Bacteria 7383
361 Ga0207686_10005625 3300025934 Bacteria 6717
362 Ga0207686_10012120 3300025934 Bacteria 4737
363 Ga0207686_10033228 3300025934 Bacteria 3077
364 Ga0207686_10064061 3300025934 Bacteria 2340
365 Ga0207686_10070347 3300025934 Bacteria 2248
366 Ga0207686_10174727 3300025934 Bacteria 1518
367 Ga0207686_10212871 3300025934 Unclassified 1390
368 Ga0207686_10362555 3300025934 Unclassified 1094
369 Ga0207686_10700870 3300025934 Unclassified 805
370 Ga0207709_10084605 3300025935 Bacteria 2054
371 Ga0207709_10165348 3300025935 Unclassified 1547
372 Ga0207709_10283165 3300025935 Bacteria 1225
373 Ga0207670_10634989 3300025936 Bacteria 879
374 Ga0207669_10343755 3300025937 Unclassified 1150
375 Ga0207669_10444311 3300025937 Bacteria 1026
376 Ga0207704_10219059 3300025938 Bacteria 1407
377 Ga0207704_10259368 3300025938 Bacteria 1310
378 Ga0207704_10620036 3300025938 Bacteria 888
379 Ga0207704_11052420 3300025938 Bacteria 690
380 Ga0207711_10011020 3300025941 Bacteria 7511
381 Ga0207711_10186176 3300025941 Bacteria 1890
382 Ga0207711_10263721 3300025941 Bacteria 1584
383 Ga0207689_10138106 3300025942 Bacteria 2007
384 Ga0207661_10002605 3300025944 Bacteria 12415
385 Ga0207661_10009145 3300025944 Bacteria 7103
386 Ga0207661_10110693 3300025944 Bacteria 2322
387 Ga0207661_10227095 3300025944 Bacteria 1652
388 Ga0207661_10287918 3300025944 Unclassified 1470
389 Ga0207661_10299451 3300025944 Unclassified 1441
390 Ga0207661_11028164 3300025944 Unclassified 759
391 Ga0207661_11643263 3300025944 Unclassified 587
392 Ga0207679_10534567 3300025945 Unclassified 1050
393 Ga0207667_10051167 3300025949 Unclassified 4356
394 Ga0207667_10074017 3300025949 Bacteria 3538
395 Ga0207667_10075359 3300025949 Bacteria 3503
396 Ga0207667_10132226 3300025949 Bacteria 2570
397 Ga0207667_10144641 3300025949 Bacteria 2448
398 Ga0207651_11547563 3300025960 Viruses 597
399 Ga0207712_10348972 3300025961 Unclassified 1229
400 Ga0207640_10190598 3300025981 Unclassified 1545
401 Ga0207658_10132677 3300025986 Bacteria 2003
402 Ga0207658_10271868 3300025986 Unclassified 1449
403 Ga0207677_10017340 3300026023 Bacteria 4290
404 Ga0207677_10118177 3300026023 Bacteria 1989
405 Ga0207677_10879768 3300026023 Unclassified 806
406 Ga0207703_10016430 3300026035 Bacteria 5771
407 Ga0207703_10025584 3300026035 Bacteria 4642
408 Ga0207703_10570343 3300026035 Unclassified 1068
409 Ga0207639_10077495 3300026041 Bacteria 2621
410 Ga0207639_10127950 3300026041 Bacteria 2098
411 Ga0207639_10353161 3300026041 Unclassified 1313
412 Ga0207639_10485949 3300026041 Bacteria 1126
413 Ga0207702_10014734 3300026078 Bacteria 6485
414 Ga0207702_10078337 3300026078 Bacteria 2861
415 Ga0207702_10114960 3300026078 Bacteria 2399
416 Ga0207702_10424809 3300026078 Bacteria 1286
417 Ga0207702_10501698 3300026078 Unclassified 1183
