F452018

General Info

Members Datasets Scaffolds Average Seq Length
479 241 958 155

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100194896|Ga0068857_1001948963
Length 172
Sequence LEQKWRGPIGLESKWVGSMKSRLLITLVVSMVPEVGSADTIQWRRYAIPSTGANVDIPVSIFTEDAGSPENGIGRRFFTQDRRADLTLQSVPNPGNDSPAKFLEKRRPPAGIQYKRVTPRFFAVSSIRNGRTWYNRCNRANGYMHCVLINYPAAEDRQWDAVVTRISLSLAQ

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
232 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
238 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
241 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 8.77
Rhizosphere 84.34
Stem 0
Stem Tuber 0
Unclassified 32.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100194896 3300005577 Bacteria 1846
2 CNAas_1004116 3300000532 Unclassified 941
3 JGI24750J21931_1009725 3300002070 Bacteria 1243
4 JGI24744J21845_10068875 3300002077 Unclassified 646
5 JGI24742J22300_10007393 3300002244 Bacteria 1812
6 JGI24742J22300_10020766 3300002244 Bacteria 1120
7 JGI25406J46586_10000281 3300003203 Bacteria 22733
8 JGI25404J52841_10000009 3300003659 Bacteria 15548
9 JGI25404J52841_10011583 3300003659 Bacteria 1903
10 JGI25404J52841_10011820 3300003659 Bacteria 1886
11 JGI25404J52841_10016728 3300003659 Bacteria 1591
12 Ga0070683_100229016 3300005329 Bacteria 1767
13 Ga0070683_100374489 3300005329 Bacteria 1357
14 Ga0070670_100828894 3300005331 Unclassified 836
15 Ga0070670_101078891 3300005331 Unclassified 732
16 Ga0068869_100449020 3300005334 Bacteria 1068
17 Ga0070666_10121589 3300005335 Bacteria 1811
18 Ga0070666_10913912 3300005335 Bacteria 649
19 Ga0070680_101310809 3300005336 Unclassified 627
20 Ga0070682_100184611 3300005337 Bacteria 1460
21 Ga0070682_100676536 3300005337 Unclassified 825
22 Ga0068868_100010988 3300005338 Bacteria 6577
23 Ga0070660_100536412 3300005339 Bacteria 975
24 Ga0070689_100128354 3300005340 Bacteria 2031
25 Ga0070668_100064426 3300005347 Bacteria 2841
26 Ga0070668_100282150 3300005347 Bacteria 1388
27 Ga0070668_100373769 3300005347 Unclassified 1211
28 Ga0070669_100015777 3300005353 Bacteria 5387
29 Ga0070675_100483842 3300005354 Unclassified 1113
30 Ga0070675_101208333 3300005354 Bacteria 696
31 Ga0070675_101666209 3300005354 Unclassified 588
32 Ga0070671_100086834 3300005355 Bacteria 2618
33 Ga0070671_100219489 3300005355 Bacteria 1613
34 Ga0070671_100835943 3300005355 Unclassified 803
35 Ga0070674_100559931 3300005356 Unclassified 960
36 Ga0070674_100647960 3300005356 Unclassified 898
37 Ga0070674_101054874 3300005356 Bacteria 716
38 Ga0070688_100386760 3300005365 Bacteria 1032
39 Ga0070659_100027996 3300005366 Bacteria 4347
40 Ga0070659_101358588 3300005366 Unclassified 631
41 Ga0070667_100095555 3300005367 Bacteria 2562
42 Ga0070667_100898833 3300005367 Unclassified 824
43 Ga0070714_100711490 3300005435 Unclassified 969
44 Ga0070713_100111274 3300005436 Bacteria 2388
45 Ga0070710_10481341 3300005437 Unclassified 846
46 Ga0070701_10029088 3300005438 Bacteria 2721
47 Ga0070711_100013584 3300005439 Bacteria 5115
48 Ga0070700_100270472 3300005441 Bacteria 1227
49 Ga0070694_100150233 3300005444 Bacteria 1700
50 Ga0070663_100005341 3300005455 Bacteria 7627
51 Ga0070663_100007700 3300005455 Bacteria 6576
52 Ga0070663_100055257 3300005455 Bacteria 2841
53 Ga0070663_100067626 3300005455 Bacteria 2592
54 Ga0070663_100231815 3300005455 Bacteria 1454
55 Ga0070678_100022323 3300005456 Bacteria 4192
56 Ga0070678_100160959 3300005456 Bacteria 1818
57 Ga0068867_101254621 3300005459 Unclassified 682
58 Ga0070685_10040268 3300005466 Bacteria 2658
59 Ga0070685_10166455 3300005466 Bacteria 1409
60 Ga0070684_100940222 3300005535 Bacteria 810
61 Ga0068853_100019306 3300005539 Bacteria 5651
62 Ga0068853_100798573 3300005539 Unclassified 904
63 Ga0068853_101264899 3300005539 Unclassified 713
64 Ga0070672_100318077 3300005543 Bacteria 1323
65 Ga0070672_100897858 3300005543 Unclassified 783
66 Ga0070686_100901621 3300005544 Unclassified 719
67 Ga0070693_100921747 3300005547 Bacteria 656
68 Ga0070665_100090859 3300005548 Bacteria 3059
69 Ga0070665_100239905 3300005548 Bacteria 1813
70 Ga0070665_100312038 3300005548 Bacteria 1576
71 Ga0070665_100911335 3300005548 Bacteria 892
72 Ga0070665_101107854 3300005548 Unclassified 803
73 Ga0070665_101447273 3300005548 Bacteria 696
74 Ga0070704_100061619 3300005549 Bacteria 2686
75 Ga0068855_100172482 3300005563 Bacteria 2449
76 Ga0068855_100932371 3300005563 Unclassified 916
77 Ga0070664_100180109 3300005564 Bacteria 1878
78 Ga0070664_100689288 3300005564 Bacteria 951
79 Ga0068854_100148627 3300005578 Bacteria 1804
