F456350

General Info

Members Datasets Scaffolds Average Seq Length
505 175 1010 322

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10078810|Ga0105240_100788102
Length 329
Sequence MGHTAMTIALISLLISTSITGVAYWLYQRRSQSSEITKVRRRLGVETEAERLAESEIPALIRSAARREPWWLLNVGSHLRINERLQLLIESSGVQSTPERVQKECAVAAVLAGVVVLIAGNQWTALAALPAAIMAAFLPIKRLRRCARKRLARFEAQFPGALEFIARSMRAGHAFSISLEMLHRECDQPLAGEFRRVYEEQNLGMPLDAALTRLASRVHLIDVQFFVSAVVLQRRTGGNLTEILDTLAEVIRERYKLKGKVKAISAHGRMTSKALSAIPIVVGGLMFMVNKEYTTFFFHTTTGLEMLAASAALQILAYVVINKIVTIEV

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 0.4
Rhizosphere 99.21
Stem 0
Stem Tuber 0
Unclassified 9.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10078810 3300009093 Bacteria 4056
2 Ga0070658_10004689 3300005327 Bacteria 11114
3 Ga0070658_10073125 3300005327 Bacteria 2811
4 Ga0070683_100000402 3300005329 Bacteria 29821
5 Ga0070683_100005292 3300005329 Bacteria 10749
6 Ga0070683_100022809 3300005329 Bacteria 5599
7 Ga0070683_100041485 3300005329 Bacteria 4234
8 Ga0070683_100044347 3300005329 Bacteria 4100
9 Ga0068869_100270099 3300005334 Bacteria 1364
10 Ga0068869_100434199 3300005334 Unclassified 1086
11 Ga0070666_10010596 3300005335 Bacteria 5767
12 Ga0070666_10059777 3300005335 Bacteria 2578
13 Ga0070680_100001228 3300005336 Bacteria 18458
14 Ga0070680_100002704 3300005336 Bacteria 13154
15 Ga0070680_100067132 3300005336 Bacteria 2942
16 Ga0070680_100309506 3300005336 Bacteria 1340
17 Ga0070682_100275392 3300005337 Bacteria 1224
18 Ga0068868_100007633 3300005338 Bacteria 7714
19 Ga0068868_100014520 3300005338 Bacteria 5806
20 Ga0070660_100011449 3300005339 Bacteria 6303
21 Ga0070660_100170251 3300005339 Bacteria 1759
22 Ga0070660_100241568 3300005339 Bacteria 1471
23 Ga0070689_100065916 3300005340 Bacteria 2821
24 Ga0070691_10000526 3300005341 Bacteria 14449
25 Ga0070661_100026935 3300005344 Bacteria 4138
26 Ga0070692_10099132 3300005345 Bacteria 1595
27 Ga0070671_100050226 3300005355 Bacteria 3469
28 Ga0070671_100050318 3300005355 Bacteria 3466
29 Ga0070673_100013862 3300005364 Bacteria 5594
30 Ga0070673_100169974 3300005364 Bacteria 1860
31 Ga0070659_100104857 3300005366 Bacteria 2278
32 Ga0070659_100461441 3300005366 Unclassified 1079
33 Ga0070667_100019516 3300005367 Bacteria 5625
34 Ga0070709_10304807 3300005434 Bacteria 1164
35 Ga0070714_100228740 3300005435 Bacteria 1712
36 Ga0070713_100001970 3300005436 Bacteria 13253
37 Ga0070713_100091128 3300005436 Bacteria 2622
38 Ga0070713_100153472 3300005436 Bacteria 2051
39 Ga0070711_100071411 3300005439 Bacteria 2446
40 Ga0070694_100168459 3300005444 Unclassified 1612
41 Ga0070681_10005068 3300005458 Bacteria 12707
42 Ga0070681_10015906 3300005458 Bacteria 7501
43 Ga0070681_10066598 3300005458 Bacteria 3571
44 Ga0070681_10078533 3300005458 Bacteria 3257
45 Ga0070681_10136366 3300005458 Bacteria 2385
46 Ga0068867_100035113 3300005459 Bacteria 3636
47 Ga0068867_100087781 3300005459 Bacteria 2356
48 Ga0070679_100000422 3300005530 Bacteria 36002
49 Ga0070679_100308287 3300005530 Bacteria 1533
50 Ga0070684_100000409 3300005535 Bacteria 29407
51 Ga0070684_100000679 3300005535 Bacteria 23444
52 Ga0070684_100027678 3300005535 Bacteria 4787
53 Ga0070684_100056287 3300005535 Bacteria 3432
54 Ga0070684_100203944 3300005535 Bacteria 1802
55 Ga0070684_100244725 3300005535 Bacteria 1639
56 Ga0070684_100304100 3300005535 Bacteria 1464
57 Ga0068853_100005799 3300005539 Bacteria 9728
58 Ga0068853_100070763 3300005539 Bacteria 3037
59 Ga0068853_100085206 3300005539 Unclassified 2770
60 Ga0068853_100118657 3300005539 Unclassified 2358
61 Ga0070686_100049751 3300005544 Bacteria 2661
62 Ga0070665_100005274 3300005548 Bacteria 13353
63 Ga0070665_100122468 3300005548 Bacteria 2603
64 Ga0070665_100125212 3300005548 Bacteria 2572
65 Ga0070665_100477035 3300005548 Unclassified 1258
66 Ga0068855_100000594 3300005563 Bacteria 44363
67 Ga0068855_100011618 3300005563 Bacteria 10641
68 Ga0068855_100019454 3300005563 Bacteria 8158
69 Ga0068855_100024965 3300005563 Bacteria 7153
70 Ga0068855_100044019 3300005563 Bacteria 5285
71 Ga0068855_100048420 3300005563 Bacteria 5016
72 Ga0068855_100078404 3300005563 Bacteria 3832
73 Ga0068855_100156593 3300005563 Bacteria 2588
74 Ga0068855_100206403 3300005563 Bacteria 2210
75 Ga0068855_100271999 3300005563 Bacteria 1884
76 Ga0070664_100132641 3300005564 Bacteria 2189
77 Ga0068857_100000566 3300005577 Bacteria 26997
78 Ga0068857_100004971 3300005577 Bacteria 11294
79 Ga0068857_100064078 3300005577 Bacteria 3267
80 Ga0068857_100214067 3300005577 Bacteria 1759
81 Ga0068856_100003060 3300005614 Bacteria 17100
82 Ga0068856_100014282 3300005614 Bacteria 7680
83 Ga0068856_100167519 3300005614 Unclassified 2208
84 Ga0068856_100186239 3300005614 Bacteria 2090
85 Ga0068852_100004200 3300005616 Bacteria 10153
86 Ga0068852_100017942 3300005616 Bacteria 5565