418 Ga0207641_10032715 3300026088 Bacteria 4319
419 Ga0207641_10213193 3300026088 Unclassified 1787
420 Ga0207641_10723154 3300026088 Unclassified 981
421 Ga0207648_10030512 3300026089 Bacteria 4774
422 Ga0207648_10191615 3300026089 Bacteria 1812
423 Ga0207648_10284340 3300026089 Unclassified 1480
424 Ga0207648_10704858 3300026089 Unclassified 936
425 Ga0207676_10014679 3300026095 Bacteria 5642
426 Ga0207676_10145009 3300026095 Unclassified 2038
427 Ga0207676_11251345 3300026095 Unclassified 736
428 Ga0207674_10000544 3300026116 Bacteria 49416
429 Ga0207674_10001922 3300026116 Bacteria 26373
430 Ga0207674_10005231 3300026116 Bacteria 15448
431 Ga0207674_10040133 3300026116 Bacteria 4851
432 Ga0207674_10062999 3300026116 Bacteria 3744
433 Ga0207683_11308475 3300026121 Unclassified 671
434 Ga0207698_10005116 3300026142 Bacteria 8059
435 Ga0268266_10144619 3300028379 Unclassified 2136
436 Ga0268265_11331480 3300028380 Bacteria 719
437 Ga0268264_10110470 3300028381 Bacteria 2407
438 Ga0268264_10214765 3300028381 Bacteria 1768
439 Ga0268264_10355298 3300028381 Bacteria 1396
440 Ga0268264_10919129 3300028381 Bacteria 879
441 Ga0265338_10607509 3300028800 Unclassified 761
442 Ga0265330_10088951 3300031235 Bacteria 1327
443 Ga0265332_10058527 3300031238 Bacteria 1649
444 Ga0265325_10216548 3300031241 Unclassified 878
445 Ga0265340_10074645 3300031247 Bacteria 1603
446 Ga0265331_10163390 3300031250 Unclassified 1009
447 Ga0265313_10013151 3300031595 Bacteria 4988
448 Ga0265314_10002227 3300031711 Bacteria 20176
449 Ga0265314_10003252 3300031711 Bacteria 15884
450 Ga0265314_10038060 3300031711 Bacteria 3479
451 Ga0265314_10298494 3300031711 Unclassified 905
452 Ga0265314_10468918 3300031711 Unclassified 668
453 Ga0265342_10258873 3300031712 Unclassified 926
454 Ga0307409_101435917 3300031995 Bacteria 717
455 Ga0373923_0077488 3300035111 Bacteria 1437
456 Ga0373936_0274958 3300035113 Unclassified 756
457 Ga0373954_0000262 3300035118 Bacteria 18999
458 Ga0373954_0007157 3300035118 Bacteria 4872
459 Ga0373943_0196931 3300035170 Bacteria 1114
460 Ga0373955_0010837 3300035172 Bacteria 4323
461 Ga0373955_0205768 3300035172 Bacteria 1172
462 Ga0373935_0097816 3300035692 Bacteria 1931
463 Ga0373927_0006169 3300035695 Bacteria 8193
464 Ga0373927_0326095 3300035695 Bacteria 1011
465 Ga0373933_0278224 3300035724 Unclassified 1081
466 Ga0373947_0061624 3300035725 Bacteria 2280
467 Ga0373937_0010662 3300036401 Bacteria 8036
468 Ga0373937_0219793 3300036401 Unclassified 1788
469 Ga0373937_0773424 3300036401 Unclassified 908
470 Ga0373925_0081454 3300037068 Bacteria 2461
471 Ga0436364_1344305 3300037853 Bacteria 4565
472 Ga0436364_1352220 3300037853 Unclassified 1561
473 Ga0451576_0274723 3300045051 Bacteria 1762
474 Ga0495592_0520145 3300046454 Unclassified 736
475 Ga0495651_0130738 3300046462 Bacteria 1833