80 Ga0068854_101722593 3300005578 Unclassified 573
81 Ga0070702_100056864 3300005615 Bacteria 2261
82 Ga0070702_100076510 3300005615 Bacteria 1992
83 Ga0070702_101111634 3300005615 Bacteria 632
84 Ga0068852_100072732 3300005616 Bacteria 3022
85 Ga0068852_100247047 3300005616 Bacteria 1708
86 Ga0068852_100294983 3300005616 Bacteria 1568
87 Ga0068852_100716513 3300005616 Bacteria 1011
88 Ga0068859_102229676 3300005617 Unclassified 604
89 Ga0068864_100122615 3300005618 Bacteria 2326
90 Ga0068864_100196302 3300005618 Bacteria 1852
91 Ga0068864_100339025 3300005618 Bacteria 1416
92 Ga0068864_100421785 3300005618 Unclassified 1271
93 Ga0068866_10228402 3300005718 Unclassified 1127
94 Ga0068861_100211609 3300005719 Bacteria 1633
95 Ga0068861_100601210 3300005719 Unclassified 1009
96 Ga0068851_10531391 3300005834 Unclassified 709
97 Ga0068863_100195056 3300005841 Unclassified 1947
98 Ga0068863_101347632 3300005841 Unclassified 721
99 Ga0068858_100048745 3300005842 Bacteria 3923
100 Ga0068858_100205729 3300005842 Bacteria 1862
101 Ga0068858_100319917 3300005842 Bacteria 1483
102 Ga0068858_100684483 3300005842 Bacteria 997
103 Ga0068860_100006181 3300005843 Bacteria 12045
104 Ga0068860_100076775 3300005843 Bacteria 3177
105 Ga0068862_100041594 3300005844 Bacteria 3911
106 Ga0068862_100122135 3300005844 Bacteria 2297
107 Ga0068862_100722353 3300005844 Bacteria 967
108 Ga0081455_10130886 3300005937 Bacteria 1962
109 Ga0081540_1000746 3300005983 Bacteria 29936
110 Ga0081540_1005809 3300005983 Bacteria 9132
111 Ga0081540_1006961 3300005983 Bacteria 8141
112 Ga0081540_1010307 3300005983 Bacteria 6340
113 Ga0081540_1046503 3300005983 Bacteria 2191
114 Ga0081540_1064105 3300005983 Bacteria 1735
115 Ga0081540_1119065 3300005983 Bacteria 1100
116 Ga0081539_10001902 3300005985 Bacteria 32363
117 Ga0081539_10023497 3300005985 Bacteria 4038
118 Ga0081539_10070787 3300005985 Bacteria 1871
119 Ga0070717_10007341 3300006028 Bacteria 8180
120 Ga0075365_10075511 3300006038 Bacteria 2275
121 Ga0075368_10051424 3300006042 Bacteria 1638
122 Ga0075363_100218327 3300006048 Bacteria 1092
123 Ga0075364_10119746 3300006051 Bacteria 1762
124 Ga0070715_10004123 3300006163 Bacteria 4725
125 Ga0070716_100139561 3300006173 Unclassified 1543
126 Ga0070712_100082629 3300006175 Bacteria 2330
127 Ga0075362_10024659 3300006177 Bacteria 2553
128 Ga0075362_10035843 3300006177 Bacteria 2168
129 Ga0075362_10122017 3300006177 Bacteria 1234
130 Ga0075362_10331923 3300006177 Unclassified 759
131 Ga0075367_10012761 3300006178 Bacteria 4494
132 Ga0075366_10045651 3300006195 Bacteria 2596
133 Ga0097621_100109796 3300006237 Bacteria 2330
134 Ga0097621_100204396 3300006237 Bacteria 1716
135 Ga0097621_100206873 3300006237 Bacteria 1705
136 Ga0097621_100225066 3300006237 Bacteria 1636
137 Ga0097621_100310593 3300006237 Bacteria 1395
138 Ga0075370_10008415 3300006353 Bacteria 5309
139 Ga0068871_100073982 3300006358 Bacteria 2810
140 Ga0068871_100639171 3300006358 Unclassified 971
141 Ga0075434_100447109 3300006871 Bacteria 1313
142 Ga0068865_100062939 3300006881 Bacteria 2606
143 Ga0068865_100194748 3300006881 Bacteria 1570
144 Ga0097620_102229732 3300006931 Unclassified 604
145 Ga0105250_10071044 3300009092 Bacteria 1406
146 Ga0105250_10191924 3300009092 Unclassified 860
147 Ga0111539_10682922 3300009094 Bacteria 1195
148 Ga0105245_10007274 3300009098 Bacteria 9694
149 Ga0105245_10109822 3300009098 Bacteria 2563
150 Ga0105245_10416619 3300009098 Bacteria 1345
151 Ga0105247_10038781 3300009101 Bacteria 2909
152 Ga0114129_11191874 3300009147 Unclassified 949
153 Ga0105243_10072409 3300009148 Bacteria 2790
154 Ga0105243_10248990 3300009148 Unclassified 1585
155 Ga0105243_10282949 3300009148 Bacteria 1495
156 Ga0105243_10556409 3300009148 Bacteria 1097
157 Ga0105243_10885620 3300009148 Unclassified 887
158 Ga0105243_11115993 3300009148 Unclassified 798
159 Ga0105243_11685716 3300009148 Unclassified 662
160 Ga0105241_10061606 3300009174 Bacteria 2890
161 Ga0105241_10701381 3300009174 Unclassified 924
162 Ga0105242_10359291 3300009176 Bacteria 1347
163 Ga0105242_10659095 3300009176 Bacteria 1019
164 Ga0105242_10839102 3300009176 Unclassified 913
165 Ga0105242_10948012 3300009176 Unclassified 864
166 Ga0105248_10225547 3300009177 Bacteria 2109
167 Ga0105248_10629141 3300009177 Unclassified 1211
168 Ga0105237_10054327 3300009545 Bacteria 4013
169 Ga0105237_10638615 3300009545 Bacteria 1071
170 Ga0105237_10843550 3300009545 Unclassified 923
171 Ga0105237_11570466 3300009545 Bacteria 665
172 Ga0105237_12307646 3300009545 Unclassified 548
173 Ga0105238_10065599 3300009551 Bacteria 3632