87 Ga0068852_100065300 3300005616 Bacteria 3174
88 Ga0068852_100105558 3300005616 Unclassified 2553
89 Ga0068852_100143471 3300005616 Bacteria 2212
90 Ga0068859_100017445 3300005617 Bacteria 7214
91 Ga0068859_100047375 3300005617 Bacteria 4319
92 Ga0068864_100011466 3300005618 Bacteria 7323
93 Ga0068864_100072544 3300005618 Bacteria 3001
94 Ga0068864_100334331 3300005618 Bacteria 1426
95 Ga0068866_10017991 3300005718 Bacteria 3189
96 Ga0068861_100054476 3300005719 Bacteria 3047
97 Ga0068863_100035119 3300005841 Bacteria 4776
98 Ga0068863_100042124 3300005841 Bacteria 4339
99 Ga0068858_100006595 3300005842 Bacteria 11292
100 Ga0068858_100013580 3300005842 Bacteria 7686
101 Ga0068858_100025169 3300005842 Bacteria 5538
102 Ga0068858_100033992 3300005842 Bacteria 4730
103 Ga0068858_100339215 3300005842 Bacteria 1438
104 Ga0068860_100000945 3300005843 Bacteria 32199
105 Ga0068860_100266733 3300005843 Bacteria 1670
106 Ga0070717_10216553 3300006028 Unclassified 1682
107 Ga0070717_10266670 3300006028 Bacteria 1516
108 Ga0097621_100008107 3300006237 Bacteria 7548
109 Ga0097621_100013387 3300006237 Bacteria 6115
110 Ga0097621_100029355 3300006237 Bacteria 4342
111 Ga0097621_100059693 3300006237 Bacteria 3123
112 Ga0097621_100081907 3300006237 Bacteria 2686
113 Ga0097621_100125563 3300006237 Bacteria 2179
114 Ga0097621_100335062 3300006237 Bacteria 1342
115 Ga0068871_100005282 3300006358 Bacteria 9040
116 Ga0068871_100018377 3300006358 Bacteria 5312
117 Ga0068871_100048284 3300006358 Bacteria 3436
118 Ga0068871_100053614 3300006358 Bacteria 3269
119 Ga0068871_100054959 3300006358 Bacteria 3231
120 Ga0068871_100159964 3300006358 Bacteria 1926
121 Ga0068871_100189531 3300006358 Unclassified 1771
122 Ga0075431_100003865 3300006847 Bacteria 14565
123 Ga0068865_100245674 3300006881 Bacteria 1410
124 Ga0097620_100017445 3300006931 Bacteria 7214
125 Ga0097620_100047375 3300006931 Bacteria 4319
126 Ga0105240_10002025 3300009093 Bacteria 33421
127 Ga0105240_10004608 3300009093 Bacteria 20897
128 Ga0105240_10006743 3300009093 Bacteria 16810
129 Ga0105240_10118095 3300009093 Bacteria 3197
130 Ga0105240_10219160 3300009093 Unclassified 2218
131 Ga0105240_10246123 3300009093 Bacteria 2070
132 Ga0105240_10342098 3300009093 Bacteria 1699
133 Ga0105245_10006586 3300009098 Bacteria 10199
134 Ga0105245_10008150 3300009098 Bacteria 9163
135 Ga0105245_10009996 3300009098 Bacteria 8261
136 Ga0105245_10011162 3300009098 Bacteria 7818
137 Ga0105245_10166042 3300009098 Bacteria 2098
138 Ga0105245_10241391 3300009098 Unclassified 1751
139 Ga0105245_10419262 3300009098 Unclassified 1341
140 Ga0105245_10538195 3300009098 Bacteria 1189
141 Ga0105247_10046859 3300009101 Bacteria 2654
142 Ga0105247_10066160 3300009101 Bacteria 2250
143 Ga0114129_10114066 3300009147 Bacteria 3726
144 Ga0114129_10455699 3300009147 Bacteria 1677
145 Ga0114129_10950454 3300009147 Bacteria 1086
146 Ga0105243_10137394 3300009148 Bacteria 2081
147 Ga0105243_10188361 3300009148 Bacteria 1800
148 Ga0105243_10243475 3300009148 Bacteria 1602
149 Ga0105241_10003031 3300009174 Bacteria 12550
150 Ga0105241_10039478 3300009174 Bacteria 3561
151 Ga0105241_10095314 3300009174 Bacteria 2356
152 Ga0105241_10135965 3300009174 Bacteria 1996
153 Ga0105241_10396020 3300009174 Unclassified 1210
154 Ga0105242_10017018 3300009176 Bacteria 5660
155 Ga0105242_10025586 3300009176 Bacteria 4672
156 Ga0105242_10043865 3300009176 Bacteria 3620
157 Ga0105242_10084205 3300009176 Bacteria 2664
158 Ga0105242_10086661 3300009176 Bacteria 2628
159 Ga0105242_10106974 3300009176 Bacteria 2378
160 Ga0105248_10004469 3300009177 Bacteria 15474
161 Ga0105248_10012786 3300009177 Bacteria 9259
162 Ga0105248_10023681 3300009177 Bacteria 6823
163 Ga0105248_10038736 3300009177 Bacteria 5336
164 Ga0105248_10205365 3300009177 Bacteria 2220
165 Ga0105248_10369314 3300009177 Bacteria 1615
166 Ga0105248_10438660 3300009177 Bacteria 1471
167 Ga0105248_10679397 3300009177 Bacteria 1162
168 Ga0105237_10003684 3300009545 Bacteria 18057
169 Ga0105237_10130926 3300009545 Bacteria 2503
170 Ga0105237_10186463 3300009545 Bacteria 2074
171 Ga0105237_10250623 3300009545 Bacteria 1773
172 Ga0105237_10270697 3300009545 Bacteria 1701
173 Ga0105237_10294722 3300009545 Bacteria 1625
174 Ga0105238_10000642 3300009551 Bacteria 36763
175 Ga0105238_10001389 3300009551 Bacteria 24277
176 Ga0105238_10003038 3300009551 Bacteria 16748
177 Ga0105238_10006262 3300009551 Bacteria 11823
178 Ga0105238_10021604 3300009551 Bacteria 6555
179 Ga0105238_10075249 3300009551 Bacteria 3368
180 Ga0105238_10077937 3300009551 Bacteria 3305
181 Ga0105238_10314704 3300009551 Bacteria 1551
182 Ga0105249_10015830 3300009553 Bacteria 6682
183 Ga0105249_10303962 3300009553 Bacteria 1601
184 Ga0105249_10540815 3300009553 Bacteria 1214
