F450975

General Info

Members Datasets Scaffolds Average Seq Length
473 179 473 349

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100126391|Ga0070698_1001263913
Length 390
Sequence MNPVERAIRSVDATQRRFTPTAFVFGVVKKYGDDNGGVLASNLAYSAFVSLFPLLLVLVTILGLAAAVDAAFKAEVLRAVAGQVPLIGNQLTGNVHQLKRSSIIGLIVGFVXXXWGSAGLAQAGLFTMEQVWNLPGPARPGYVQRLGRAGLFLALLGGGVIVTTALASLSTYLHDGLAVKIPLELMTAAFNVGMYIGAFRALTPKGVPTRSLLPGAVTGGILWTVLQVLGTYLVHHFLHSDSVYGVFGTVLGLLAWIYLAVEITVYSAEINVVLARRLWPRSIVQPPLTEADRVSMALQALQNQRRPEQQIEVTFDDRPPGAEVPDQTPRTPDDVAPPVRVPVPAHVAQVPEPRGGSDPDSATPAGLAGPASSAAGRPASARQCRVPASR

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
45 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
46 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
47 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
88 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.59
Rhizosphere 94.29
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10021680 3300003659 Bacteria 1391
2 Ga0068869_100098989 3300005334 Bacteria 2203
3 Ga0068869_100107674 3300005334 Bacteria 2117
4 Ga0070680_100293627 3300005336 Bacteria 1378
5 Ga0070682_100101284 3300005337 Bacteria 1902
6 Ga0070709_10000050 3300005434 Bacteria 92617
7 Ga0070709_10001376 3300005434 Bacteria 13243
8 Ga0070709_10015283 3300005434 Bacteria 4365
9 Ga0070714_100004903 3300005435 Bacteria 10163
10 Ga0070714_100005682 3300005435 Bacteria 9547
11 Ga0070714_100010751 3300005435 Bacteria 7243
12 Ga0070714_100044778 3300005435 Bacteria 3747
13 Ga0070714_100069348 3300005435 Bacteria 3044
14 Ga0070714_100096198 3300005435 Bacteria 2601
15 Ga0070714_100112211 3300005435 Bacteria 2415
16 Ga0070714_100188124 3300005435 Bacteria 1882
17 Ga0070714_100196742 3300005435 Bacteria 1842
18 Ga0070714_100251788 3300005435 Bacteria 1633
19 Ga0070714_100281008 3300005435 Bacteria 1546
20 Ga0070714_100349705 3300005435 Unclassified 1388
21 Ga0070713_100000234 3300005436 Bacteria 36880
22 Ga0070713_100008821 3300005436 Bacteria 7177
23 Ga0070713_100011428 3300005436 Bacteria 6467
24 Ga0070713_100060531 3300005436 Bacteria 3165
25 Ga0070713_100142786 3300005436 Bacteria 2122
26 Ga0070713_100173630 3300005436 Bacteria 1932
27 Ga0070713_100259932 3300005436 Bacteria 1586
28 Ga0070713_100279360 3300005436 Bacteria 1531
29 Ga0070710_10000291 3300005437 Bacteria 23753
30 Ga0070710_10009682 3300005437 Bacteria 4721
31 Ga0070710_10012982 3300005437 Bacteria 4155
32 Ga0070710_10070543 3300005437 Bacteria 2013
33 Ga0070710_10088130 3300005437 Bacteria 1825
34 Ga0070710_10167149 3300005437 Bacteria 1368
35 Ga0070711_100000915 3300005439 Bacteria 15562
36 Ga0070711_100003179 3300005439 Bacteria 9528
37 Ga0070711_100031243 3300005439 Bacteria 3534
38 Ga0070711_100061450 3300005439 Bacteria 2615
39 Ga0070711_100128015 3300005439 Bacteria 1887
40 Ga0070694_100212866 3300005444 Bacteria 1446
41 Ga0070708_100004284 3300005445 Bacteria 11217
42 Ga0070708_100010156 3300005445 Bacteria 7619
43 Ga0070681_10201102 3300005458 Bacteria 1910
44 Ga0070706_100233861 3300005467 Bacteria 1716
45 Ga0070706_100253897 3300005467 Bacteria 1641
46 Ga0070707_100001010 3300005468 Bacteria 27882
47 Ga0070707_100005267 3300005468 Bacteria 12106
48 Ga0070707_100131939 3300005468 Bacteria 2429
49 Ga0070707_100208711 3300005468 Bacteria 1904
50 Ga0070698_100000006 3300005471 Bacteria 129236
51 Ga0070698_100000554 3300005471 Bacteria 39971
52 Ga0070698_100000804 3300005471 Bacteria 34239
53 Ga0070698_100035671 3300005471 Bacteria 5140
54 Ga0070698_100126391 3300005471 Bacteria 2514
55 Ga0070698_100175447 3300005471 Bacteria 2083
56 Ga0070699_100001072 3300005518 Bacteria 25485
57 Ga0070699_100272296 3300005518 Bacteria 1516
58 Ga0070697_100001719 3300005536 Bacteria 16723
59 Ga0070693_100159199 3300005547 Bacteria 1437
60 Ga0070665_100312228 3300005548 Bacteria 1576
61 Ga0070704_100287534 3300005549 Bacteria 1365
62 Ga0068855_100064334 3300005563 Bacteria 4278
63 Ga0068855_100383930 3300005563 Bacteria 1542
64 Ga0068856_100014711 3300005614 Bacteria 7552
65 Ga0068856_100088532 3300005614 Bacteria 3078
66 Ga0068864_100020816 3300005618 Bacteria 5488
67 Ga0068864_100057648 3300005618 Bacteria 3356
68 Ga0068864_100387429 3300005618 Unclassified 1326
69 Ga0068863_100354717 3300005841 Bacteria 1429
70 Ga0068858_100030513 3300005842 Bacteria 5006
71 Ga0081540_1000037 3300005983 Bacteria 139165
72 Ga0081540_1001127 3300005983 Bacteria 23603
73 Ga0081540_1009622 3300005983 Bacteria 6646
74 Ga0070717_10002599 3300006028 Bacteria 12741
75 Ga0070717_10047678 3300006028 Bacteria 3511
76 Ga0070717_10056992 3300006028 Bacteria 3229
77 Ga0070717_10064358 3300006028 Bacteria 3046
78 Ga0070717_10233645 3300006028 Bacteria 1619
79 Ga0070717_10320243 3300006028 Unclassified 1381
80 Ga0070715_10012029 3300006163 Bacteria 3134
81 Ga0070716_100000199 3300006173 Bacteria 23708
82 Ga0070716_100014970 3300006173 Bacteria 3979