174 Ga0105238_10185777 3300009551 Bacteria 2055
175 Ga0105238_10280614 3300009551 Bacteria 1647
176 Ga0105249_10055267 3300009553 Plasmid 3631
177 Ga0105249_10552974 3300009553 Unclassified 1202
178 Ga0105249_11238445 3300009553 Unclassified 817
179 Ga0105249_11487602 3300009553 Unclassified 749
180 Ga0105239_10136540 3300010375 Bacteria 2730
181 Ga0105239_10360449 3300010375 Bacteria 1642
182 Ga0105239_11286799 3300010375 Bacteria 843
183 Ga0105246_10007015 3300011119 Bacteria 6895
184 Ga0105246_10015943 3300011119 Bacteria 4753
185 Ga0105246_10251981 3300011119 Unclassified 1402
186 Ga0105246_10349061 3300011119 Bacteria 1212
187 Ga0105246_10534037 3300011119 Unclassified 1002
188 Ga0105246_10905606 3300011119 Unclassified 791
189 Ga0157371_10927548 3300013102 Unclassified 661
190 Ga0157369_10955239 3300013105 Unclassified 878
191 Ga0157374_10028290 3300013296 Bacteria 5064
192 Ga0157374_10056610 3300013296 Bacteria 3661
193 Ga0157374_10085752 3300013296 Bacteria 2995
194 Ga0157374_10671149 3300013296 Unclassified 1049
195 Ga0157374_10863799 3300013296 Unclassified 922
196 Ga0157374_11354758 3300013296 Unclassified 734
197 Ga0157378_10010927 3300013297 Bacteria 7942
198 Ga0157378_10468066 3300013297 Bacteria 1254
199 Ga0157378_10649395 3300013297 Unclassified 1070
200 Ga0163162_10029983 3300013306 Bacteria 5387
201 Ga0163162_10043006 3300013306 Bacteria 4522
202 Ga0163162_10254774 3300013306 Bacteria 1887
203 Ga0163162_10475861 3300013306 Bacteria 1380
204 Ga0163162_10525196 3300013306 Unclassified 1313
205 Ga0163162_11097350 3300013306 Unclassified 902
206 Ga0157372_11242827 3300013307 Bacteria 860
207 Ga0157375_10054643 3300013308 Bacteria 3934
208 Ga0157375_10060256 3300013308 Bacteria 3763
209 Ga0157375_10152238 3300013308 Bacteria 2449
210 Ga0157375_10179125 3300013308 Bacteria 2270
211 Ga0157375_10893410 3300013308 Bacteria 1033
212 Ga0157375_11095742 3300013308 Unclassified 932
213 Ga0163163_10052293 3300014325 Bacteria 4030
214 Ga0163163_10063677 3300014325 Bacteria 3657
215 Ga0163163_10331870 3300014325 Unclassified 1575
216 Ga0163163_10656076 3300014325 Unclassified 1113
217 Ga0163163_10834909 3300014325 Bacteria 985
218 Ga0157380_10039023 3300014326 Bacteria 3691
219 Ga0157380_10161721 3300014326 Unclassified 1947
220 Ga0157380_10286333 3300014326 Bacteria 1510
221 Ga0157380_10294110 3300014326 Bacteria 1493
222 Ga0157380_10445638 3300014326 Unclassified 1242
223 Ga0157380_10563905 3300014326 Unclassified 1120
224 Ga0157380_12442269 3300014326 Unclassified 588
225 Ga0157377_10080372 3300014745 Unclassified 1904
226 Ga0157379_10288556 3300014968 Bacteria 1494
227 Ga0157379_10291850 3300014968 Unclassified 1485
228 Ga0157376_10097564 3300014969 Bacteria 2560
229 Ga0157376_10114636 3300014969 Bacteria 2378
230 Ga0157376_10280566 3300014969 Bacteria 1569
231 Ga0163161_10282750 3300017792 Unclassified 1302
232 Ga0163161_10807980 3300017792 Bacteria 789
233 Ga0207666_1058022 3300025271 Bacteria 618
234 Ga0207697_10012797 3300025315 Bacteria 3510
235 Ga0207697_10065303 3300025315 Unclassified 1518
236 Ga0207697_10095233 3300025315 Unclassified 1265
237 Ga0207692_10028305 3300025898 Bacteria 2649
238 Ga0207710_10019440 3300025900 Bacteria 2899
239 Ga0207688_10037732 3300025901 Bacteria 2680
240 Ga0207688_10049875 3300025901 Bacteria 2341
241 Ga0207688_10618726 3300025901 Unclassified 683
242 Ga0207680_10459501 3300025903 Unclassified 904
243 Ga0207647_10097395 3300025904 Bacteria 1749
244 Ga0207647_10219651 3300025904 Unclassified 1096
245 Ga0207647_10271040 3300025904 Unclassified 970
246 Ga0207685_10250951 3300025905 Unclassified 856
247 Ga0207645_10009268 3300025907 Bacteria 6818
248 Ga0207643_10238700 3300025908 Bacteria 1117
249 Ga0207705_10600312 3300025909 Unclassified 856
250 Ga0207654_10040133 3300025911 Bacteria 2636
251 Ga0207654_10188582 3300025911 Unclassified 1350
252 Ga0207671_10116250 3300025914 Bacteria 2040
253 Ga0207693_11032320 3300025915 Unclassified 627
254 Ga0207663_10013845 3300025916 Bacteria 4398
255 Ga0207662_10118608 3300025918 Bacteria 1657
256 Ga0207657_10101415 3300025919 Bacteria 2389
257 Ga0207649_10612909 3300025920 Unclassified 838
258 Ga0207694_10065181 3300025924 Bacteria 2840
259 Ga0207650_10305730 3300025925 Bacteria 1300
260 Ga0207659_10107103 3300025926 Bacteria 2118
261 Ga0207659_11485175 3300025926 Unclassified 580
262 Ga0207687_10004960 3300025927 Bacteria 8832
263 Ga0207687_10031615 3300025927 Bacteria 3578
264 Ga0207687_10125578 3300025927 Bacteria 1926
265 Ga0207687_10129096 3300025927 Bacteria 1902