476 Ga0495580_0295918 3300046472 Bacteria 1103
477 Ga0495580_0535997 3300046472 Unclassified 778
478 Ga0495580_0639044 3300046472 Bacteria 701
479 Ga0495582_0006449 3300046473 Bacteria 6517
480 Ga0495664_0200006 3300046477 Bacteria 1211
481 Ga0495594_0026713 3300046499 Bacteria 3108
482 Ga0495594_0130348 3300046499 Bacteria 1424
483 Ga0495666_0223476 3300046526 Bacteria 862
484 Ga0495652_0028792 3300046529 Bacteria 4884
485 Ga0495652_0109742 3300046529 Bacteria 2221
486 Ga0495665_0027529 3300046531 Bacteria 3051
487 Ga0495587_0023612 3300046536 Bacteria 3778
488 Ga0495587_0286389 3300046536 Bacteria 923
489 Ga0495645_0131047 3300046543 Bacteria 1757
490 Ga0495667_0087679 3300046559 Bacteria 2018
491 Ga0495635_0367236 3300046663 Unclassified 959
492 Ga0495635_0581880 3300046663 Bacteria 732
493 Ga0495658_0191362 3300046683 Bacteria 1272
494 Ga0495589_0334165 3300046794 Bacteria 699
495 Ga0495636_0387168 3300047318 Bacteria 664
496 Ga0495674_0281264 3300047319 Unclassified 1363
497 Ga0495674_1248372 3300047319 Unclassified 560
498 Ga0495675_0704788 3300047444 Unclassified 565
499 Ga0495684_0099150 3300047471 Bacteria 2203
500 Ga0495684_0638925 3300047471 Unclassified 713
501 Ga0495602_0018739 3300048088 Bacteria 6899
502 Ga0496102_0263481 3300048905 Bacteria 1625
503 Ga0501033_0156424 3300049570 Bacteria 1642
504 Ga0501036_0037927 3300049572 Bacteria 4077
505 Ga0501038_0039774 3300049574 Bacteria 4113
506 Ga0501039_0014019 3300049575 Bacteria 6133
507 Ga0501040_0002171 3300049576 Bacteria 12653
508 Ga0501041_0000494 3300049577 Bacteria 20217
509 Ga0501042_0001048 3300049578 Bacteria 15764
510 Ga0501043_0106752 3300049579 Bacteria 2199
511 Ga0501046_0033258 3300049580 Bacteria 4168
512 Ga0501048_0018725 3300049582 Bacteria 5090
513 Ga0501068_0152002 3300049584 Bacteria 1455
514 Ga0501071_0014360 3300049587 Bacteria 5415
515 Ga0501072_0019962 3300049588 Bacteria 5187
516 Ga0501075_0004054 3300049591 Bacteria 9885
517 Ga0501076_0002897 3300049592 Bacteria 11881
518 Ga0501079_0237041 3300049741 Bacteria 1425
519 Ga0501080_0072114 3300049742 Bacteria 3213
520 Ga0501081_0005443 3300049743 Bacteria 8215
521 Ga0501083_0461204 3300049744 Bacteria 827
522 Ga0501268_020846 3300049765 Bacteria 1120
523 Ga0501045_0002274 3300049824 Bacteria 13017
524 nmdc:mga0k408_87055_c1 3300050493 Unclassified 1834
525 nmdc:mga06z11_48278_c1 3300050494 Bacteria 2166
526 nmdc:mga04h51_40309_c1 3300050495 Bacteria 1521
527 nmdc:mga07m45_49023_c1 3300050496 Bacteria 2376
528 nmdc:mga08y16_1086064_c1 3300050511 Bacteria 776
529 nmdc:mga0n895_1045597_c1 3300050512 Unclassified 796
530 nmdc:mga0n895_595940_c1 3300050512 Bacteria 1108
531 nmdc:mga0rr50_659535_c1 3300050513 Bacteria 893
532 nmdc:mga08x19_270964_c1 3300050514 Bacteria 1175
533 Ga0495619_0233674 3300053085 Bacteria 1274