185 Ga0105239_10003447 3300010375 Bacteria 19363
186 Ga0105239_10009300 3300010375 Bacteria 11107
187 Ga0105239_10012855 3300010375 Bacteria 9313
188 Ga0105239_10119873 3300010375 Bacteria 2921
189 Ga0105239_10191241 3300010375 Bacteria 2291
190 Ga0105246_10000495 3300011119 Bacteria 21435
191 Ga0105246_10073589 3300011119 Bacteria 2413
192 Ga0105246_10197114 3300011119 Bacteria 1563
193 Ga0157370_10002845 3300013104 Bacteria 20673
194 Ga0157370_10003252 3300013104 Bacteria 19149
195 Ga0157370_10022068 3300013104 Bacteria 6339
196 Ga0157370_10026360 3300013104 Bacteria 5740
197 Ga0157370_10052650 3300013104 Bacteria 3886
198 Ga0157369_10004059 3300013105 Bacteria 17337
199 Ga0157369_10004657 3300013105 Bacteria 16122
200 Ga0157369_10007098 3300013105 Bacteria 12917
201 Ga0157369_10031459 3300013105 Bacteria 5843
202 Ga0157369_10053998 3300013105 Bacteria 4339
203 Ga0157369_10091074 3300013105 Bacteria 3256
204 Ga0157369_10111662 3300013105 Bacteria 2905
205 Ga0157369_10131906 3300013105 Bacteria 2647
206 Ga0157369_10390793 3300013105 Bacteria 1443
207 Ga0157374_10007039 3300013296 Bacteria 9572
208 Ga0157374_10049206 3300013296 Bacteria 3915
209 Ga0157374_10066450 3300013296 Bacteria 3388
210 Ga0157374_10201708 3300013296 Bacteria 1948
211 Ga0157374_10563170 3300013296 Unclassified 1148
212 Ga0157378_10006808 3300013297 Bacteria 9970
213 Ga0157378_10048399 3300013297 Bacteria 3780
214 Ga0157378_10151375 3300013297 Bacteria 2162
215 Ga0157378_10172763 3300013297 Bacteria 2028
216 Ga0163162_10113680 3300013306 Bacteria 2806
217 Ga0163162_10166055 3300013306 Bacteria 2331
218 Ga0163162_10414237 3300013306 Bacteria 1480
219 Ga0163162_10639758 3300013306 Bacteria 1188
220 Ga0157372_10001475 3300013307 Bacteria 25532
221 Ga0157372_10069785 3300013307 Bacteria 3953
222 Ga0157372_10167209 3300013307 Bacteria 2543
223 Ga0157372_10263993 3300013307 Bacteria 1999
224 Ga0157372_10294946 3300013307 Bacteria 1886
225 Ga0157372_10299903 3300013307 Bacteria 1869
226 Ga0157375_10047171 3300013308 Bacteria 4205
227 Ga0157375_10465899 3300013308 Bacteria 1429
228 Ga0163163_10002200 3300014325 Bacteria 16410
229 Ga0163163_10010272 3300014325 Bacteria 8412
230 Ga0163163_10019029 3300014325 Bacteria 6443
231 Ga0163163_10063060 3300014325 Bacteria 3674
232 Ga0163163_10195985 3300014325 Unclassified 2068
233 Ga0157379_10051605 3300014968 Bacteria 3673
234 Ga0157376_10070370 3300014969 Bacteria 2969
235 Ga0157376_10112484 3300014969 Bacteria 2399
236 Ga0157376_10367380 3300014969 Bacteria 1382
237 Ga0207680_10002610 3300025903 Bacteria 8409
238 Ga0207699_10108059 3300025906 Bacteria 1778
239 Ga0207705_10009712 3300025909 Bacteria 6998
240 Ga0207654_10022449 3300025911 Bacteria 3367
241 Ga0207654_10070809 3300025911 Bacteria 2071
242 Ga0207654_10122642 3300025911 Bacteria 1634
243 Ga0207654_10221749 3300025911 Unclassified 1255
244 Ga0207707_10001075 3300025912 Bacteria 26180
245 Ga0207707_10026197 3300025912 Bacteria 5097
246 Ga0207707_10077019 3300025912 Unclassified 2911
247 Ga0207707_10096189 3300025912 Bacteria 2588
248 Ga0207707_10304473 3300025912 Unclassified 1378
249 Ga0207695_10001637 3300025913 Bacteria 36185
250 Ga0207695_10008296 3300025913 Bacteria 13021
251 Ga0207695_10010820 3300025913 Bacteria 11120
252 Ga0207695_10013765 3300025913 Bacteria 9624
253 Ga0207695_10204051 3300025913 Bacteria 1890
254 Ga0207695_10242715 3300025913 Bacteria 1702
255 Ga0207671_10002559 3300025914 Bacteria 19309
256 Ga0207671_10008800 3300025914 Bacteria 8501
257 Ga0207671_10121976 3300025914 Bacteria 1993
258 Ga0207671_10236865 3300025914 Bacteria 1433
259 Ga0207660_10001782 3300025917 Bacteria 14406
260 Ga0207657_10011745 3300025919 Bacteria 8675
261 Ga0207657_10045442 3300025919 Bacteria 3854
262 Ga0207657_10138197 3300025919 Bacteria 1992
263 Ga0207657_10332704 3300025919 Unclassified 1199
264 Ga0207649_10252078 3300025920 Unclassified 1272
265 Ga0207652_10007102 3300025921 Bacteria 9024
266 Ga0207694_10000837 3300025924 Bacteria 27402
267 Ga0207694_10003727 3300025924 Bacteria 12073
268 Ga0207694_10006073 3300025924 Bacteria 9236
269 Ga0207694_10012491 3300025924 Bacteria 6403
270 Ga0207694_10018799 3300025924 Bacteria 5223
271 Ga0207694_10094877 3300025924 Bacteria 2357
272 Ga0207694_10134577 3300025924 Bacteria 1984
273 Ga0207694_10219296 3300025924 Bacteria 1551
274 Ga0207687_10001724 3300025927 Bacteria 15061
275 Ga0207687_10002576 3300025927 Bacteria 12312
276 Ga0207687_10004660 3300025927 Bacteria 9121
277 Ga0207687_10009910 3300025927 Bacteria 6240
278 Ga0207687_10026666 3300025927 Bacteria 3871
279 Ga0207687_10074912 3300025927 Bacteria 2427
280 Ga0207687_10176921 3300025927 Unclassified 1650
281 Ga0207687_10271801 3300025927 Bacteria 1355
282 Ga0207700_10010912 3300025928 Bacteria 5767
283 Ga0207700_10033294 3300025928 Bacteria 3686