266 Ga0207700_11309232 3300025928 Unclassified 645
267 Ga0207664_10037513 3300025929 Bacteria 3752
268 Ga0207644_10118126 3300025931 Bacteria 2015
269 Ga0207644_10270799 3300025931 Bacteria 1361
270 Ga0207644_10734595 3300025931 Unclassified 824
271 Ga0207690_10040813 3300025932 Bacteria 3037
272 Ga0207706_10248116 3300025933 Bacteria 1555
273 Ga0207706_10862082 3300025933 Unclassified 767
274 Ga0207709_10034315 3300025935 Bacteria 2990
275 Ga0207709_10052537 3300025935 Bacteria 2504
276 Ga0207709_10618163 3300025935 Unclassified 859
277 Ga0207709_11108248 3300025935 Unclassified 650
278 Ga0207669_10033829 3300025937 Bacteria 2889
279 Ga0207669_10095284 3300025937 Unclassified 1951
280 Ga0207704_10124150 3300025938 Bacteria 1773
281 Ga0207665_10011480 3300025939 Bacteria 5819
282 Ga0207691_10145307 3300025940 Bacteria 2088
283 Ga0207691_10164603 3300025940 Bacteria 1944
284 Ga0207691_10229046 3300025940 Bacteria 1610
285 Ga0207711_10643073 3300025941 Unclassified 989
286 Ga0207711_10708171 3300025941 Bacteria 939
287 Ga0207689_10258880 3300025942 Bacteria 1439
288 Ga0207689_10409560 3300025942 Bacteria 1131
289 Ga0207679_10184236 3300025945 Bacteria 1730
290 Ga0207679_10283413 3300025945 Bacteria 1422
291 Ga0207667_10257025 3300025949 Bacteria 1786
292 Ga0207651_10208071 3300025960 Unclassified 1573
293 Ga0207712_10635181 3300025961 Unclassified 927
294 Ga0207668_10024907 3300025972 Bacteria 3868
295 Ga0207668_10292177 3300025972 Unclassified 1341
296 Ga0207668_10656633 3300025972 Unclassified 918
297 Ga0207668_11043974 3300025972 Unclassified 731
298 Ga0207658_10226912 3300025986 Bacteria 1574
299 Ga0207677_10062197 3300026023 Bacteria 2588
300 Ga0207677_10224437 3300026023 Bacteria 1509
301 Ga0207677_10867921 3300026023 Unclassified 812
302 Ga0207703_10020634 3300026035 Bacteria 5154
303 Ga0207703_10274781 3300026035 Unclassified 1528
304 Ga0207703_10334919 3300026035 Bacteria 1389
305 Ga0207639_10266890 3300026041 Bacteria 1499
306 Ga0207639_10365968 3300026041 Unclassified 1291
307 Ga0207639_10384851 3300026041 Unclassified 1260
308 Ga0207639_11238211 3300026041 Unclassified 700
309 Ga0207678_10008798 3300026067 Bacteria 8883
310 Ga0207678_10068038 3300026067 Bacteria 3056
311 Ga0207678_10130152 3300026067 Bacteria 2146
312 Ga0207678_10181490 3300026067 Bacteria 1797
313 Ga0207678_10289196 3300026067 Bacteria 1407
314 Ga0207678_10883832 3300026067 Unclassified 790
315 Ga0207678_11286082 3300026067 Unclassified 647
316 Ga0207708_10137714 3300026075 Bacteria 1913
317 Ga0207702_12335833 3300026078 Bacteria 522
318 Ga0207641_10188121 3300026088 Unclassified 1896
319 Ga0207648_10002954 3300026089 Bacteria 17980
320 Ga0207676_10072362 3300026095 Bacteria 2771
321 Ga0207676_10166659 3300026095 Bacteria 1915
322 Ga0207676_10593337 3300026095 Unclassified 1063
323 Ga0207676_11134986 3300026095 Bacteria 773
324 Ga0207676_11220553 3300026095 Unclassified 746
325 Ga0207674_10374887 3300026116 Bacteria 1375
326 Ga0207674_10376798 3300026116 Bacteria 1372
327 Ga0207675_100060617 3300026118 Bacteria 3532
328 Ga0207675_100424772 3300026118 Unclassified 1313
329 Ga0207675_101118249 3300026118 Bacteria 808
330 Ga0207675_102210623 3300026118 Unclassified 565
331 Ga0207683_10017519 3300026121 Bacteria 6106
332 Ga0207683_10097363 3300026121 Bacteria 2624
333 Ga0207683_10124295 3300026121 Bacteria 2318
334 Ga0207683_10220825 3300026121 Bacteria 1727
335 Ga0207683_10249145 3300026121 Bacteria 1621
336 Ga0207698_10104814 3300026142 Bacteria 2354
337 Ga0207698_10816746 3300026142 Unclassified 936
338 Ga0209813_10004061 3300027866 Bacteria 3469
339 Ga0268266_10052133 3300028379 Bacteria 3513
340 Ga0268266_10093429 3300028379 Bacteria 2639
341 Ga0268266_10273089 3300028379 Bacteria 1570
342 Ga0268266_10608168 3300028379 Bacteria 1050
343 Ga0268265_10195180 3300028380 Bacteria 1751
344 Ga0268265_10361950 3300028380 Bacteria 1328
345 Ga0268265_10965348 3300028380 Unclassified 840
346 Ga0268264_10837921 3300028381 Unclassified 920
347 Ga0268264_11290278 3300028381 Bacteria 740
348 Ga0307517_10125649 3300028786 Bacteria 1873
349 Ga0307408_100284068 3300031548 Bacteria 1379
350 Ga0307406_10634786 3300031901 Bacteria 885
351 Ga0307406_10926514 3300031901 Bacteria 743
352 Ga0307411_10156000 3300032005 Bacteria 1703
353 Ga0373931_0297422 3300035691 Unclassified 996
354 Ga0373927_0304650 3300035695 Bacteria 1049
355 Ga0395900_1479978 3300037418 Bacteria 591
356 Ga0395898_0506374 3300037466 Bacteria 1148
357 Ga0439465_0248177 3300041413 Bacteria 658
358 Ga0451793_1148458 3300041452 Unclassified 638
359 Ga0451793_1866754 3300041452 Unclassified 945