83 Ga0070716_100036100 3300006173 Bacteria 2723
84 Ga0070716_100114759 3300006173 Bacteria 1675
85 Ga0070716_100131320 3300006173 Bacteria 1584
86 Ga0070712_100076619 3300006175 Bacteria 2408
87 Ga0070712_100084511 3300006175 Unclassified 2308
88 Ga0070712_100093708 3300006175 Bacteria 2205
89 Ga0070712_100106814 3300006175 Bacteria 2081
90 Ga0070712_100139353 3300006175 Unclassified 1849
91 Ga0070712_100203271 3300006175 Bacteria 1557
92 Ga0075428_100183913 3300006844 Bacteria 2261
93 Ga0075433_10246797 3300006852 Unclassified 1585
94 Ga0075434_100012579 3300006871 Bacteria 8026
95 Ga0075434_100020063 3300006871 Bacteria 6475
96 Ga0075434_100089364 3300006871 Bacteria 3082
97 Ga0075434_100142520 3300006871 Bacteria 2417
98 Ga0068865_100188757 3300006881 Bacteria 1592
99 Ga0075436_100018464 3300006914 Bacteria 4774
100 Ga0075436_100040930 3300006914 Bacteria 3197
101 Ga0075435_100003684 3300007076 Bacteria 10435
102 Ga0111539_10063831 3300009094 Bacteria 4358
103 Ga0105245_10111297 3300009098 Bacteria 2546
104 Ga0105245_10192701 3300009098 Bacteria 1953
105 Ga0105245_10269484 3300009098 Bacteria 1660
106 Ga0105247_10090678 3300009101 Bacteria 1940
107 Ga0105248_10099877 3300009177 Bacteria 3270
108 Ga0105237_10212313 3300009545 Bacteria 1935
109 Ga0105237_10310926 3300009545 Bacteria 1579
110 Ga0105238_10082487 3300009551 Bacteria 3205
111 Ga0105238_10163826 3300009551 Bacteria 2199
112 Ga0105239_10462807 3300010375 Bacteria 1439
113 Ga0157328_1000556 3300012478 Bacteria 1382
114 Ga0157346_1000606 3300012480 Bacteria 1557
115 Ga0157343_1000333 3300012488 Bacteria 1827
116 Ga0157342_1000265 3300012507 Bacteria 2920
117 Ga0157370_10130822 3300013104 Bacteria 2341
118 Ga0157370_10303725 3300013104 Bacteria 1473
119 Ga0157370_10384068 3300013104 Bacteria 1293
120 Ga0157369_10189367 3300013105 Bacteria 2162
121 Ga0157374_10153960 3300013296 Bacteria 2237
122 Ga0157374_10432481 3300013296 Unclassified 1316
123 Ga0157378_10370666 3300013297 Bacteria 1404
124 Ga0163162_10036050 3300013306 Bacteria 4928
125 Ga0163162_10326749 3300013306 Bacteria 1666
126 Ga0157372_10450180 3300013307 Bacteria 1500
127 Ga0163163_10081954 3300014325 Bacteria 3229
128 Ga0163163_10264754 3300014325 Bacteria 1770
129 Ga0157376_10048049 3300014969 Bacteria 3526
130 Ga0213875_10000330 3300021388 Bacteria 45066
131 Ga0213875_10044446 3300021388 Bacteria 2086
132 Ga0224712_10018928 3300022467 Bacteria 2311
133 Ga0224572_1006898 3300024225 Bacteria 2066
134 Ga0207692_10000075 3300025898 Bacteria 28691
135 Ga0207692_10003323 3300025898 Bacteria 6269
136 Ga0207692_10014474 3300025898 Bacteria 3447
137 Ga0207692_10060778 3300025898 Bacteria 1955
138 Ga0207692_10087813 3300025898 Bacteria 1679
139 Ga0207710_10106965 3300025900 Bacteria 1325
140 Ga0207685_10017437 3300025905 Bacteria 2322
141 Ga0207699_10000271 3300025906 Bacteria 28500
142 Ga0207699_10001648 3300025906 Bacteria 10581
143 Ga0207699_10052911 3300025906 Bacteria 2406
144 Ga0207699_10180841 3300025906 Archaea 1417
145 Ga0207684_10000524 3300025910 Bacteria 47426
146 Ga0207684_10022686 3300025910 Bacteria 5359
147 Ga0207684_10120939 3300025910 Bacteria 2245
148 Ga0207684_10159717 3300025910 Bacteria 1941
149 Ga0207671_10118245 3300025914 Bacteria 2024
150 Ga0207693_10000886 3300025915 Bacteria 26829
151 Ga0207693_10036520 3300025915 Bacteria 3873
152 Ga0207693_10050171 3300025915 Bacteria 3277
153 Ga0207693_10093453 3300025915 Bacteria 2357
154 Ga0207693_10094013 3300025915 Bacteria 2350
155 Ga0207663_10001747 3300025916 Bacteria 10223
156 Ga0207663_10006017 3300025916 Bacteria 6169
157 Ga0207663_10048802 3300025916 Bacteria 2622
158 Ga0207663_10090161 3300025916 Unclassified 2032
159 Ga0207663_10141506 3300025916 Bacteria 1677
160 Ga0207646_10000049 3300025922 Bacteria 171680
161 Ga0207646_10001443 3300025922 Bacteria 29510
162 Ga0207646_10079959 3300025922 Bacteria 2922
163 Ga0207646_10105367 3300025922 Bacteria 2529
164 Ga0207646_10122643 3300025922 Bacteria 2335
165 Ga0207646_10284816 3300025922 Bacteria 1493
166 Ga0207694_10158392 3300025924 Bacteria 1828
167 Ga0207694_10173335 3300025924 Bacteria 1747
168 Ga0207687_10079518 3300025927 Bacteria 2364
169 Ga0207700_10004147 3300025928 Bacteria 8507
170 Ga0207700_10007634 3300025928 Bacteria 6634
171 Ga0207700_10025666 3300025928 Bacteria 4097
172 Ga0207700_10078345 3300025928 Bacteria 2570
173 Ga0207700_10111101 3300025928 Bacteria 2205
174 Ga0207700_10198537 3300025928 Bacteria 1689
175 Ga0207664_10000530 3300025929 Bacteria 27113
176 Ga0207664_10004626 3300025929 Bacteria 9333
177 Ga0207664_10005562 3300025929 Bacteria 8629
178 Ga0207664_10010680 3300025929 Bacteria 6494
179 Ga0207664_10028405 3300025929 Bacteria 4250
180 Ga0207664_10044539 3300025929 Bacteria 3475
181 Ga0207664_10052981 3300025929 Bacteria 3210
182 Ga0207664_10054995 3300025929 Bacteria 3156
183 Ga0207664_10119634 3300025929 Bacteria 2202
184 Ga0207664_10121384 3300025929 Bacteria 2187