284 Ga0207700_10203237 3300025928 Bacteria 1670
285 Ga0207664_10098506 3300025929 Bacteria 2411
286 Ga0207664_10112244 3300025929 Bacteria 2269
287 Ga0207644_10089654 3300025931 Bacteria 2289
288 Ga0207644_10146665 3300025931 Bacteria 1822
289 Ga0207690_10039835 3300025932 Bacteria 3068
290 Ga0207706_10047426 3300025933 Bacteria 3801
291 Ga0207686_10016746 3300025934 Bacteria 4117
292 Ga0207686_10023185 3300025934 Bacteria 3582
293 Ga0207686_10024335 3300025934 Unclassified 3508
294 Ga0207686_10042790 3300025934 Bacteria 2771
295 Ga0207686_10079790 3300025934 Bacteria 2132
296 Ga0207709_10018622 3300025935 Bacteria 3891
297 Ga0207709_10161515 3300025935 Bacteria 1563
298 Ga0207704_10134049 3300025938 Bacteria 1721
299 Ga0207691_10249980 3300025940 Bacteria 1531
300 Ga0207711_10004030 3300025941 Bacteria 12608
301 Ga0207711_10039424 3300025941 Bacteria 4018
302 Ga0207711_10043963 3300025941 Bacteria 3812
303 Ga0207711_10052800 3300025941 Bacteria 3484
304 Ga0207711_10107339 3300025941 Bacteria 2479
305 Ga0207711_10109891 3300025941 Bacteria 2451
306 Ga0207711_10386195 3300025941 Unclassified 1300
307 Ga0207711_10454080 3300025941 Bacteria 1193
308 Ga0207689_10072887 3300025942 Bacteria 2821
309 Ga0207689_10096518 3300025942 Bacteria 2428
310 Ga0207689_10205128 3300025942 Bacteria 1628
311 Ga0207661_10000332 3300025944 Bacteria 30096
312 Ga0207661_10002257 3300025944 Bacteria 13281
313 Ga0207661_10012233 3300025944 Bacteria 6233
314 Ga0207661_10113985 3300025944 Bacteria 2291
315 Ga0207661_10461717 3300025944 Unclassified 1157
316 Ga0207679_10112700 3300025945 Bacteria 2150
317 Ga0207667_10000769 3300025949 Bacteria 41712
318 Ga0207667_10006977 3300025949 Bacteria 13647
319 Ga0207667_10019579 3300025949 Bacteria 7550
320 Ga0207667_10025405 3300025949 Bacteria 6483
321 Ga0207667_10059370 3300025949 Bacteria 4006
322 Ga0207667_10060406 3300025949 Bacteria 3968
323 Ga0207667_10065589 3300025949 Bacteria 3786
324 Ga0207651_10010788 3300025960 Bacteria 5081
325 Ga0207651_10042617 3300025960 Bacteria 3023
326 Ga0207712_10030763 3300025961 Bacteria 3611
327 Ga0207712_10396412 3300025961 Bacteria 1159
328 Ga0207658_10012888 3300025986 Bacteria 5709
329 Ga0207658_10150640 3300025986 Bacteria 1895
330 Ga0207658_10308380 3300025986 Unclassified 1366
331 Ga0207677_10010086 3300026023 Bacteria 5332
332 Ga0207677_10120098 3300026023 Unclassified 1975
333 Ga0207677_10176634 3300026023 Bacteria 1676
334 Ga0207703_10044082 3300026035 Bacteria 3583
335 Ga0207703_10158375 3300026035 Bacteria 1981
336 Ga0207703_10206911 3300026035 Bacteria 1747
337 Ga0207639_10046348 3300026041 Bacteria 3280
338 Ga0207639_10085232 3300026041 Bacteria 2512
339 Ga0207639_10368273 3300026041 Bacteria 1288
340 Ga0207702_10004839 3300026078 Bacteria 11859
341 Ga0207702_10023132 3300026078 Bacteria 5154
342 Ga0207702_10034696 3300026078 Bacteria 4219
343 Ga0207702_10054961 3300026078 Bacteria 3375
344 Ga0207702_10536953 3300026078 Unclassified 1143
345 Ga0207641_10024462 3300026088 Bacteria 4978
346 Ga0207648_10001498 3300026089 Bacteria 25742
347 Ga0207648_10014215 3300026089 Bacteria 7363
348 Ga0207676_10205244 3300026095 Bacteria 1744
349 Ga0207676_10258461 3300026095 Unclassified 1571
350 Ga0207676_10281967 3300026095 Bacteria 1509
351 Ga0207674_10001255 3300026116 Bacteria 33149
352 Ga0207674_10004305 3300026116 Bacteria 17168
353 Ga0207674_10017190 3300026116 Bacteria 7893
354 Ga0207674_10020416 3300026116 Bacteria 7158
355 Ga0207674_10021568 3300026116 Bacteria 6934
356 Ga0207674_10151044 3300026116 Bacteria 2280
357 Ga0207675_100075396 3300026118 Bacteria 3157
358 Ga0207675_100119804 3300026118 Bacteria 2489
359 Ga0207698_10012881 3300026142 Bacteria 5494
360 Ga0207698_10013060 3300026142 Bacteria 5466
361 Ga0207698_10124306 3300026142 Bacteria 2191
362 Ga0268266_10009431 3300028379 Bacteria 8593
363 Ga0268266_10041985 3300028379 Bacteria 3905
364 Ga0268266_10262376 3300028379 Bacteria 1601
365 Ga0268266_10382134 3300028379 Unclassified 1328
366 Ga0268264_10003352 3300028381 Bacteria 13845
367 Ga0268264_10006780 3300028381 Bacteria 9619
368 Ga0268264_10480076 3300028381 Unclassified 1209
369 Ga0268264_10515558 3300028381 Bacteria 1168
370 Ga0265323_10001903 3300028653 Bacteria 9846
371 Ga0265320_10000877 3300031240 Bacteria 22699
372 Ga0265340_10006182 3300031247 Bacteria 6599
373 Ga0265340_10025189 3300031247 Bacteria 3016
374 Ga0265339_10009519 3300031249 Bacteria 6100
375 Ga0265316_10002205 3300031344 Bacteria 20469
376 Ga0265316_10010935 3300031344 Bacteria 8239
377 Ga0265316_10022431 3300031344 Bacteria 5323
378 Ga0265316_10056426 3300031344 Bacteria 3068
379 Ga0265316_10278057 3300031344 Unclassified 1224
380 Ga0265316_10331711 3300031344 Unclassified 1103
381 Ga0265313_10004862 3300031595 Bacteria 10093
382 Ga0265314_10008090 3300031711 Bacteria 9048