360 Ga0451839_1042516 3300041496 Unclassified 674
361 Ga0451845_0350038 3300041501 Bacteria 649
362 Ga0451853_3010924 3300041512 Unclassified 629
363 Ga0495617_152508 3300046452 Bacteria 735
364 Ga0495617_164979 3300046452 Bacteria 701
365 Ga0495603_0098519 3300046455 Bacteria 1707
366 Ga0495603_0517031 3300046455 Unclassified 684
367 Ga0495629_0014551 3300046459 Bacteria 5662
368 Ga0495629_0116519 3300046459 Bacteria 1862
369 Ga0495629_0590749 3300046459 Bacteria 743
370 Ga0495638_0507364 3300046460 Unclassified 606
371 Ga0495605_0380452 3300046474 Unclassified 589
372 Ga0495639_0391332 3300046475 Bacteria 701
373 Ga0495584_0418392 3300046491 Bacteria 681
374 Ga0495584_0474349 3300046491 Bacteria 637
375 Ga0495585_0060667 3300046492 Bacteria 2081
376 Ga0495585_0083725 3300046492 Bacteria 1726
377 Ga0495585_0287216 3300046492 Bacteria 812
378 Ga0495585_0368120 3300046492 Unclassified 696
379 Ga0495594_0525002 3300046499 Bacteria 672
380 Ga0495596_0107775 3300046500 Bacteria 1082
381 Ga0495596_0401668 3300046500 Unclassified 534
382 Ga0495606_0115448 3300046507 Bacteria 1614
383 Ga0495606_0330717 3300046507 Unclassified 815
384 Ga0495616_0187747 3300046513 Bacteria 915
385 Ga0495620_0116102 3300046515 Unclassified 1058
386 Ga0495620_0132688 3300046515 Unclassified 977
387 Ga0495628_1199877 3300046516 Unclassified 515
388 Ga0495630_1324252 3300046517 Unclassified 543
389 Ga0495631_0258356 3300046518 Bacteria 742
390 Ga0495631_0398369 3300046518 Unclassified 586
391 Ga0495632_0283556 3300046519 Unclassified 737
392 Ga0495643_0215340 3300046522 Unclassified 914
393 Ga0495644_0144430 3300046523 Bacteria 909
394 Ga0495644_0209840 3300046523 Unclassified 752
395 Ga0495648_0432513 3300046524 Bacteria 580
396 Ga0495663_0077320 3300046525 Bacteria 1067
397 Ga0495598_0114930 3300046537 Bacteria 906
398 Ga0495598_0159457 3300046537 Bacteria 793
399 Ga0495621_0330062 3300046539 Bacteria 637
400 Ga0495633_0136884 3300046558 Bacteria 1133
401 Ga0495656_0179829 3300046615 Unclassified 1039
402 Ga0495656_0281695 3300046615 Unclassified 847
403 Ga0495668_0012595 3300046616 Bacteria 5014
404 Ga0495668_0063215 3300046616 Bacteria 2039
405 Ga0495668_0082884 3300046616 Bacteria 1759
406 Ga0495625_0668566 3300046660 Bacteria 617
407 Ga0495625_0731692 3300046660 Unclassified 581
408 Ga0495661_0291831 3300046665 Unclassified 819
409 Ga0495657_0592785 3300046675 Bacteria 642
410 Ga0495669_0058833 3300046684 Bacteria 1735
411 Ga0495669_0155810 3300046684 Unclassified 1083
412 Ga0495669_0162128 3300046684 Unclassified 1061
413 Ga0495669_0351986 3300046684 Bacteria 712
414 Ga0495670_0096757 3300046691 Bacteria 1516
415 Ga0495589_0206407 3300046794 Unclassified 926
416 Ga0495604_0457337 3300047317 Unclassified 833
417 Ga0495685_163901 3300047447 Bacteria 719
418 Ga0495686_0117005 3300047472 Bacteria 1593
419 Ga0495686_0342596 3300047472 Bacteria 814
420 Ga0495593_0134882 3300047673 Bacteria 1252
421 Ga0496100_0053459 3300048903 Bacteria 2630
422 Ga0496100_0382103 3300048903 Bacteria 1070
423 Ga0496101_0042451 3300048904 Bacteria 3246
424 Ga0496101_0315994 3300048904 Unclassified 1225
425 Ga0496101_0440442 3300048904 Unclassified 1028
426 Ga0496101_0945442 3300048904 Unclassified 678
427 Ga0496101_1260240 3300048904 Unclassified 579
428 Ga0496102_0009668 3300048905 Bacteria 8294
429 Ga0496102_0078767 3300048905 Bacteria 3034
430 Ga0496102_0763120 3300048905 Unclassified 890
431 Ga0496103_0362078 3300048906 Bacteria 932
432 Ga0496104_0031480 3300048907 Bacteria 4934
433 Ga0496104_0098144 3300048907 Bacteria 2804
434 Ga0496104_0287468 3300048907 Unclassified 1557
435 Ga0496105_0110752 3300048908 Bacteria 2266
436 Ga0496105_0587689 3300048908 Unclassified 865
437 Ga0496105_0800346 3300048908 Unclassified 717
438 Ga0496106_0370773 3300048909 Unclassified 1150
439 Ga0496107_0251745 3300048910 Bacteria 1314
440 Ga0496108_0078562 3300048911 Bacteria 2793
441 Ga0496108_0256086 3300048911 Bacteria 1523
442 Ga0496109_0040676 3300048912 Bacteria 4210
443 Ga0496109_0156964 3300048912 Bacteria 2131
444 Ga0496109_0520925 3300048912 Bacteria 1122
445 Ga0496109_0886921 3300048912 Unclassified 830
446 Ga0496110_0024282 3300048913 Bacteria 5165
447 Ga0496110_0088917 3300048913 Bacteria 2760
448 Ga0496110_0156895 3300048913 Bacteria 2062
449 Ga0496110_1251938 3300048913 Unclassified 651
450 Ga0496111_0050703 3300048914 Bacteria 2995
451 Ga0496112_0001551 3300048915 Bacteria 17764
452 Ga0496112_0138423 3300048915 Bacteria 2404
453 Ga0496112_0214237 3300048915 Bacteria 1883
454 Ga0496112_0342294 3300048915 Bacteria 1439