534 Ga0495619_0352022 3300053085 Bacteria 1019
535 Ga0500568_0010318 3300053139 Bacteria 4380
536 Ga0501084_0059067 3300054114 Bacteria 3209
537 Ga0501082_0001822 3300060353 Bacteria 18778
538 Ga0530510_0006142 3300061734 Bacteria 8342
539 Ga0373941_0148646
540 Ga0070658_10021656
541 Ga0070683_100046161
542 Ga0070683_100138109
543 Ga0070690_100133792
544 Ga0068869_100158901
545 Ga0070666_10052738
546 Ga0070666_10196185
547 Ga0070666_10562568
548 Ga0070680_100002378
549 Ga0070680_100414298
550 Ga0070682_100432577
551 Ga0068868_100155585
552 Ga0068868_100177918
553 Ga0070660_100098498
554 Ga0070660_100209896
555 Ga0070689_100231815
556 Ga0070689_101000302
557 Ga0070691_10050894
558 Ga0070691_10143046
559 Ga0070661_100036342
560 Ga0070661_100276861
561 Ga0070692_10306596
562 Ga0070671_100615615
563 Ga0070674_100259680
564 Ga0070674_100490954
565 Ga0070674_101451484
566 Ga0070673_100166333
567 Ga0070673_101694820
568 Ga0070659_100196239
569 Ga0070667_100074572
570 Ga0070667_100454074
571 Ga0070709_10022248
572 Ga0070709_10165740
573 Ga0070709_10806002
574 Ga0070714_101501480
575 Ga0070713_100017337
576 Ga0070713_100132088
577 Ga0070713_100246075
578 Ga0070713_100865066
579 Ga0070713_101357259
580 Ga0070710_10447459
581 Ga0070711_100134825
582 Ga0070705_100162154
583 Ga0070700_100416468
584 Ga0070662_100012911
585 Ga0070681_10000569
586 Ga0070681_10004023
587 Ga0070681_10084952
588 Ga0070681_10134645
589 Ga0070681_10482900
590 Ga0070681_10869283
591 Ga0068867_100021087
592 Ga0068867_100218901
593 Ga0068867_100381847
594 Ga0070685_10715719
595 Ga0070706_101419628
596 Ga0070699_100484875
597 Ga0070679_100000840
598 Ga0070679_100374300
599 Ga0070679_100963725
600 Ga0070684_100109001
601 Ga0070684_100238779
602 Ga0070684_100287886
603 Ga0070684_100288689
604 Ga0070697_100269892
605 Ga0068853_100157827
606 Ga0068853_100381753
607 Ga0068853_100397012
608 Ga0070672_100244433
609 Ga0070686_100296661
610 Ga0070695_100072655
611 Ga0070695_100157904
612 Ga0070665_100004984
613 Ga0070665_101549643
614 Ga0068855_100015833
615 Ga0068855_100022164
616 Ga0068855_100039593
617 Ga0068855_100079538
618 Ga0068855_100162958
619 Ga0068855_100285434
620 Ga0070664_100144918
621 Ga0070664_100292151
622 Ga0068857_100001968
623 Ga0068857_100012396
624 Ga0068857_100099620
625 Ga0068857_100121734
626 Ga0068857_100198234
627 Ga0068857_101295290
628 Ga0068856_100164537
629 Ga0068856_100446565
630 Ga0068856_100957724
631 Ga0068856_101232314
632 Ga0068856_101244676
633 Ga0070702_100411102
634 Ga0070702_100543098
635 Ga0068852_100015536
636 Ga0068852_100127057
637 Ga0068852_100493077
638 Ga0068859_100150924
639 Ga0068859_100336407
640 Ga0068859_100388665
641 Ga0068859_102142979
642 Ga0068864_101282290
643 Ga0068870_10038549
644 Ga0068863_100044238
645 Ga0068863_100057672
646 Ga0068863_100084439
647 Ga0068858_100051711