383 Ga0265314_10010108 3300031711 Bacteria 7909
384 Ga0265314_10010759 3300031711 Bacteria 7608
385 Ga0265314_10081708 3300031711 Bacteria 2128
386 Ga0265314_10095132 3300031711 Unclassified 1929
387 Ga0307516_10233869 3300031730 Bacteria 1540
388 Ga0373934_0000619 3300035086 Bacteria 12502
389 Ga0373934_0051881 3300035086 Bacteria 1626
390 Ga0373923_0118551 3300035111 Bacteria 1181
391 Ga0373945_0015611 3300035116 Bacteria 2557
392 Ga0373953_0059038 3300035117 Bacteria 1565
393 Ga0373954_0004805 3300035118 Bacteria 5825
394 Ga0373954_0045421 3300035118 Bacteria 2052
395 Ga0373954_0087832 3300035118 Bacteria 1491
396 Ga0373957_0041085 3300035120 Bacteria 1741
397 Ga0373943_0005349 3300035170 Bacteria 5775
398 Ga0373943_0086108 3300035170 Bacteria 1620
399 Ga0373946_0009719 3300035171 Bacteria 3551
400 Ga0373955_0050182 3300035172 Bacteria 2268
401 Ga0373935_0049851 3300035692 Bacteria 2656
402 Ga0373935_0164273 3300035692 Bacteria 1515
403 Ga0373927_0000549 3300035695 Bacteria 28588
404 Ga0373927_0006755 3300035695 Bacteria 7804
405 Ga0373927_0015329 3300035695 Bacteria 5062
406 Ga0373927_0208265 3300035695 Unclassified 1284
407 Ga0373933_0028340 3300035724 Bacteria 3230
408 Ga0373933_0043883 3300035724 Bacteria 2646
409 Ga0373947_0000912 3300035725 Bacteria 17912
410 Ga0373947_0003330 3300035725 Bacteria 9521
411 Ga0373947_0106433 3300035725 Bacteria 1768
412 Ga0373937_0017956 3300036401 Bacteria 6311
413 Ga0373937_0081782 3300036401 Bacteria 2988
414 Ga0373937_0102566 3300036401 Bacteria 2656
415 Ga0373937_0108183 3300036401 Bacteria 2585
416 Ga0373937_0544522 3300036401 Bacteria 1102
417 Ga0373925_0000073 3300037068 Bacteria 106508
418 Ga0373925_0024793 3300037068 Bacteria 4381
419 Ga0373925_0086729 3300037068 Bacteria 2388
420 Ga0373925_0389865 3300037068 Bacteria 1135
421 Ga0373925_0575706 3300037068 Unclassified 927
422 Ga0466967_0376888 3300045976 Unclassified 1377
423 Ga0495592_0003006 3300046454 Bacteria 12001
424 Ga0495592_0083870 3300046454 Bacteria 2300
425 Ga0495592_0113054 3300046454 Bacteria 1919
426 Ga0495651_0017416 3300046462 Bacteria 5564
427 Ga0495651_0061210 3300046462 Bacteria 2881
428 Ga0495653_0109490 3300046463 Bacteria 1988
429 Ga0495653_0213671 3300046463 Bacteria 1301
430 Ga0495580_0071863 3300046472 Bacteria 2417
431 Ga0495580_0147436 3300046472 Archaea 1631
432 Ga0495580_0183301 3300046472 Unclassified 1445
433 Ga0495580_0191348 3300046472 Unclassified 1411
434 Ga0495582_0002531 3300046473 Bacteria 10173
435 Ga0495582_0068077 3300046473 Bacteria 1968
436 Ga0495662_0027282 3300046476 Bacteria 2759
437 Ga0495664_0007859 3300046477 Bacteria 5936
438 Ga0495608_0087695 3300046511 Bacteria 2015
439 Ga0495628_0018644 3300046516 Bacteria 5743
440 Ga0495628_0103032 3300046516 Unclassified 2201
441 Ga0495628_0109120 3300046516 Unclassified 2130
442 Ga0495628_0173875 3300046516 Bacteria 1632
443 Ga0495642_0126028 3300046528 Bacteria 1101
444 Ga0495652_0038331 3300046529 Bacteria 4153
445 Ga0495652_0070482 3300046529 Bacteria 2921
446 Ga0495665_0153513 3300046531 Bacteria 1201
447 Ga0495640_0081012 3300046533 Bacteria 2158
448 Ga0495587_0019373 3300046536 Bacteria 4211
449 Ga0495587_0033191 3300046536 Bacteria 3117
450 Ga0495587_0097831 3300046536 Bacteria 1692
451 Ga0495587_0153245 3300046536 Bacteria 1313
452 Ga0495645_0028313 3300046543 Bacteria 4071
453 Ga0495645_0061621 3300046543 Bacteria 2718
454 Ga0495645_0086194 3300046543 Bacteria 2247
455 Ga0495645_0110931 3300046543 Bacteria 1941
456 Ga0495667_0013590 3300046559 Bacteria 5505
457 Ga0495667_0018158 3300046559 Bacteria 4750
458 Ga0495667_0361609 3300046559 Bacteria 916
459 Ga0495634_0067478 3300046642 Bacteria 2366
460 Ga0495635_0035912 3300046663 Bacteria 3437
461 Ga0495635_0042438 3300046663 Bacteria 3140
462 Ga0495635_0206119 3300046663 Bacteria 1333
463 Ga0495599_0011435 3300046678 Bacteria 5453
464 Ga0495599_0031887 3300046678 Bacteria 3308
465 Ga0495599_0088338 3300046678 Unclassified 1935
466 Ga0495599_0149307 3300046678 Unclassified 1448
467 Ga0495623_0007540 3300046679 Bacteria 7060
468 Ga0495623_0132860 3300046679 Bacteria 1488
469 Ga0495646_0029340 3300046680 Bacteria 3439
470 Ga0495658_0003546 3300046683 Bacteria 7715
471 Ga0495613_0198532 3300046689 Bacteria 1415
472 Ga0495624_0159933 3300046690 Bacteria 1376
473 Ga0495624_0244452 3300046690 Unclassified 1086
474 Ga0495600_0095917 3300046809 Bacteria 1934
475 Ga0495604_0183748 3300047317 Bacteria 1461
476 Ga0495604_0184833 3300047317 Bacteria 1456
477 Ga0495604_0294465 3300047317 Bacteria 1092
478 Ga0495636_0012781 3300047318 Bacteria 3326
479 Ga0495636_0072943 3300047318 Bacteria 1468
480 Ga0495674_0000591 3300047319 Bacteria 33921
481 Ga0495674_0018864 3300047319 Bacteria 6416
482 Ga0495674_0029828 3300047319 Bacteria 4963
483 Ga0495674_0052440 3300047319 Bacteria 3589