455 Ga0496112_0547137 3300048915 Unclassified 1091
456 Ga0496114_0055054 3300048917 Bacteria 3317
457 Ga0496114_1057466 3300048917 Bacteria 696
458 Ga0496115_0174966 3300048918 Unclassified 1775
459 Ga0496115_0252610 3300048918 Bacteria 1451
460 Ga0496115_0700932 3300048918 Unclassified 796
461 Ga0496121_0467678 3300048924 Unclassified 808
462 Ga0496125_0155119 3300048928 Bacteria 1566
463 nmdc:mga03683_152927_c1 3300050489 Bacteria 1042
464 nmdc:mga03683_195881_c1 3300050489 Bacteria 926
465 nmdc:mga03683_47284_c1 3300050489 Bacteria 1785
466 nmdc:mga00v17_749270_c1 3300050491 Unclassified 624
467 nmdc:mga0yw44_32698_c1 3300050492 Bacteria 3033
468 nmdc:mga0k408_10678_c1 3300050493 Bacteria 4975
469 nmdc:mga06z11_5470_c1 3300050494 Bacteria 5099
470 nmdc:mga04h51_9559_c1 3300050495 Bacteria 2635
471 nmdc:mga07m45_5080_c1 3300050496 Bacteria 6511
472 nmdc:mga08y16_260107_c1 3300050511 Bacteria 1792
473 nmdc:mga0sz30_3300_c2 3300050516 Bacteria 4801
474 Ga0495655_0094068 3300053083 Unclassified 878
475 Ga0500628_178267 3300053129 Unclassified 606
476 Ga0500620_036024 3300053155 Bacteria 1598
477 Ga0500627_0073736 3300053158 Bacteria 1515
478 2885390933 2885383462 Bacteria 9473874
479 8006985778 8006984368 Bacteria 9651211
480 Ga0068857_100194896
481 CNAas_1004116
482 JGI24750J21931_1009725
483 JGI24744J21845_10068875
484 JGI24742J22300_10007393
485 JGI24742J22300_10020766
486 JGI25406J46586_10000281
487 JGI25404J52841_10000009
488 JGI25404J52841_10011583
489 JGI25404J52841_10011820
490 JGI25404J52841_10016728
491 Ga0070683_100229016
492 Ga0070683_100374489
493 Ga0070670_100828894
494 Ga0070670_101078891
495 Ga0068869_100449020
496 Ga0070666_10121589
497 Ga0070666_10913912
498 Ga0070680_101310809
499 Ga0070682_100184611
500 Ga0070682_100676536
501 Ga0068868_100010988
502 Ga0070660_100536412
503 Ga0070689_100128354
504 Ga0070668_100064426
505 Ga0070668_100282150
506 Ga0070668_100373769
507 Ga0070669_100015777
508 Ga0070675_100483842
509 Ga0070675_101208333
510 Ga0070675_101666209
511 Ga0070671_100086834
512 Ga0070671_100219489
513 Ga0070671_100835943
514 Ga0070674_100559931
515 Ga0070674_100647960
516 Ga0070674_101054874
517 Ga0070688_100386760
518 Ga0070659_100027996
519 Ga0070659_101358588
520 Ga0070667_100095555
521 Ga0070667_100898833
522 Ga0070714_100711490
523 Ga0070713_100111274
524 Ga0070710_10481341
525 Ga0070701_10029088
526 Ga0070711_100013584
527 Ga0070700_100270472
528 Ga0070694_100150233
529 Ga0070663_100005341
530 Ga0070663_100007700
531 Ga0070663_100055257
532 Ga0070663_100067626
533 Ga0070663_100231815
534 Ga0070678_100022323
535 Ga0070678_100160959
536 Ga0068867_101254621
537 Ga0070685_10040268
538 Ga0070685_10166455
539 Ga0070684_100940222
540 Ga0068853_100019306
541 Ga0068853_100798573
542 Ga0068853_101264899
543 Ga0070672_100318077
544 Ga0070672_100897858
545 Ga0070686_100901621
546 Ga0070693_100921747
547 Ga0070665_100090859
548 Ga0070665_100239905
549 Ga0070665_100312038
550 Ga0070665_100911335
551 Ga0070665_101107854
552 Ga0070665_101447273
553 Ga0070704_100061619
554 Ga0068855_100172482
555 Ga0068855_100932371
556 Ga0070664_100180109
557 Ga0070664_100689288
558 Ga0068854_100148627
559 Ga0068854_101722593
560 Ga0070702_100056864
561 Ga0070702_100076510
562 Ga0070702_101111634
563 Ga0068852_100072732
564 Ga0068852_100247047
565 Ga0068852_100294983
566 Ga0068852_100716513
567 Ga0068859_102229676
568 Ga0068864_100122615
569 Ga0068864_100196302
570 Ga0068864_100339025
571 Ga0068864_100421785
572 Ga0068866_10228402
573 Ga0068861_100211609
574 Ga0068861_100601210
575 Ga0068851_10531391
576 Ga0068863_100195056
577 Ga0068863_101347632
578 Ga0068858_100048745
579 Ga0068858_100205729
580 Ga0068858_100319917
581 Ga0068858_100684483
582 Ga0068860_100006181
583 Ga0068860_100076775
584 Ga0068862_100041594
585 Ga0068862_100122135
586 Ga0068862_100722353
587 Ga0081455_10130886
588 Ga0081540_1000746
589 Ga0081540_1005809
590 Ga0081540_1006961
591 Ga0081540_1010307
592 Ga0081540_1046503
593 Ga0081540_1064105
594 Ga0081540_1119065
595 Ga0081539_10001902
596 Ga0081539_10023497
597 Ga0081539_10070787
598 Ga0070717_10007341
599 Ga0075365_10075511
600 Ga0075368_10051424
601 Ga0075363_100218327
602 Ga0075364_10119746
603 Ga0070715_10004123
604 Ga0070716_100139561
605 Ga0070712_100082629
606 Ga0075362_10024659
607 Ga0075362_10035843
608 Ga0075362_10122017
609 Ga0075362_10331923
610 Ga0075367_10012761
611 Ga0075366_10045651
612 Ga0097621_100109796
613 Ga0097621_100204396
614 Ga0097621_100206873
615 Ga0097621_100225066
616 Ga0097621_100310593
617 Ga0075370_10008415
618 Ga0068871_100073982
619 Ga0068871_100639171