185 Ga0207664_10205021 3300025929 Bacteria 1704
186 Ga0207664_10232998 3300025929 Bacteria 1601
187 Ga0207665_10000019 3300025939 Bacteria 121429
188 Ga0207665_10002670 3300025939 Bacteria 11982
189 Ga0207665_10024322 3300025939 Bacteria 3993
190 Ga0207665_10037259 3300025939 Bacteria 3237
191 Ga0207665_10119170 3300025939 Bacteria 1863
192 Ga0207711_10126438 3300025941 Bacteria 2287
193 Ga0207711_10300560 3300025941 Bacteria 1480
194 Ga0207689_10160488 3300025942 Bacteria 1853
195 Ga0207661_10367112 3300025944 Bacteria 1301
196 Ga0207667_10144400 3300025949 Bacteria 2450
197 Ga0207667_10272966 3300025949 Bacteria 1728
198 Ga0207658_10145213 3300025986 Bacteria 1926
199 Ga0207703_10083113 3300026035 Bacteria 2674
200 Ga0207639_10215790 3300026041 Bacteria 1654
201 Ga0207678_10312429 3300026067 Bacteria 1351
202 Ga0207702_10073621 3300026078 Bacteria 2946
203 Ga0207702_10165743 3300026078 Bacteria 2021
204 Ga0207641_10036186 3300026088 Bacteria 4120
205 Ga0207641_10120875 3300026088 Bacteria 2337
206 Ga0207676_10038524 3300026095 Bacteria 3650
207 Ga0207674_10030753 3300026116 Bacteria 5643
208 Ga0207674_10059754 3300026116 Bacteria 3857
209 Ga0207683_10106092 3300026121 Bacteria 2512
210 Ga0268266_10296605 3300028379 Bacteria 1507
211 Ga0268266_10421740 3300028379 Bacteria 1264
212 Ga0373930_0020395 3300034816 Unclassified 1292
213 Ga0373958_0005531 3300034819 Bacteria 1926
214 Ga0373926_0003939 3300035083 Bacteria 4847
215 Ga0373929_0007055 3300035085 Bacteria 2045
216 Ga0373934_0088700 3300035086 Bacteria 1246
217 Ga0373944_0000497 3300035089 Bacteria 9144
218 Ga0373944_0005510 3300035089 Bacteria 3337
219 Ga0373923_0008153 3300035111 Bacteria 3721
220 Ga0373923_0048502 3300035111 Bacteria 1773
221 Ga0373923_0089749 3300035111 Bacteria 1343
222 Ga0373936_0001062 3300035113 Bacteria 9838
223 Ga0373936_0001152 3300035113 Bacteria 9491
224 Ga0373936_0006872 3300035113 Bacteria 4281
225 Ga0373936_0012913 3300035113 Bacteria 3184
226 Ga0373936_0016572 3300035113 Bacteria 2835
227 Ga0373945_0000757 3300035116 Bacteria 9428
228 Ga0373945_0007477 3300035116 Bacteria 3542
229 Ga0373954_0009836 3300035118 Bacteria 4209
230 Ga0373956_0047007 3300035119 Unclassified 1930
231 Ga0373956_0053554 3300035119 Bacteria 1816
232 Ga0373956_0126605 3300035119 Bacteria 1194
233 Ga0373957_0001355 3300035120 Bacteria 6581
234 Ga0373957_0013785 3300035120 Bacteria 2750
235 Ga0373943_0000044 3300035170 Bacteria 42115
236 Ga0373943_0015596 3300035170 Bacteria 3454
237 Ga0373946_0004486 3300035171 Bacteria 4997
238 Ga0373946_0009905 3300035171 Bacteria 3522
239 Ga0373946_0038485 3300035171 Bacteria 1948
240 Ga0373955_0010178 3300035172 Bacteria 4432
241 Ga0373955_0033372 3300035172 Bacteria 2711
242 Ga0373955_0082205 3300035172 Bacteria 1822
243 Ga0373962_0005962 3300035242 Bacteria 2941
244 Ga0373924_0012407 3300035410 Bacteria 3183
245 Ga0373924_0022456 3300035410 Bacteria 2467
246 Ga0373931_0039376 3300035691 Bacteria 2477
247 Ga0373935_0019228 3300035692 Bacteria 4165
248 Ga0373935_0024522 3300035692 Bacteria 3713
249 Ga0373935_0169799 3300035692 Bacteria 1491
250 Ga0373927_0010970 3300035695 Bacteria 6034
251 Ga0373933_0003342 3300035724 Bacteria 8943
252 Ga0373933_0018007 3300035724 Bacteria 3967
253 Ga0373933_0070190 3300035724 Unclassified 2130
254 Ga0373933_0112498 3300035724 Bacteria 1699
255 Ga0373933_0197536 3300035724 Bacteria 1286
256 Ga0373947_0004032 3300035725 Bacteria 8631
257 Ga0373947_0074128 3300035725 Bacteria 2093
258 Ga0373947_0137161 3300035725 Bacteria 1566
259 Ga0373937_0004784 3300036401 Bacteria 11498
260 Ga0373937_0011439 3300036401 Bacteria 7787
261 Ga0373937_0120804 3300036401 Bacteria 2441
262 Ga0373937_0134965 3300036401 Bacteria 2307
263 Ga0373937_0219783 3300036401 Bacteria 1788
264 Ga0373925_0005850 3300037068 Bacteria 9119
265 Ga0373925_0008560 3300037068 Bacteria 7456
266 Ga0373925_0053901 3300037068 Bacteria 3007
267 Ga0373925_0060687 3300037068 Bacteria 2839
268 Ga0373925_0116143 3300037068 Bacteria 2072
269 Ga0373925_0132533 3300037068 Bacteria 1944
270 Ga0373925_0243002 3300037068 Bacteria 1442
271 Ga0436364_0051808 3300037853 Bacteria 1903
272 Ga0436364_0059473 3300037853 Bacteria 77135
273 Ga0436364_0509219 3300037853 Bacteria 4000
274 Ga0436364_0951890 3300037853 Bacteria 3079
275 Ga0436364_1121364 3300037853 Bacteria 2220
276 Ga0436364_1287727 3300037853 Bacteria 14001
277 Ga0436364_1370375 3300037853 Bacteria 3318
278 Ga0466961_0133764 3300044693 Bacteria 1554
279 Ga0466963_0027384 3300044694 Bacteria 3649
280 Ga0466967_0023475 3300045976 Bacteria 5055
281 Ga0466967_0110861 3300045976 Bacteria 2521
282 Ga0466967_0175914 3300045976 Bacteria 2016
283 Ga0495592_0054506 3300046454 Bacteria 2962
284 Ga0495603_0015217 3300046455 Bacteria 4655
285 Ga0495603_0034510 3300046455 Bacteria 3041
286 Ga0495629_0019121 3300046459 Bacteria 4897
287 Ga0495629_0073349 3300046459 Bacteria 2390