484 Ga0495674_0169951 3300047319 Bacteria 1820
485 Ga0495674_0209712 3300047319 Bacteria 1614
486 Ga0495674_0232762 3300047319 Unclassified 1520
487 Ga0495680_0015415 3300047322 Bacteria 6596
488 Ga0495675_0043116 3300047444 Bacteria 2875
489 Ga0495675_0099252 3300047444 Bacteria 1824
490 Ga0495684_0001674 3300047471 Bacteria 17812
491 Ga0495684_0006552 3300047471 Bacteria 9031
492 Ga0495684_0019071 3300047471 Bacteria 5282
493 Ga0495684_0290673 3300047471 Bacteria 1177
494 Ga0495602_0010907 3300048088 Bacteria 9417
495 Ga0495602_0152813 3300048088 Bacteria 1812
496 Ga0496112_0061030 3300048915 Bacteria 3716
497 Ga0496115_0084560 3300048918 Bacteria 2587
498 Ga0501075_0317552 3300049591 Unclassified 1187
499 nmdc:mga05p37_110913_c1 3300050507 Bacteria 3374
500 nmdc:mga05p37_115687_c1 3300050507 Bacteria 3296
501 nmdc:mga05p37_741775_c1 3300050507 Bacteria 1084
502 nmdc:mga06r32_4289_c1 3300050510 Bacteria 12775
503 Ga0495619_0126570 3300053085 Bacteria 1754
504 Ga0500568_0003365 3300053139 Bacteria 8942
505 Ga0501082_0001604 3300060353 Bacteria 19923
506 Ga0105240_10078810
507 Ga0070658_10004689
508 Ga0070658_10073125
509 Ga0070683_100000402
510 Ga0070683_100005292
511 Ga0070683_100022809
512 Ga0070683_100041485
513 Ga0070683_100044347
514 Ga0068869_100270099
515 Ga0068869_100434199
516 Ga0070666_10010596
517 Ga0070666_10059777
518 Ga0070680_100001228
519 Ga0070680_100002704
520 Ga0070680_100067132
521 Ga0070680_100309506
522 Ga0070682_100275392
523 Ga0068868_100007633
524 Ga0068868_100014520
525 Ga0070660_100011449
526 Ga0070660_100170251
527 Ga0070660_100241568
528 Ga0070689_100065916
529 Ga0070691_10000526
530 Ga0070661_100026935
531 Ga0070692_10099132
532 Ga0070671_100050226
533 Ga0070671_100050318
534 Ga0070673_100013862
535 Ga0070673_100169974
536 Ga0070659_100104857
537 Ga0070659_100461441
538 Ga0070667_100019516
539 Ga0070709_10304807
540 Ga0070714_100228740
541 Ga0070713_100001970
542 Ga0070713_100091128
543 Ga0070713_100153472
544 Ga0070711_100071411
545 Ga0070694_100168459
546 Ga0070681_10005068
547 Ga0070681_10015906
548 Ga0070681_10066598
549 Ga0070681_10078533
550 Ga0070681_10136366
551 Ga0068867_100035113
552 Ga0068867_100087781
553 Ga0070679_100000422
554 Ga0070679_100308287
555 Ga0070684_100000409
556 Ga0070684_100000679
557 Ga0070684_100027678
558 Ga0070684_100056287
559 Ga0070684_100203944
560 Ga0070684_100244725
561 Ga0070684_100304100
562 Ga0068853_100005799
563 Ga0068853_100070763
564 Ga0068853_100085206
565 Ga0068853_100118657
566 Ga0070686_100049751
567 Ga0070665_100005274
568 Ga0070665_100122468
569 Ga0070665_100125212
570 Ga0070665_100477035
571 Ga0068855_100000594
572 Ga0068855_100011618
573 Ga0068855_100019454
574 Ga0068855_100024965
575 Ga0068855_100044019
576 Ga0068855_100048420
577 Ga0068855_100078404
578 Ga0068855_100156593
579 Ga0068855_100206403
580 Ga0068855_100271999
581 Ga0070664_100132641
582 Ga0068857_100000566
583 Ga0068857_100004971
584 Ga0068857_100064078
585 Ga0068857_100214067
586 Ga0068856_100003060
587 Ga0068856_100014282
588 Ga0068856_100167519
589 Ga0068856_100186239
590 Ga0068852_100004200
591 Ga0068852_100017942
592 Ga0068852_100065300
593 Ga0068852_100105558
594 Ga0068852_100143471
595 Ga0068859_100017445
596 Ga0068859_100047375
597 Ga0068864_100011466
598 Ga0068864_100072544
599 Ga0068864_100334331
600 Ga0068866_10017991
601 Ga0068861_100054476
602 Ga0068863_100035119
603 Ga0068863_100042124
604 Ga0068858_100006595
605 Ga0068858_100013580
606 Ga0068858_100025169
607 Ga0068858_100033992
608 Ga0068858_100339215
609 Ga0068860_100000945
610 Ga0068860_100266733
611 Ga0070717_10216553
612 Ga0070717_10266670
613 Ga0097621_100008107
614 Ga0097621_100013387
615 Ga0097621_100029355
616 Ga0097621_100059693
617 Ga0097621_100081907
618 Ga0097621_100125563
619 Ga0097621_100335062
620 Ga0068871_100005282
621 Ga0068871_100018377
622 Ga0068871_100048284
623 Ga0068871_100053614
624 Ga0068871_100054959
625 Ga0068871_100159964
626 Ga0068871_100189531
627 Ga0075431_100003865
628 Ga0068865_100245674
629 Ga0097620_100017445
630 Ga0097620_100047375
631 Ga0105240_10002025
632 Ga0105240_10004608
633 Ga0105240_10006743
634 Ga0105240_10118095
635 Ga0105240_10219160
636 Ga0105240_10246123
637 Ga0105240_10342098
638 Ga0105245_10006586
639 Ga0105245_10008150
640 Ga0105245_10009996
641 Ga0105245_10011162
642 Ga0105245_10166042
643 Ga0105245_10241391
644 Ga0105245_10419262
645 Ga0105245_10538195
646 Ga0105247_10046859
647 Ga0105247_10066160
648 Ga0114129_10114066
649 Ga0114129_10455699
650 Ga0114129_10950454
651 Ga0105243_10137394
652 Ga0105243_10188361
653 Ga0105243_10243475
654 Ga0105241_10003031
655 Ga0105241_10039478
656 Ga0105241_10095314
657 Ga0105241_10135965
658 Ga0105241_10396020
659 Ga0105242_10017018
660 Ga0105242_10025586
661 Ga0105242_10043865
662 Ga0105242_10084205