620 Ga0075434_100447109
621 Ga0068865_100062939
622 Ga0068865_100194748
623 Ga0097620_102229732
624 Ga0105250_10071044
625 Ga0105250_10191924
626 Ga0111539_10682922
627 Ga0105245_10007274
628 Ga0105245_10109822
629 Ga0105245_10416619
630 Ga0105247_10038781
631 Ga0114129_11191874
632 Ga0105243_10072409
633 Ga0105243_10248990
634 Ga0105243_10282949
635 Ga0105243_10556409
636 Ga0105243_10885620
637 Ga0105243_11115993
638 Ga0105243_11685716
639 Ga0105241_10061606
640 Ga0105241_10701381
641 Ga0105242_10359291
642 Ga0105242_10659095
643 Ga0105242_10839102
644 Ga0105242_10948012
645 Ga0105248_10225547
646 Ga0105248_10629141
647 Ga0105237_10054327
648 Ga0105237_10638615
649 Ga0105237_10843550
650 Ga0105237_11570466
651 Ga0105237_12307646
652 Ga0105238_10065599
653 Ga0105238_10185777
654 Ga0105238_10280614
655 Ga0105249_10055267
656 Ga0105249_10552974
657 Ga0105249_11238445
658 Ga0105249_11487602
659 Ga0105239_10136540
660 Ga0105239_10360449
661 Ga0105239_11286799
662 Ga0105246_10007015
663 Ga0105246_10015943
664 Ga0105246_10251981
665 Ga0105246_10349061
666 Ga0105246_10534037
667 Ga0105246_10905606
668 Ga0157371_10927548
669 Ga0157369_10955239
670 Ga0157374_10028290
671 Ga0157374_10056610
672 Ga0157374_10085752
673 Ga0157374_10671149
674 Ga0157374_10863799
675 Ga0157374_11354758
676 Ga0157378_10010927
677 Ga0157378_10468066
678 Ga0157378_10649395
679 Ga0163162_10029983
680 Ga0163162_10043006
681 Ga0163162_10254774
682 Ga0163162_10475861
683 Ga0163162_10525196
684 Ga0163162_11097350
685 Ga0157372_11242827
686 Ga0157375_10054643
687 Ga0157375_10060256
688 Ga0157375_10152238
689 Ga0157375_10179125
690 Ga0157375_10893410
691 Ga0157375_11095742
692 Ga0163163_10052293
693 Ga0163163_10063677
694 Ga0163163_10331870
695 Ga0163163_10656076
696 Ga0163163_10834909
697 Ga0157380_10039023
698 Ga0157380_10161721
699 Ga0157380_10286333
700 Ga0157380_10294110
701 Ga0157380_10445638
702 Ga0157380_10563905
703 Ga0157380_12442269
704 Ga0157377_10080372
705 Ga0157379_10288556
706 Ga0157379_10291850
707 Ga0157376_10097564
708 Ga0157376_10114636
709 Ga0157376_10280566
710 Ga0163161_10282750
711 Ga0163161_10807980
712 Ga0207666_1058022
713 Ga0207697_10012797
714 Ga0207697_10065303
715 Ga0207697_10095233
716 Ga0207692_10028305
717 Ga0207710_10019440
718 Ga0207688_10037732
719 Ga0207688_10049875
720 Ga0207688_10618726
721 Ga0207680_10459501
722 Ga0207647_10097395
723 Ga0207647_10219651
724 Ga0207647_10271040
725 Ga0207685_10250951
726 Ga0207645_10009268
727 Ga0207643_10238700
728 Ga0207705_10600312
729 Ga0207654_10040133
730 Ga0207654_10188582
731 Ga0207671_10116250
732 Ga0207693_11032320
733 Ga0207663_10013845
734 Ga0207662_10118608
735 Ga0207657_10101415
736 Ga0207649_10612909
737 Ga0207694_10065181
738 Ga0207650_10305730
739 Ga0207659_10107103
740 Ga0207659_11485175
741 Ga0207687_10004960
742 Ga0207687_10031615
743 Ga0207687_10125578
744 Ga0207687_10129096
745 Ga0207700_11309232
746 Ga0207664_10037513
747 Ga0207644_10118126
748 Ga0207644_10270799
749 Ga0207644_10734595
750 Ga0207690_10040813
751 Ga0207706_10248116
752 Ga0207706_10862082
753 Ga0207709_10034315
754 Ga0207709_10052537
755 Ga0207709_10618163
756 Ga0207709_11108248
757 Ga0207669_10033829
758 Ga0207669_10095284
759 Ga0207704_10124150
760 Ga0207665_10011480
761 Ga0207691_10145307
762 Ga0207691_10164603
763 Ga0207691_10229046
764 Ga0207711_10643073
765 Ga0207711_10708171
766 Ga0207689_10258880
767 Ga0207689_10409560
768 Ga0207679_10184236
769 Ga0207679_10283413
770 Ga0207667_10257025
771 Ga0207651_10208071
772 Ga0207712_10635181
773 Ga0207668_10024907
774 Ga0207668_10292177
775 Ga0207668_10656633
776 Ga0207668_11043974
777 Ga0207658_10226912
778 Ga0207677_10062197
779 Ga0207677_10224437
780 Ga0207677_10867921
781 Ga0207703_10020634
782 Ga0207703_10274781
783 Ga0207703_10334919
784 Ga0207639_10266890
785 Ga0207639_10365968
786 Ga0207639_10384851
787 Ga0207639_11238211
788 Ga0207678_10008798
789 Ga0207678_10068038
790 Ga0207678_10130152
791 Ga0207678_10181490
792 Ga0207678_10289196
793 Ga0207678_10883832
794 Ga0207678_11286082
795 Ga0207708_10137714
796 Ga0207702_12335833
797 Ga0207641_10188121
798 Ga0207648_10002954
799 Ga0207676_10072362
800 Ga0207676_10166659
801 Ga0207676_10593337
802 Ga0207676_11134986
803 Ga0207676_11220553
804 Ga0207674_10374887
805 Ga0207674_10376798
806 Ga0207675_100060617
807 Ga0207675_100424772
808 Ga0207675_101118249
809 Ga0207675_102210623
810 Ga0207683_10017519
811 Ga0207683_10097363
812 Ga0207683_10124295
813 Ga0207683_10220825
814 Ga0207683_10249145
815 Ga0207698_10104814
816 Ga0207698_10816746
817 Ga0209813_10004061