648 Ga0068858_100052611
649 Ga0068858_100058432
650 Ga0068858_100107948
651 Ga0068858_100269123
652 Ga0068860_100039616
653 Ga0068860_100909839
654 Ga0068860_101306610
655 Ga0081539_10035670
656 Ga0070717_10105127
657 Ga0075368_10065003
658 Ga0070712_100517296
659 Ga0075367_10035321
660 Ga0075369_10079381
661 Ga0075366_10242159
662 Ga0097621_100018965
663 Ga0097621_100035661
664 Ga0097621_100235980
665 Ga0097621_100321490
666 Ga0097621_100392667
667 Ga0097621_101376830
668 Ga0097621_101382706
669 Ga0068871_100005713
670 Ga0068871_100009522
671 Ga0068871_100033202
672 Ga0068871_100179902
673 Ga0068871_100269682
674 Ga0068871_100712521
675 Ga0075434_100490694
676 Ga0075434_101205599
677 Ga0068865_100028331
678 Ga0068865_100042293
679 Ga0075436_100057460
680 Ga0097620_100150926
681 Ga0097620_100336400
682 Ga0097620_100388660
683 Ga0097620_102142622
684 Ga0075435_100545244
685 Ga0075435_100682679
686 Ga0105240_10006975
687 Ga0105240_10022789
688 Ga0105240_10165047
689 Ga0105240_10198034
690 Ga0105240_10200469
691 Ga0105240_10323275
692 Ga0105240_10342898
693 Ga0105240_10361989
694 Ga0105240_10429885
695 Ga0111539_11040034
696 Ga0105245_10001023
697 Ga0105245_10001254
698 Ga0105245_10011245
699 Ga0105245_10015147
700 Ga0105245_10032644
701 Ga0105245_10037268
702 Ga0105245_10260005
703 Ga0105245_10365173
704 Ga0105245_10452803
705 Ga0105245_10550251
706 Ga0105245_10665457
707 Ga0105245_10716778
708 Ga0105245_11397480
709 Ga0105245_11900586
710 Ga0105247_10214680
711 Ga0105247_10596928
712 Ga0105247_10743635
713 Ga0105247_10862498
714 Ga0105243_10096006
715 Ga0105243_10358767
716 Ga0105243_10638708
717 Ga0105241_10037313
718 Ga0105241_10048360
719 Ga0105241_10074100
720 Ga0105241_10094511
721 Ga0105241_10126470
722 Ga0105241_10225458
723 Ga0105241_10256650
724 Ga0105241_11608578
725 Ga0105242_10017839
726 Ga0105242_10021357
727 Ga0105242_10024178
728 Ga0105242_10024816
729 Ga0105242_10035923
730 Ga0105242_10097490
731 Ga0105242_10367388
732 Ga0105242_10374057
733 Ga0105242_10409595
734 Ga0105248_10002427
735 Ga0105248_10041586
736 Ga0105248_10077445
737 Ga0105248_10287590
738 Ga0105237_10004772
739 Ga0105237_10011618
740 Ga0105237_10023470
741 Ga0105237_10035726
742 Ga0105237_10164993
743 Ga0105237_10237189
744 Ga0105237_10261913
745 Ga0105237_10912658
746 Ga0105237_11447879
747 Ga0105238_10000748
748 Ga0105238_10004155
749 Ga0105238_10013307
750 Ga0105238_10014034
751 Ga0105238_10062230
752 Ga0105238_10216008
753 Ga0105238_10219159
754 Ga0105238_10488375
755 Ga0105238_10566174
756 Ga0105249_10171986
757 Ga0105249_10526974
758 Ga0105249_10860701
759 Ga0105239_10023790
760 Ga0105239_10030581
761 Ga0105239_10032885
762 Ga0105239_10045242
763 Ga0105239_10117619
764 Ga0105239_10134986
765 Ga0105239_10273030
766 Ga0105239_10581788
767 Ga0105239_10609628
768 Ga0105239_10670474