663 Ga0105242_10086661
664 Ga0105242_10106974
665 Ga0105248_10004469
666 Ga0105248_10012786
667 Ga0105248_10023681
668 Ga0105248_10038736
669 Ga0105248_10205365
670 Ga0105248_10369314
671 Ga0105248_10438660
672 Ga0105248_10679397
673 Ga0105237_10003684
674 Ga0105237_10130926
675 Ga0105237_10186463
676 Ga0105237_10250623
677 Ga0105237_10270697
678 Ga0105237_10294722
679 Ga0105238_10000642
680 Ga0105238_10001389
681 Ga0105238_10003038
682 Ga0105238_10006262
683 Ga0105238_10021604
684 Ga0105238_10075249
685 Ga0105238_10077937
686 Ga0105238_10314704
687 Ga0105249_10015830
688 Ga0105249_10303962
689 Ga0105249_10540815
690 Ga0105239_10003447
691 Ga0105239_10009300
692 Ga0105239_10012855
693 Ga0105239_10119873
694 Ga0105239_10191241
695 Ga0105246_10000495
696 Ga0105246_10073589
697 Ga0105246_10197114
698 Ga0157370_10002845
699 Ga0157370_10003252
700 Ga0157370_10022068
701 Ga0157370_10026360
702 Ga0157370_10052650
703 Ga0157369_10004059
704 Ga0157369_10004657
705 Ga0157369_10007098
706 Ga0157369_10031459
707 Ga0157369_10053998
708 Ga0157369_10091074
709 Ga0157369_10111662
710 Ga0157369_10131906
711 Ga0157369_10390793
712 Ga0157374_10007039
713 Ga0157374_10049206
714 Ga0157374_10066450
715 Ga0157374_10201708
716 Ga0157374_10563170
717 Ga0157378_10006808
718 Ga0157378_10048399
719 Ga0157378_10151375
720 Ga0157378_10172763
721 Ga0163162_10113680
722 Ga0163162_10166055
723 Ga0163162_10414237
724 Ga0163162_10639758
725 Ga0157372_10001475
726 Ga0157372_10069785
727 Ga0157372_10167209
728 Ga0157372_10263993
729 Ga0157372_10294946
730 Ga0157372_10299903
731 Ga0157375_10047171
732 Ga0157375_10465899
733 Ga0163163_10002200
734 Ga0163163_10010272
735 Ga0163163_10019029
736 Ga0163163_10063060
737 Ga0163163_10195985
738 Ga0157379_10051605
739 Ga0157376_10070370
740 Ga0157376_10112484
741 Ga0157376_10367380
742 Ga0207680_10002610
743 Ga0207699_10108059
744 Ga0207705_10009712
745 Ga0207654_10022449
746 Ga0207654_10070809
747 Ga0207654_10122642
748 Ga0207654_10221749
749 Ga0207707_10001075
750 Ga0207707_10026197
751 Ga0207707_10077019
752 Ga0207707_10096189
753 Ga0207707_10304473
754 Ga0207695_10001637
755 Ga0207695_10008296
756 Ga0207695_10010820
757 Ga0207695_10013765
758 Ga0207695_10204051
759 Ga0207695_10242715
760 Ga0207671_10002559
761 Ga0207671_10008800
762 Ga0207671_10121976
763 Ga0207671_10236865
764 Ga0207660_10001782
765 Ga0207657_10011745
766 Ga0207657_10045442
767 Ga0207657_10138197
768 Ga0207657_10332704
769 Ga0207649_10252078
770 Ga0207652_10007102
771 Ga0207694_10000837
772 Ga0207694_10003727
773 Ga0207694_10006073
774 Ga0207694_10012491
775 Ga0207694_10018799
776 Ga0207694_10094877
777 Ga0207694_10134577
778 Ga0207694_10219296
779 Ga0207687_10001724
780 Ga0207687_10002576
781 Ga0207687_10004660
782 Ga0207687_10009910
783 Ga0207687_10026666
784 Ga0207687_10074912
785 Ga0207687_10176921
786 Ga0207687_10271801
787 Ga0207700_10010912
788 Ga0207700_10033294
789 Ga0207700_10203237
790 Ga0207664_10098506
791 Ga0207664_10112244
792 Ga0207644_10089654
793 Ga0207644_10146665
794 Ga0207690_10039835
795 Ga0207706_10047426
796 Ga0207686_10016746
797 Ga0207686_10023185
798 Ga0207686_10024335
799 Ga0207686_10042790
800 Ga0207686_10079790
801 Ga0207709_10018622
802 Ga0207709_10161515
803 Ga0207704_10134049
804 Ga0207691_10249980
805 Ga0207711_10004030
806 Ga0207711_10039424
807 Ga0207711_10043963
808 Ga0207711_10052800
809 Ga0207711_10107339
810 Ga0207711_10109891
811 Ga0207711_10386195
812 Ga0207711_10454080
813 Ga0207689_10072887
814 Ga0207689_10096518
815 Ga0207689_10205128
816 Ga0207661_10000332
817 Ga0207661_10002257
818 Ga0207661_10012233
819 Ga0207661_10113985
820 Ga0207661_10461717
821 Ga0207679_10112700
822 Ga0207667_10000769
823 Ga0207667_10006977
824 Ga0207667_10019579
825 Ga0207667_10025405
826 Ga0207667_10059370
827 Ga0207667_10060406
828 Ga0207667_10065589
829 Ga0207651_10010788
830 Ga0207651_10042617
831 Ga0207712_10030763
832 Ga0207712_10396412
833 Ga0207658_10012888
834 Ga0207658_10150640
835 Ga0207658_10308380
836 Ga0207677_10010086
837 Ga0207677_10120098
838 Ga0207677_10176634
839 Ga0207703_10044082
840 Ga0207703_10158375
841 Ga0207703_10206911
842 Ga0207639_10046348
843 Ga0207639_10085232
844 Ga0207639_10368273
845 Ga0207702_10004839
846 Ga0207702_10023132
847 Ga0207702_10034696
848 Ga0207702_10054961
849 Ga0207702_10536953
850 Ga0207641_10024462
851 Ga0207648_10001498
852 Ga0207648_10014215
853 Ga0207676_10205244
854 Ga0207676_10258461
855 Ga0207676_10281967
856 Ga0207674_10001255
857 Ga0207674_10004305
858 Ga0207674_10017190
859 Ga0207674_10020416
860 Ga0207674_10021568
861 Ga0207674_10151044
862 Ga0207675_100075396
863 Ga0207675_100119804
864 Ga0207698_10012881
865 Ga0207698_10013060
866 Ga0207698_10124306
867 Ga0268266_10009431
868 Ga0268266_10041985
869 Ga0268266_10262376
870 Ga0268266_10382134
871 Ga0268264_10003352