288 Ga0495629_0078218 3300046459 Bacteria 2309
289 Ga0495629_0079255 3300046459 Unclassified 2293
290 Ga0495641_0005777 3300046461 Bacteria 8217
291 Ga0495641_0005906 3300046461 Bacteria 8082
292 Ga0495641_0027538 3300046461 Bacteria 2762
293 Ga0495651_0024315 3300046462 Bacteria 4713
294 Ga0495651_0053722 3300046462 Bacteria 3100
295 Ga0495651_0056425 3300046462 Bacteria 3017
296 Ga0495651_0058683 3300046462 Bacteria 2952
297 Ga0495651_0161855 3300046462 Bacteria 1602
298 Ga0495653_0002657 3300046463 Bacteria 14227
299 Ga0495653_0005717 3300046463 Bacteria 10164
300 Ga0495653_0006102 3300046463 Bacteria 9875
301 Ga0495653_0018583 3300046463 Bacteria 5642
302 Ga0495580_0041452 3300046472 Bacteria 3283
303 Ga0495582_0007281 3300046473 Bacteria 6131
304 Ga0495582_0007669 3300046473 Bacteria 5965
305 Ga0495639_0030539 3300046475 Bacteria 2395
306 Ga0495662_0012961 3300046476 Bacteria 4061
307 Ga0495662_0018192 3300046476 Bacteria 3400
308 Ga0495662_0083611 3300046476 Bacteria 1553
309 Ga0495664_0026644 3300046477 Bacteria 3367
310 Ga0495664_0033730 3300046477 Bacteria 3009
311 Ga0495664_0148378 3300046477 Bacteria 1422
312 Ga0495664_0183514 3300046477 Bacteria 1268
313 Ga0495594_0081906 3300046499 Bacteria 1802
314 Ga0495594_0111915 3300046499 Bacteria 1540
315 Ga0495608_0000416 3300046511 Bacteria 29789
316 Ga0495608_0010436 3300046511 Bacteria 6482
317 Ga0495608_0037781 3300046511 Bacteria 3246
318 Ga0495608_0062741 3300046511 Bacteria 2440
319 Ga0495608_0105819 3300046511 Bacteria 1811
320 Ga0495618_0013383 3300046514 Bacteria 4992
321 Ga0495618_0046286 3300046514 Bacteria 2745
322 Ga0495618_0052814 3300046514 Bacteria 2569
323 Ga0495618_0083338 3300046514 Bacteria 2042
324 Ga0495618_0243691 3300046514 Bacteria 1129
325 Ga0495630_0043176 3300046517 Bacteria 3367
326 Ga0495630_0056318 3300046517 Bacteria 2946
327 Ga0495630_0067564 3300046517 Bacteria 2687
328 Ga0495630_0164604 3300046517 Bacteria 1688
329 Ga0495666_0017263 3300046526 Bacteria 3595
330 Ga0495666_0101070 3300046526 Bacteria 1359
331 Ga0495652_0002603 3300046529 Bacteria 18455
332 Ga0495652_0042112 3300046529 Bacteria 3938
333 Ga0495652_0067948 3300046529 Bacteria 2986
334 Ga0495652_0109995 3300046529 Bacteria 2217
335 Ga0495665_0004483 3300046531 Bacteria 7536
336 Ga0495665_0039553 3300046531 Bacteria 2511
337 Ga0495640_0046944 3300046533 Bacteria 2990
338 Ga0495640_0055511 3300046533 Bacteria 2709
339 Ga0495640_0075471 3300046533 Bacteria 2251
340 Ga0495640_0102169 3300046533 Unclassified 1881
341 Ga0495640_0115585 3300046533 Bacteria 1748
342 Ga0495586_0056578 3300046535 Bacteria 2127
343 Ga0495586_0116393 3300046535 Bacteria 1491
344 Ga0495587_0000435 3300046536 Bacteria 29335
345 Ga0495587_0015393 3300046536 Bacteria 4778
346 Ga0495587_0034978 3300046536 Bacteria 3027
347 Ga0495587_0048908 3300046536 Bacteria 2504
348 Ga0495587_0056049 3300046536 Bacteria 2319
349 Ga0495587_0091747 3300046536 Bacteria 1754
350 Ga0495587_0104800 3300046536 Unclassified 1627
351 Ga0495645_0021263 3300046543 Bacteria 4689
352 Ga0495645_0179425 3300046543 Bacteria 1452
353 Ga0495645_0219859 3300046543 Bacteria 1278
354 Ga0495667_0002845 3300046559 Bacteria 11574
355 Ga0495667_0003227 3300046559 Bacteria 10932
356 Ga0495667_0012359 3300046559 Bacteria 5786
357 Ga0495667_0017117 3300046559 Bacteria 4895
358 Ga0495667_0042027 3300046559 Bacteria 3030
359 Ga0495634_0042116 3300046642 Bacteria 3099
360 Ga0495634_0073757 3300046642 Bacteria 2243
361 Ga0495635_0003080 3300046663 Bacteria 11468
362 Ga0495635_0004571 3300046663 Bacteria 9601
363 Ga0495635_0014468 3300046663 Bacteria 5520
364 Ga0495635_0016886 3300046663 Bacteria 5098
365 Ga0495635_0046622 3300046663 Bacteria 2989
366 Ga0495635_0139331 3300046663 Bacteria 1652
367 Ga0495657_0004054 3300046675 Bacteria 11745
368 Ga0495657_0007092 3300046675 Bacteria 8691
369 Ga0495657_0007346 3300046675 Bacteria 8519
370 Ga0495657_0011782 3300046675 Bacteria 6519
371 Ga0495599_0043630 3300046678 Bacteria 2814
372 Ga0495599_0060823 3300046678 Bacteria 2361
373 Ga0495599_0061330 3300046678 Bacteria 2350
374 Ga0495599_0061588 3300046678 Bacteria 2345
375 Ga0495599_0096858 3300046678 Bacteria 1839
376 Ga0495623_0000198 3300046679 Bacteria 38159
377 Ga0495623_0028390 3300046679 Bacteria 3599
378 Ga0495623_0088617 3300046679 Bacteria 1904
379 Ga0495646_0007485 3300046680 Bacteria 6939
380 Ga0495646_0103405 3300046680 Bacteria 1630
381 Ga0495647_0063312 3300046681 Bacteria 1464
382 Ga0495658_0008245 3300046683 Bacteria 5161
383 Ga0495658_0079738 3300046683 Bacteria 1919
384 Ga0495658_0101078 3300046683 Unclassified 1721
385 Ga0495613_0083571 3300046689 Bacteria 2318
386 Ga0495624_0013517 3300046690 Bacteria 5565
387 Ga0495624_0017032 3300046690 Bacteria 4884
388 Ga0495624_0045471 3300046690 Bacteria 2794
389 Ga0495624_0064123 3300046690 Bacteria 2296
390 Ga0495624_0105943 3300046690 Bacteria 1730