769 Ga0105239_10680269
770 Ga0105239_11291012
771 Ga0105239_11676155
772 Ga0105246_10068375
773 Ga0105246_10220662
774 Ga0105246_10238316
775 Ga0105246_10465418
776 Ga0105246_10658439
777 Ga0157373_10688813
778 Ga0157370_10003059
779 Ga0157370_10005245
780 Ga0157370_10049132
781 Ga0157370_10166213
782 Ga0157370_10313500
783 Ga0157369_10002292
784 Ga0157369_10006604
785 Ga0157369_10035885
786 Ga0157369_10318027
787 Ga0157369_10414395
788 Ga0157369_11102463
789 Ga0157374_10050065
790 Ga0157374_10209186
791 Ga0157374_10289793
792 Ga0157374_10299305
793 Ga0157374_10501631
794 Ga0157374_10579588
795 Ga0157378_10007063
796 Ga0157378_10063339
797 Ga0157378_10084993
798 Ga0157378_10146764
799 Ga0157378_10440082
800 Ga0157378_11278712
801 Ga0163162_10016917
802 Ga0163162_10060676
803 Ga0163162_10556236
804 Ga0163162_10695432
805 Ga0163162_10876486
806 Ga0163162_12432884
807 Ga0157372_10003445
808 Ga0157372_10010545
809 Ga0157372_10090316
810 Ga0157372_10332918
811 Ga0157372_10376247
812 Ga0157375_10005612
813 Ga0157375_10035966
814 Ga0157375_10513388
815 Ga0157375_10613076
816 Ga0163163_10022492
817 Ga0163163_10093349
818 Ga0163163_10245938
819 Ga0163163_10346449
820 Ga0163163_10391796
821 Ga0163163_10518958
822 Ga0163163_10819266
823 Ga0163163_10941004
824 Ga0163163_11657738
825 Ga0157380_10038330
826 Ga0157380_10892897
827 Ga0157379_10059796
828 Ga0157379_10066472
829 Ga0157379_10113841
830 Ga0157379_10185203
831 Ga0157379_10387822
832 Ga0157376_10017973
833 Ga0157376_10205836
834 Ga0157376_10801010
835 Ga0163161_10973727
836 Ga0213875_10015108
837 Ga0213875_10072175
838 Ga0207680_10016140
839 Ga0207680_10277433
840 Ga0207680_10733912
841 Ga0207705_10133433
842 Ga0207684_10772873
843 Ga0207654_10028156
844 Ga0207654_10048709
845 Ga0207654_10068859
846 Ga0207654_10076704
847 Ga0207654_10081631
848 Ga0207654_10083584
849 Ga0207654_10145394
850 Ga0207707_10012079
851 Ga0207707_10012837
852 Ga0207707_10184452
853 Ga0207707_10393895
854 Ga0207707_10419608
855 Ga0207695_10000597
856 Ga0207695_10033536
857 Ga0207695_10089537
858 Ga0207695_10130141
859 Ga0207695_10402904
860 Ga0207671_10017070
861 Ga0207671_10033570
862 Ga0207671_10055669
863 Ga0207671_10369685
864 Ga0207693_10375808
865 Ga0207663_10103221
866 Ga0207660_10006515
867 Ga0207660_10171273
868 Ga0207657_10000879
869 Ga0207657_10097094
870 Ga0207657_10723531
871 Ga0207649_10024044
872 Ga0207649_10052101
873 Ga0207652_10000972
874 Ga0207652_10345241
875 Ga0207652_11046323
876 Ga0207681_10353822
877 Ga0207694_10000375
878 Ga0207694_10021258
879 Ga0207694_10055217
880 Ga0207694_10058456
881 Ga0207694_10203722
882 Ga0207687_10003346
883 Ga0207687_10007990
884 Ga0207687_10067782
885 Ga0207687_10114097
886 Ga0207687_10255480
887 Ga0207687_10261848
888 Ga0207687_10395469
889 Ga0207687_10490850
890 Ga0207687_10508569