872 Ga0268264_10006780
873 Ga0268264_10480076
874 Ga0268264_10515558
875 Ga0265323_10001903
876 Ga0265320_10000877
877 Ga0265340_10006182
878 Ga0265340_10025189
879 Ga0265339_10009519
880 Ga0265316_10002205
881 Ga0265316_10010935
882 Ga0265316_10022431
883 Ga0265316_10056426
884 Ga0265316_10278057
885 Ga0265316_10331711
886 Ga0265313_10004862
887 Ga0265314_10008090
888 Ga0265314_10010108
889 Ga0265314_10010759
890 Ga0265314_10081708
891 Ga0265314_10095132
892 Ga0307516_10233869
893 Ga0373934_0000619
894 Ga0373934_0051881
895 Ga0373923_0118551
896 Ga0373945_0015611
897 Ga0373953_0059038
898 Ga0373954_0004805
899 Ga0373954_0045421
900 Ga0373954_0087832
901 Ga0373957_0041085
902 Ga0373943_0005349
903 Ga0373943_0086108
904 Ga0373946_0009719
905 Ga0373955_0050182
906 Ga0373935_0049851
907 Ga0373935_0164273
908 Ga0373927_0000549
909 Ga0373927_0006755
910 Ga0373927_0015329
911 Ga0373927_0208265
912 Ga0373933_0028340
913 Ga0373933_0043883
914 Ga0373947_0000912
915 Ga0373947_0003330
916 Ga0373947_0106433
917 Ga0373937_0017956
918 Ga0373937_0081782
919 Ga0373937_0102566
920 Ga0373937_0108183
921 Ga0373937_0544522
922 Ga0373925_0000073
923 Ga0373925_0024793
924 Ga0373925_0086729
925 Ga0373925_0389865
926 Ga0373925_0575706
927 Ga0466967_0376888
928 Ga0495592_0003006
929 Ga0495592_0083870
930 Ga0495592_0113054
931 Ga0495651_0017416
932 Ga0495651_0061210
933 Ga0495653_0109490
934 Ga0495653_0213671
935 Ga0495580_0071863
936 Ga0495580_0147436
937 Ga0495580_0183301
938 Ga0495580_0191348
939 Ga0495582_0002531
940 Ga0495582_0068077
941 Ga0495662_0027282
942 Ga0495664_0007859
943 Ga0495608_0087695
944 Ga0495628_0018644
945 Ga0495628_0103032
946 Ga0495628_0109120
947 Ga0495628_0173875
948 Ga0495642_0126028
949 Ga0495652_0038331
950 Ga0495652_0070482
951 Ga0495665_0153513
952 Ga0495640_0081012
953 Ga0495587_0019373
954 Ga0495587_0033191
955 Ga0495587_0097831
956 Ga0495587_0153245
957 Ga0495645_0028313
958 Ga0495645_0061621
959 Ga0495645_0086194
960 Ga0495645_0110931
961 Ga0495667_0013590
962 Ga0495667_0018158
963 Ga0495667_0361609
964 Ga0495634_0067478
965 Ga0495635_0035912
966 Ga0495635_0042438
967 Ga0495635_0206119
968 Ga0495599_0011435
969 Ga0495599_0031887
970 Ga0495599_0088338
971 Ga0495599_0149307
972 Ga0495623_0007540
973 Ga0495623_0132860
974 Ga0495646_0029340
975 Ga0495658_0003546
976 Ga0495613_0198532
977 Ga0495624_0159933
978 Ga0495624_0244452
979 Ga0495600_0095917
980 Ga0495604_0183748
981 Ga0495604_0184833
982 Ga0495604_0294465
983 Ga0495636_0012781
984 Ga0495636_0072943
985 Ga0495674_0000591
986 Ga0495674_0018864
987 Ga0495674_0029828
988 Ga0495674_0052440
989 Ga0495674_0169951
990 Ga0495674_0209712
991 Ga0495674_0232762
992 Ga0495680_0015415
993 Ga0495675_0043116
994 Ga0495675_0099252
995 Ga0495684_0001674
996 Ga0495684_0006552
997 Ga0495684_0019071
998 Ga0495684_0290673
999 Ga0495602_0010907
1000 Ga0495602_0152813
1001 Ga0496112_0061030
1002 Ga0496115_0084560
1003 Ga0501075_0317552
1004 nmdc:mga05p37_110913_c1
1005 nmdc:mga05p37_115687_c1
1006 nmdc:mga05p37_741775_c1
1007 nmdc:mga06r32_4289_c1
1008 Ga0495619_0126570
1009 Ga0500568_0003365
1010 Ga0501082_0001604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

161

288

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vma-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8447 152 264
2whn-assembly1.cif.gz_A n-terminal domain from the pilc type iv pilus biogenesis protein 0.8397 152 254
3c1q-assembly1.cif.gz_A the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8363 152 257
2vmb-assembly2.cif.gz_B the three-dimensional structure of the cytoplasmic domains of epsf from the type 2 secretion system of vibrio cholerae 0.8302 152 264
5nbg-assembly1.cif.gz_B structure of the cytoplasmic domain i of outf in the d. dadantii type ii secretion system 0.828 152 259
ID Description Score Start End Superfamily
af_P36646_52_165_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8223 156 260 1.20.81.30
af_P36646_249_359_1.20.81.30 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.8075 145 251 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.7988 152 264 1.20.81.30
3c1qB00 Mainly Alpha;Up-down Bundle;Receptor-associated Protein;Type II secretion system (T2SS), domain F 0.752 152 264 1.20.81.30
af_Q76PC3_7_147_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.7391 96 144 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A2V6ZGS9-F1-model_v4 Pilus assembly protein TadB 0.9449 80 288 GO:0005886
AF-A0A2V6ZGS9-F1-model_v4 Pilus assembly protein TadB 0.9236 80 288 GO:0005886
AF-A0A3B9MCK5-F1-model_v4 Secretion system protein 0.9183 85 326 GO:0005886
AF-A0A537VPR9-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.9091 128 326 GO:0005886
AF-A0A7V0XEU4-F1-model_v4 Type II secretion system protein GspF domain-containing protein 0.909 136 326 GO:0005886

Map