391 Ga0495600_0002656 3300046809 Bacteria 10329
392 Ga0495600_0007872 3300046809 Bacteria 6526
393 Ga0495600_0017200 3300046809 Bacteria 4595
394 Ga0495600_0058516 3300046809 Unclassified 2517
395 Ga0495600_0124992 3300046809 Bacteria 1673
396 Ga0495581_0001556 3300047315 Bacteria 12808
397 Ga0495581_0003518 3300047315 Bacteria 8988
398 Ga0495581_0040925 3300047315 Unclassified 2681
399 Ga0495581_0044575 3300047315 Bacteria 2565
400 Ga0495581_0064896 3300047315 Bacteria 2110
401 Ga0495604_0010660 3300047317 Bacteria 7290
402 Ga0495604_0017099 3300047317 Bacteria 5802
403 Ga0495674_0000110 3300047319 Bacteria 60617
404 Ga0495674_0055013 3300047319 Bacteria 3491
405 Ga0495674_0060153 3300047319 Bacteria 3315
406 Ga0495674_0085680 3300047319 Bacteria 2698
407 Ga0495674_0117207 3300047319 Bacteria 2252
408 Ga0495676_0001274 3300047321 Bacteria 21640
409 Ga0495676_0084199 3300047321 Bacteria 2400
410 Ga0495676_0106836 3300047321 Bacteria 2061
411 Ga0495676_0191980 3300047321 Bacteria 1424
412 Ga0495680_0006597 3300047322 Bacteria 10766
413 Ga0495680_0008435 3300047322 Bacteria 9365
414 Ga0495680_0013295 3300047322 Bacteria 7189
415 Ga0495680_0023948 3300047322 Bacteria 5071
416 Ga0495680_0040615 3300047322 Bacteria 3705
417 Ga0495680_0057023 3300047322 Bacteria 3023
418 Ga0495675_0029537 3300047444 Bacteria 3497
419 Ga0495675_0097404 3300047444 Bacteria 1843
420 Ga0495675_0104877 3300047444 Bacteria 1767
421 Ga0495684_0002879 3300047471 Bacteria 13542
422 Ga0495684_0005267 3300047471 Bacteria 10069
423 Ga0495684_0069795 3300047471 Bacteria 2671
424 Ga0495684_0117704 3300047471 Bacteria 2002
425 Ga0495684_0124544 3300047471 Bacteria 1939
426 Ga0495684_0176936 3300047471 Bacteria 1583
427 Ga0495593_0016128 3300047673 Bacteria 4216
428 Ga0495593_0020780 3300047673 Bacteria 3672
429 Ga0495593_0061770 3300047673 Bacteria 1959
430 Ga0495602_0116350 3300048088 Bacteria 2160
431 Ga0495602_0155845 3300048088 Bacteria 1788
432 Ga0495602_0165112 3300048088 Bacteria 1724
433 Ga0495614_0019781 3300048089 Bacteria 2913
434 Ga0495614_0045830 3300048089 Bacteria 1875
435 Ga0496102_0097688 3300048905 Bacteria 2724
436 Ga0496102_0140973 3300048905 Bacteria 2260
437 Ga0496104_0012247 3300048907 Bacteria 7708
438 Ga0496104_0040208 3300048907 Bacteria 4382
439 Ga0496105_0002154 3300048908 Bacteria 14257
440 Ga0496107_0106390 3300048910 Bacteria 2060
441 Ga0496108_0022127 3300048911 Bacteria 5227
442 Ga0496108_0043614 3300048911 Bacteria 3746
443 Ga0496108_0069469 3300048911 Bacteria 2972
444 Ga0496109_0083172 3300048912 Bacteria 2952
445 Ga0496110_0121468 3300048913 Bacteria 2354
446 Ga0496110_0133478 3300048913 Bacteria 2242
447 Ga0496111_0035215 3300048914 Bacteria 3577
448 Ga0496112_0223328 3300048915 Bacteria 1839
449 Ga0496113_0098844 3300048916 Bacteria 2259
450 Ga0496113_0156325 3300048916 Bacteria 1801
451 Ga0496114_0075102 3300048917 Bacteria 2846
452 Ga0496126_0230469 3300048929 Bacteria 1552
453 nmdc:mga05p37_20920_c1 3300050507 Bacteria 7919
454 nmdc:mga0n895_34758_c1 3300050512 Bacteria 4855
455 nmdc:mga0n895_91604_c1 3300050512 Bacteria 3043
456 nmdc:mga0rr50_21508_c1 3300050513 Bacteria 4405
457 nmdc:mga0rr50_5260_c1 3300050513 Bacteria 7700
458 nmdc:mga0rr50_84862_c1 3300050513 Bacteria 2453
459 nmdc:mga08x19_18272_c1 3300050514 Bacteria 4298
460 nmdc:mga08x19_4028_c1 3300050514 Bacteria 8735
461 nmdc:mga0a205_141874_c1 3300050515 Bacteria 2302
462 nmdc:mga0a205_160192_c1 3300050515 Bacteria 2148
463 nmdc:mga0a205_336753_c1 3300050515 Unclassified 1378
464 nmdc:mga0a205_338262_c1 3300050515 Bacteria 1374
465 Ga0495601_0021105 3300053077 Bacteria 3985
466 Ga0495612_0019553 3300053078 Bacteria 2712
467 Ga0495612_0027893 3300053078 Bacteria 2272
468 Ga0495612_0054628 3300053078 Bacteria 1646
469 Ga0495595_0102400 3300053084 Bacteria 1383
470 Ga0495595_0151749 3300053084 Bacteria 1140
471 Ga0495619_0060680 3300053085 Bacteria 2514
472 Ga0495619_0109511 3300053085 Bacteria 1886
473 Ga0495619_0183845 3300053085 Bacteria 1446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100098989 Ga0068869_1000989892 314
2 3300005467 Ga0070706_100233861 Ga0070706_1002338612 315
3 3300026041 Ga0207639_10215790 Ga0207639_102157903 317
4 3300005983 Ga0081540_1000037 Ga0081540_100003792 318
5 3300005435 Ga0070714_100010751 Ga0070714_1000107512 323
6 3300025929 Ga0207664_10010680 Ga0207664_100106804 323
7 3300005434 Ga0070709_10000050 Ga0070709_1000005020 325
8 3300005435 Ga0070714_100004903 Ga0070714_1000049031 325
9 3300005436 Ga0070713_100000234 Ga0070713_10000023419 325
10 3300005437 Ga0070710_10000291 Ga0070710_100002911 325
11 3300005439 Ga0070711_100000915 Ga0070711_1000009155 325
12 3300006028 Ga0070717_10002599 Ga0070717_100025998 325
13 3300006163 Ga0070715_10012029 Ga0070715_100120292 325
14 3300006173 Ga0070716_100000199 Ga0070716_10000019924 325
15 3300006175 Ga0070712_100106814 Ga0070712_1001068142 325