891 Ga0207700_10032107
892 Ga0207700_10109263
893 Ga0207700_10476430
894 Ga0207700_10602121
895 Ga0207690_10204824
896 Ga0207706_10010093
897 Ga0207686_10003448
898 Ga0207686_10004613
899 Ga0207686_10005625
900 Ga0207686_10012120
901 Ga0207686_10033228
902 Ga0207686_10064061
903 Ga0207686_10070347
904 Ga0207686_10174727
905 Ga0207686_10212871
906 Ga0207686_10362555
907 Ga0207686_10700870
908 Ga0207709_10084605
909 Ga0207709_10165348
910 Ga0207709_10283165
911 Ga0207670_10634989
912 Ga0207669_10343755
913 Ga0207669_10444311
914 Ga0207704_10219059
915 Ga0207704_10259368
916 Ga0207704_10620036
917 Ga0207704_11052420
918 Ga0207711_10011020
919 Ga0207711_10186176
920 Ga0207711_10263721
921 Ga0207689_10138106
922 Ga0207661_10002605
923 Ga0207661_10009145
924 Ga0207661_10110693
925 Ga0207661_10227095
926 Ga0207661_10287918
927 Ga0207661_10299451
928 Ga0207661_11028164
929 Ga0207661_11643263
930 Ga0207679_10534567
931 Ga0207667_10051167
932 Ga0207667_10074017
933 Ga0207667_10075359
934 Ga0207667_10132226
935 Ga0207667_10144641
936 Ga0207651_11547563
937 Ga0207712_10348972
938 Ga0207640_10190598
939 Ga0207658_10132677
940 Ga0207658_10271868
941 Ga0207677_10017340
942 Ga0207677_10118177
943 Ga0207677_10879768
944 Ga0207703_10016430
945 Ga0207703_10025584
946 Ga0207703_10570343
947 Ga0207639_10077495
948 Ga0207639_10127950
949 Ga0207639_10353161
950 Ga0207639_10485949
951 Ga0207702_10014734
952 Ga0207702_10078337
953 Ga0207702_10114960
954 Ga0207702_10424809
955 Ga0207702_10501698
956 Ga0207641_10032715
957 Ga0207641_10213193
958 Ga0207641_10723154
959 Ga0207648_10030512
960 Ga0207648_10191615
961 Ga0207648_10284340
962 Ga0207648_10704858
963 Ga0207676_10014679
964 Ga0207676_10145009
965 Ga0207676_11251345
966 Ga0207674_10000544
967 Ga0207674_10001922
968 Ga0207674_10005231
969 Ga0207674_10040133
970 Ga0207674_10062999
971 Ga0207683_11308475
972 Ga0207698_10005116
973 Ga0268266_10144619
974 Ga0268265_11331480
975 Ga0268264_10110470
976 Ga0268264_10214765
977 Ga0268264_10355298
978 Ga0268264_10919129
979 Ga0265338_10607509
980 Ga0265330_10088951
981 Ga0265332_10058527
982 Ga0265325_10216548
983 Ga0265340_10074645
984 Ga0265331_10163390
985 Ga0265313_10013151
986 Ga0265314_10002227
987 Ga0265314_10003252
988 Ga0265314_10038060
989 Ga0265314_10298494
990 Ga0265314_10468918
991 Ga0265342_10258873
992 Ga0307409_101435917
993 Ga0373923_0077488
994 Ga0373936_0274958
995 Ga0373954_0000262
996 Ga0373954_0007157
997 Ga0373943_0196931
998 Ga0373955_0010837
999 Ga0373955_0205768
1000 Ga0373935_0097816
1001 Ga0373927_0006169
1002 Ga0373927_0326095
1003 Ga0373933_0278224
1004 Ga0373947_0061624
1005 Ga0373937_0010662
1006 Ga0373937_0219793
1007 Ga0373937_0773424
1008 Ga0373925_0081454
1009 Ga0436364_1344305
1010 Ga0436364_1352220
1011 Ga0451576_0274723
1012 Ga0495592_0520145
1013 Ga0495651_0130738