818 Ga0268266_10052133
819 Ga0268266_10093429
820 Ga0268266_10273089
821 Ga0268266_10608168
822 Ga0268265_10195180
823 Ga0268265_10361950
824 Ga0268265_10965348
825 Ga0268264_10837921
826 Ga0268264_11290278
827 Ga0307517_10125649
828 Ga0307408_100284068
829 Ga0307406_10634786
830 Ga0307406_10926514
831 Ga0307411_10156000
832 Ga0373931_0297422
833 Ga0373927_0304650
834 Ga0395900_1479978
835 Ga0395898_0506374
836 Ga0439465_0248177
837 Ga0451793_1148458
838 Ga0451793_1866754
839 Ga0451839_1042516
840 Ga0451845_0350038
841 Ga0451853_3010924
842 Ga0495617_152508
843 Ga0495617_164979
844 Ga0495603_0098519
845 Ga0495603_0517031
846 Ga0495629_0014551
847 Ga0495629_0116519
848 Ga0495629_0590749
849 Ga0495638_0507364
850 Ga0495605_0380452
851 Ga0495639_0391332
852 Ga0495584_0418392
853 Ga0495584_0474349
854 Ga0495585_0060667
855 Ga0495585_0083725
856 Ga0495585_0287216
857 Ga0495585_0368120
858 Ga0495594_0525002
859 Ga0495596_0107775
860 Ga0495596_0401668
861 Ga0495606_0115448
862 Ga0495606_0330717
863 Ga0495616_0187747
864 Ga0495620_0116102
865 Ga0495620_0132688
866 Ga0495628_1199877
867 Ga0495630_1324252
868 Ga0495631_0258356
869 Ga0495631_0398369
870 Ga0495632_0283556
871 Ga0495643_0215340
872 Ga0495644_0144430
873 Ga0495644_0209840
874 Ga0495648_0432513
875 Ga0495663_0077320
876 Ga0495598_0114930
877 Ga0495598_0159457
878 Ga0495621_0330062
879 Ga0495633_0136884
880 Ga0495656_0179829
881 Ga0495656_0281695
882 Ga0495668_0012595
883 Ga0495668_0063215
884 Ga0495668_0082884
885 Ga0495625_0668566
886 Ga0495625_0731692
887 Ga0495661_0291831
888 Ga0495657_0592785
889 Ga0495669_0058833
890 Ga0495669_0155810
891 Ga0495669_0162128
892 Ga0495669_0351986
893 Ga0495670_0096757
894 Ga0495589_0206407
895 Ga0495604_0457337
896 Ga0495685_163901
897 Ga0495686_0117005
898 Ga0495686_0342596
899 Ga0495593_0134882
900 Ga0496100_0053459
901 Ga0496100_0382103
902 Ga0496101_0042451
903 Ga0496101_0315994
904 Ga0496101_0440442
905 Ga0496101_0945442
906 Ga0496101_1260240
907 Ga0496102_0009668
908 Ga0496102_0078767
909 Ga0496102_0763120
910 Ga0496103_0362078
911 Ga0496104_0031480
912 Ga0496104_0098144
913 Ga0496104_0287468
914 Ga0496105_0110752
915 Ga0496105_0587689
916 Ga0496105_0800346
917 Ga0496106_0370773
918 Ga0496107_0251745
919 Ga0496108_0078562
920 Ga0496108_0256086
921 Ga0496109_0040676
922 Ga0496109_0156964
923 Ga0496109_0520925
924 Ga0496109_0886921
925 Ga0496110_0024282
926 Ga0496110_0088917
927 Ga0496110_0156895
928 Ga0496110_1251938
929 Ga0496111_0050703
930 Ga0496112_0001551
931 Ga0496112_0138423
932 Ga0496112_0214237
933 Ga0496112_0342294
934 Ga0496112_0547137
935 Ga0496114_0055054
936 Ga0496114_1057466
937 Ga0496115_0174966
938 Ga0496115_0252610
939 Ga0496115_0700932
940 Ga0496121_0467678
941 Ga0496125_0155119
942 nmdc:mga03683_152927_c1
943 nmdc:mga03683_195881_c1
944 nmdc:mga03683_47284_c1
945 nmdc:mga00v17_749270_c1
946 nmdc:mga0yw44_32698_c1
947 nmdc:mga0k408_10678_c1
948 nmdc:mga06z11_5470_c1
949 nmdc:mga04h51_9559_c1
950 nmdc:mga07m45_5080_c1
951 nmdc:mga08y16_260107_c1
952 nmdc:mga0sz30_3300_c2
953 Ga0495655_0094068
954 Ga0500628_178267
955 Ga0500620_036024
956 Ga0500627_0073736
957 2885390933
958 8006985778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xb3-assembly1.cif.gz_A the structure of cyanobacterial psbp 0.7437 26 152
2lnj-assembly1.cif.gz_A solution structure of cyanobacterial psbp (cyanop) from synechocystis sp. pcc 6803 0.7335 24 152
7pi5-assembly1.cif.gz_p unstacked stretched dunaliella psii 0.7039 26 152
1v2b-assembly1.cif.gz_A crystal structure of psbp protein in the oxygen-evolving complex of photosystem ii from higher plants 0.7011 24 152
5xnl-assembly1.cif.gz_p structure of stacked c2s2m2-type psii-lhcii supercomplex from pisum sativum 0.6979 23 152
ID Description Score Start End Superfamily
af_A4I937_6_264_3.70.10.10 Alpha Beta;Box;Proliferating Cell Nuclear Antigen; 0.8004 104 135 3.70.10.10
af_Q6ATY3_75_252_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7553 25 152 3.40.1000.10
2xb3A00 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7437 26 152 3.40.1000.10
af_Q54C86_7_153_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7405 27 152 3.40.1000.10
af_A4IBK2_445_596_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.7403 27 152 3.40.1000.10
ID Description Score Start End GO Terms
AF-A0A2A2V554-F1-model_v4 Uncharacterized protein 0.9772 24 153
AF-A0A537QM49-F1-model_v4 Secreted protein 0.9738 24 137
AF-A0A023XAU7-F1-model_v4 deleted 0.9645 26 153
AF-I2QUT6-F1-model_v4 Uncharacterized protein 0.9642 64 155
AF-M4Z947-F1-model_v4 Uncharacterized protein 0.9641 24 153

Map