16 3300025898 Ga0207692_10000075 Ga0207692_100000758 325
17 3300025906 Ga0207699_10000271 Ga0207699_1000027121 325
18 3300025915 Ga0207693_10000886 Ga0207693_1000088622 325
19 3300025916 Ga0207663_10001747 Ga0207663_100017477 325
20 3300025928 Ga0207700_10004147 Ga0207700_100041476 325
21 3300025929 Ga0207664_10000530 Ga0207664_100005307 325
22 3300025939 Ga0207665_10000019 Ga0207665_1000001926 325
23 3300047321 Ga0495676_0191980 Ga0495676_0191980_402_1409 325
24 3300053078 Ga0495612_0054628 Ga0495612_0054628_181_1230 325
25 3300005435 Ga0070714_100281008 Ga0070714_1002810082 326
26 3300005436 Ga0070713_100279360 Ga0070713_1002793602 326
27 3300025928 Ga0207700_10111101 Ga0207700_101111012 326
28 3300025929 Ga0207664_10054995 Ga0207664_100549952 326
29 3300005471 Ga0070698_100000804 Ga0070698_10000080431 327
30 3300009098 Ga0105245_10269484 Ga0105245_102694842 327
31 3300037853 Ga0436364_1287727 Ga0436364_1287727_684_1871 328
32 3300036401 Ga0373937_0219783 Ga0373937_0219783_146_1231 329
33 3300005437 Ga0070710_10012982 Ga0070710_100129822 330
34 3300005437 Ga0070710_10088130 Ga0070710_100881301 330
35 3300005468 Ga0070707_100208711 Ga0070707_1002087111 330
36 3300005518 Ga0070699_100001072 Ga0070699_1000010724 330
37 3300005536 Ga0070697_100001719 Ga0070697_1000017194 330
38 3300005548 Ga0070665_100312228 Ga0070665_1003122282 330
39 3300005563 Ga0068855_100064334 Ga0068855_1000643344 330
40 3300005614 Ga0068856_100014711 Ga0068856_1000147117 330
41 3300005618 Ga0068864_100057648 Ga0068864_1000576481 330
42 3300005842 Ga0068858_100030513 Ga0068858_1000305134 330
43 3300009098 Ga0105245_10111297 Ga0105245_101112972 330
44 3300009177 Ga0105248_10099877 Ga0105248_100998774 330
45 3300009545 Ga0105237_10212313 Ga0105237_102123132 330
46 3300009551 Ga0105238_10082487 Ga0105238_100824872 330
47 3300013104 Ga0157370_10303725 Ga0157370_103037251 330
48 3300013296 Ga0157374_10432481 Ga0157374_104324811 330
49 3300013306 Ga0163162_10036050 Ga0163162_100360504 330
50 3300014325 Ga0163163_10081954 Ga0163163_100819544 330
51 3300025898 Ga0207692_10060778 Ga0207692_100607781 330
52 3300025914 Ga0207671_10118245 Ga0207671_101182452 330
53 3300025922 Ga0207646_10001443 Ga0207646_1000144316 330
54 3300025922 Ga0207646_10284816 Ga0207646_102848162 330
55 3300025924 Ga0207694_10158392 Ga0207694_101583921 330
56 3300025941 Ga0207711_10300560 Ga0207711_103005602 330
57 3300025949 Ga0207667_10272966 Ga0207667_102729662 330
58 3300026035 Ga0207703_10083113 Ga0207703_100831132 330
59 3300026067 Ga0207678_10312429 Ga0207678_103124292 330
60 3300026078 Ga0207702_10073621 Ga0207702_100736213 330
61 3300026088 Ga0207641_10036186 Ga0207641_100361864 330
62 3300026095 Ga0207676_10038524 Ga0207676_100385243 330
63 3300026116 Ga0207674_10030753 Ga0207674_100307537 330
64 3300028379 Ga0268266_10421740 Ga0268266_104217402 330
65 3300035083 Ga0373926_0003939 Ga0373926_0003939_1532_2674 330
66 3300035089 Ga0373944_0000497 Ga0373944_0000497_6778_7920 330
67 3300035111 Ga0373923_0048502 Ga0373923_0048502_562_1704 330
68 3300035113 Ga0373936_0001062 Ga0373936_0001062_7859_9001 330
69 3300035116 Ga0373945_0007477 Ga0373945_0007477_2096_3238 330
70 3300035170 Ga0373943_0000044 Ga0373943_0000044_2481_3623 330
71 3300035171 Ga0373946_0009905 Ga0373946_0009905_226_1368 330
72 3300035692 Ga0373935_0019228 Ga0373935_0019228_2281_3423 330
73 3300035692 Ga0373935_0169799 Ga0373935_0169799_142_1227 330
74 3300035695 Ga0373927_0010970 Ga0373927_0010970_2481_3623 330
75 3300035725 Ga0373947_0004032 Ga0373947_0004032_743_1885 330
76 3300036401 Ga0373937_0134965 Ga0373937_0134965_621_1763 330
77 3300037068 Ga0373925_0005850 Ga0373925_0005850_98_1240 330
78 3300046462 Ga0495651_0056425 Ga0495651_0056425_1559_2701 330
79 3300046463 Ga0495653_0005717 Ga0495653_0005717_8248_9390 330
80 3300046475 Ga0495639_0030539 Ga0495639_0030539_270_1412 330
81 3300046476 Ga0495662_0083611 Ga0495662_0083611_341_1483 330
82 3300046477 Ga0495664_0033730 Ga0495664_0033730_617_1759 330
83 3300046514 Ga0495618_0052814 Ga0495618_0052814_452_1594 330
84 3300046517 Ga0495630_0067564 Ga0495630_0067564_1020_2162 330
85 3300046529 Ga0495652_0109995 Ga0495652_0109995_302_1444 330
86 3300046533 Ga0495640_0115585 Ga0495640_0115585_183_1325 330
87 3300046536 Ga0495587_0015393 Ga0495587_0015393_3092_4177 330
88 3300046536 Ga0495587_0091747 Ga0495587_0091747_421_1563 330
89 3300046543 Ga0495645_0179425 Ga0495645_0179425_319_1404 330
90 3300046559 Ga0495667_0017117 Ga0495667_0017117_1583_2725 330
91 3300046642 Ga0495634_0042116 Ga0495634_0042116_808_1950 330
92 3300046663 Ga0495635_0003080 Ga0495635_0003080_1259_2401 330
93 3300046678 Ga0495599_0060823 Ga0495599_0060823_306_1391 330
94 3300046678 Ga0495599_0061330 Ga0495599_0061330_521_1663 330
95 3300046680 Ga0495646_0103405 Ga0495646_0103405_264_1349 330
96 3300046690 Ga0495624_0013517 Ga0495624_0013517_2151_3293 330