1014 Ga0495580_0295918
1015 Ga0495580_0535997
1016 Ga0495580_0639044
1017 Ga0495582_0006449
1018 Ga0495664_0200006
1019 Ga0495594_0026713
1020 Ga0495594_0130348
1021 Ga0495666_0223476
1022 Ga0495652_0028792
1023 Ga0495652_0109742
1024 Ga0495665_0027529
1025 Ga0495587_0023612
1026 Ga0495587_0286389
1027 Ga0495645_0131047
1028 Ga0495667_0087679
1029 Ga0495635_0367236
1030 Ga0495635_0581880
1031 Ga0495658_0191362
1032 Ga0495589_0334165
1033 Ga0495636_0387168
1034 Ga0495674_0281264
1035 Ga0495674_1248372
1036 Ga0495675_0704788
1037 Ga0495684_0099150
1038 Ga0495684_0638925
1039 Ga0495602_0018739
1040 Ga0496102_0263481
1041 Ga0501033_0156424
1042 Ga0501036_0037927
1043 Ga0501038_0039774
1044 Ga0501039_0014019
1045 Ga0501040_0002171
1046 Ga0501041_0000494
1047 Ga0501042_0001048
1048 Ga0501043_0106752
1049 Ga0501046_0033258
1050 Ga0501048_0018725
1051 Ga0501068_0152002
1052 Ga0501071_0014360
1053 Ga0501072_0019962
1054 Ga0501075_0004054
1055 Ga0501076_0002897
1056 Ga0501079_0237041
1057 Ga0501080_0072114
1058 Ga0501081_0005443
1059 Ga0501083_0461204
1060 Ga0501268_020846
1061 Ga0501045_0002274
1062 nmdc:mga0k408_87055_c1
1063 nmdc:mga06z11_48278_c1
1064 nmdc:mga04h51_40309_c1
1065 nmdc:mga07m45_49023_c1
1066 nmdc:mga08y16_1086064_c1
1067 nmdc:mga0n895_1045597_c1
1068 nmdc:mga0n895_595940_c1
1069 nmdc:mga0rr50_659535_c1
1070 nmdc:mga08x19_270964_c1
1071 Ga0495619_0233674
1072 Ga0495619_0352022
1073 Ga0500568_0010318
1074 Ga0501084_0059067
1075 Ga0501082_0001822
1076 Ga0530510_0006142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

62

195

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9576 1 169
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9551 2 171
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9531 2 171
5i8u-assembly2.cif.gz_A crystal structure of the rv1700 (mt adprase) e142q mutant 0.9447 2 169
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9429 2 169
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.955 2 171 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9511 2 170 3.90.79.10
5i8uB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9308 1 174 3.90.79.10
2w4eB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9241 40 170 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9234 2 171 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7C7QIN9-F1-model_v4 NUDIX hydrolase 0.9825 34 170 GO:0006753
GO:0016787
GO:0019693
AF-W0DYU0-F1-model_v4 GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) 0.9793 2 170 GO:0005829
GO:0006753
GO:0016462
GO:0019693
AF-A0A7G8BLA5-F1-model_v4 NUDIX hydrolase 0.9791 2 171 GO:0006753
GO:0016462
GO:0019693
AF-A0A3B8ZFL4-F1-model_v4 NUDIX hydrolase 0.9784 42 171 GO:0006753
GO:0016787
GO:0019693
AF-A0A356M7R1-F1-model_v4 ADP-ribose pyrophosphatase 0.9774 2 170 GO:0006753
GO:0016462
GO:0019693

Map