97 3300047315 Ga0495581_0064896 Ga0495581_0064896_780_1922 330
98 3300047319 Ga0495674_0000110 Ga0495674_0000110_44000_45142 330
99 3300047321 Ga0495676_0001274 Ga0495676_0001274_20055_21197 330
100 3300047322 Ga0495680_0008435 Ga0495680_0008435_749_1891 330
101 3300047444 Ga0495675_0104877 Ga0495675_0104877_464_1549 330
102 3300047471 Ga0495684_0005267 Ga0495684_0005267_8633_9775 330
103 3300048088 Ga0495602_0155845 Ga0495602_0155845_628_1713 330
104 3300048907 Ga0496104_0012247 Ga0496104_0012247_1701_2771 330
105 3300048908 Ga0496105_0002154 Ga0496105_0002154_11496_12566 330
106 3300048911 Ga0496108_0022127 Ga0496108_0022127_3638_4708 330
107 3300048912 Ga0496109_0083172 Ga0496109_0083172_1253_2323 330
108 3300048913 Ga0496110_0133478 Ga0496110_0133478_621_1691 330
109 3300048914 Ga0496111_0035215 Ga0496111_0035215_1268_2338 330
110 3300048915 Ga0496112_0223328 Ga0496112_0223328_610_1680 330
111 3300048916 Ga0496113_0156325 Ga0496113_0156325_195_1265 330
112 3300053084 Ga0495595_0151749 Ga0495595_0151749_10_1095 330
113 3300005435 Ga0070714_100196742 Ga0070714_1001967422 331
114 3300005436 Ga0070713_100173630 Ga0070713_1001736302 331
115 3300006871 Ga0075434_100142520 Ga0075434_1001425203 331
116 3300025929 Ga0207664_10232998 Ga0207664_102329982 331
117 3300005445 Ga0070708_100010156 Ga0070708_10001015611 334
118 3300005445 Ga0070708_100004284 Ga0070708_10000428410 335
119 3300005518 Ga0070699_100272296 Ga0070699_1002722963 335
120 3300035725 Ga0373947_0074128 Ga0373947_0074128_313_1410 335
121 3300037068 Ga0373925_0132533 Ga0373925_0132533_680_1777 335
122 3300046678 Ga0495599_0061588 Ga0495599_0061588_74_1228 335
123 3300024225 Ga0224572_1006898 Ga0224572_10068982 336
124 3300046462 Ga0495651_0053722 Ga0495651_0053722_163_1305 336
125 3300046809 Ga0495600_0124992 Ga0495600_0124992_433_1575 336
126 3300045976 Ga0466967_0175914 Ga0466967_0175914_239_1393 337
127 3300005435 Ga0070714_100069348 Ga0070714_1000693484 338
128 3300005435 Ga0070714_100188124 Ga0070714_1001881242 338
129 3300005436 Ga0070713_100142786 Ga0070713_1001427862 338
130 3300005436 Ga0070713_100259932 Ga0070713_1002599322 338
131 3300005614 Ga0068856_100088532 Ga0068856_1000885323 338
132 3300022467 Ga0224712_10018928 Ga0224712_100189283 338
133 3300025910 Ga0207684_10000524 Ga0207684_1000052424 338
134 3300025929 Ga0207664_10119634 Ga0207664_101196342 338
135 3300035119 Ga0373956_0053554 Ga0373956_0053554_454_1500 338
136 3300035120 Ga0373957_0001355 Ga0373957_0001355_5094_6140 338
137 3300035172 Ga0373955_0010178 Ga0373955_0010178_2953_3999 338
138 3300035724 Ga0373933_0070190 Ga0373933_0070190_236_1282 338
139 3300036401 Ga0373937_0004784 Ga0373937_0004784_9998_11044 338
140 3300044694 Ga0466963_0027384 Ga0466963_0027384_726_1880 338
141 3300046459 Ga0495629_0073349 Ga0495629_0073349_906_1952 338
142 3300046463 Ga0495653_0018583 Ga0495653_0018583_4258_5304 338
143 3300046511 Ga0495608_0105819 Ga0495608_0105819_311_1357 338
144 3300046514 Ga0495618_0013383 Ga0495618_0013383_889_1935 338
145 3300046517 Ga0495630_0056318 Ga0495630_0056318_1201_2247 338
146 3300046533 Ga0495640_0102169 Ga0495640_0102169_816_1862 338
147 3300046536 Ga0495587_0000435 Ga0495587_0000435_21007_22053 338
148 3300046559 Ga0495667_0002845 Ga0495667_0002845_540_1586 338
149 3300046675 Ga0495657_0007092 Ga0495657_0007092_575_1621 338
150 3300046678 Ga0495599_0096858 Ga0495599_0096858_455_1501 338
151 3300046679 Ga0495623_0000198 Ga0495623_0000198_6494_7540 338
152 3300046680 Ga0495646_0007485 Ga0495646_0007485_523_1569 338
153 3300046690 Ga0495624_0105943 Ga0495624_0105943_87_1133 338
154 3300046809 Ga0495600_0002656 Ga0495600_0002656_2137_3183 338
155 3300047319 Ga0495674_0055013 Ga0495674_0055013_543_1589 338
156 3300047444 Ga0495675_0097404 Ga0495675_0097404_344_1390 338
157 3300047471 Ga0495684_0069795 Ga0495684_0069795_870_1916 338
158 3300048088 Ga0495602_0116350 Ga0495602_0116350_660_1706 338
159 3300053085 Ga0495619_0109511 Ga0495619_0109511_137_1183 338
160 3300035724 Ga0373933_0112498 Ga0373933_0112498_284_1429 339
161 3300046463 Ga0495653_0006102 Ga0495653_0006102_5068_6213 339
162 3300046663 Ga0495635_0004571 Ga0495635_0004571_1263_2408 339
163 3300046675 Ga0495657_0011782 Ga0495657_0011782_3182_4327 339
164 3300005434 Ga0070709_10001376 Ga0070709_100013764 340
165 3300005435 Ga0070714_100096198 Ga0070714_1000961982 340
166 3300005436 Ga0070713_100008821 Ga0070713_1000088216 340
167 3300005437 Ga0070710_10009682 Ga0070710_100096823 340
168 3300005439 Ga0070711_100003179 Ga0070711_1000031794 340
169 3300006028 Ga0070717_10047678 Ga0070717_100476782 340
170 3300006173 Ga0070716_100036100 Ga0070716_1000361003 340
171 3300006175 Ga0070712_100076619 Ga0070712_1000766191 340
172 3300021388 Ga0213875_10044446 Ga0213875_100444462 340
173 3300025898 Ga0207692_10003323 Ga0207692_100033233 340
174 3300025906 Ga0207699_10001648 Ga0207699_100016484 340
175 3300025915 Ga0207693_10036520 Ga0207693_100365202 340
176 3300025916 Ga0207663_10006017 Ga0207663_100060173 340
177 3300025928 Ga0207700_10078345 Ga0207700_100783453 340
178 3300025929 Ga0207664_10005562 Ga0207664_100055628 340
179 3300025939 Ga0207665_10002670 Ga0207665_1000267012 340
180 3300046663 Ga0495635_0016886 Ga0495635_0016886_3889_4965 341
181 3300025916 Ga0207663_10141506 Ga0207663_101415062 342
182 3300025929 Ga0207664_10028405 Ga0207664_100284052 342
183 3300035119 Ga0373956_0047007 Ga0373956_0047007_556_1587 342
184 3300035172 Ga0373955_0033372 Ga0373955_0033372_1047_2078 342
185 3300037068 Ga0373925_0053901 Ga0373925_0053901_304_1335 342
186 3300037068 Ga0373925_0116143 Ga0373925_0116143_928_1959 342
187 3300046454 Ga0495592_0054506 Ga0495592_0054506_1345_2376 342
188 3300046462 Ga0495651_0024315 Ga0495651_0024315_2263_3294 342
189 3300046463 Ga0495653_0002657 Ga0495653_0002657_3728_4759 342
190 3300046477 Ga0495664_0183514 Ga0495664_0183514_37_1068 342
191 3300046511 Ga0495608_0000416 Ga0495608_0000416_25588_26619 342
192 3300046514 Ga0495618_0243691 Ga0495618_0243691_62_1093 342
193 3300046529 Ga0495652_0042112 Ga0495652_0042112_949_1980 342
194 3300046533 Ga0495640_0046944 Ga0495640_0046944_1778_2809 342
195 3300046543 Ga0495645_0021263 Ga0495645_0021263_961_1992 342
196 3300046559 Ga0495667_0003227 Ga0495667_0003227_3201_4232 342
197 3300046663 Ga0495635_0014468 Ga0495635_0014468_1313_2344 342
198 3300046675 Ga0495657_0004054 Ga0495657_0004054_3185_4216 342
199 3300046678 Ga0495599_0043630 Ga0495599_0043630_1697_2728 342
200 3300046679 Ga0495623_0028390 Ga0495623_0028390_1848_2879 342
201 3300046809 Ga0495600_0017200 Ga0495600_0017200_2418_3449 342
202 3300047317 Ga0495604_0017099 Ga0495604_0017099_3923_4954 342
203 3300047322 Ga0495680_0006597 Ga0495680_0006597_1726_2757 342
204 3300053078 Ga0495612_0027893 Ga0495612_0027893_206_1237 342
205 3300053085 Ga0495619_0183845 Ga0495619_0183845_248_1279 342
206 3300035111 Ga0373923_0008153 Ga0373923_0008153_2375_3460 343
207 3300035111 Ga0373923_0089749 Ga0373923_0089749_15_1064 343
208 3300035113 Ga0373936_0001152 Ga0373936_0001152_212_1297 343
209 3300035118 Ga0373954_0009836 Ga0373954_0009836_1888_2973 343
210 3300035119 Ga0373956_0126605 Ga0373956_0126605_64_1149 343
211 3300035170 Ga0373943_0015596 Ga0373943_0015596_2049_3134 343
212 3300035171 Ga0373946_0004486 Ga0373946_0004486_3212_4297 343
213 3300035410 Ga0373924_0012407 Ga0373924_0012407_505_1590 343
214 3300037068 Ga0373925_0060687 Ga0373925_0060687_305_1390 343
215 3300046455 Ga0495603_0015217 Ga0495603_0015217_2713_3798 343
216 3300046459 Ga0495629_0078218 Ga0495629_0078218_418_1503 343
217 3300046461 Ga0495641_0027538 Ga0495641_0027538_1450_2535 343
218 3300046472 Ga0495580_0041452 Ga0495580_0041452_238_1323 343
219 3300046473 Ga0495582_0007669 Ga0495582_0007669_1038_2123 343
220 3300046476 Ga0495662_0018192 Ga0495662_0018192_307_1392 343
221 3300046499 Ga0495594_0081906 Ga0495594_0081906_442_1527 343
222 3300046511 Ga0495608_0062741 Ga0495608_0062741_345_1430 343
223 3300046514 Ga0495618_0083338 Ga0495618_0083338_411_1496 343
224 3300046526 Ga0495666_0017263 Ga0495666_0017263_2028_3113 343
225 3300046529 Ga0495652_0067948 Ga0495652_0067948_806_1891 343
226 3300046531 Ga0495665_0004483 Ga0495665_0004483_6429_7514 343
227 3300046533 Ga0495640_0055511 Ga0495640_0055511_276_1361 343
228 3300046535 Ga0495586_0056578 Ga0495586_0056578_286_1371 343
229 3300046536 Ga0495587_0056049 Ga0495587_0056049_806_1891 343
230 3300046559 Ga0495667_0042027 Ga0495667_0042027_935_2020 343
231 3300046642 Ga0495634_0073757 Ga0495634_0073757_582_1667 343
232 3300046663 Ga0495635_0046622 Ga0495635_0046622_546_1631 343
233 3300046679 Ga0495623_0088617 Ga0495623_0088617_310_1395 343
234 3300046683 Ga0495658_0008245 Ga0495658_0008245_1234_2319 343
235 3300046690 Ga0495624_0017032 Ga0495624_0017032_1337_2422 343
236 3300046809 Ga0495600_0007872 Ga0495600_0007872_807_1892 343
237 3300047315 Ga0495581_0001556 Ga0495581_0001556_5188_6273 343
238 3300047319 Ga0495674_0117207 Ga0495674_0117207_883_1968 343
239 3300047321 Ga0495676_0106836 Ga0495676_0106836_765_1850 343
240 3300047444 Ga0495675_0029537 Ga0495675_0029537_1991_3076 343
241 3300047673 Ga0495593_0016128 Ga0495593_0016128_2049_3134 343
242 3300048089 Ga0495614_0019781 Ga0495614_0019781_1768_2853 343
243 3300053085 Ga0495619_0060680 Ga0495619_0060680_392_1477 343
244 3300006028 Ga0070717_10056992 Ga0070717_100569923 344
245 3300006028 Ga0070717_10320243 Ga0070717_103202431 344
246 3300013104 Ga0157370_10384068 Ga0157370_103840681 344
247 3300025922 Ga0207646_10105367 Ga0207646_101053671 344
248 3300045976 Ga0466967_0110861 Ga0466967_0110861_1173_2222 344
249 3300005439 Ga0070711_100128015 Ga0070711_1001280151 345
250 3300005467 Ga0070706_100253897 Ga0070706_1002538972 345
251 3300047322 Ga0495680_0057023 Ga0495680_0057023_417_1583 345
252 3300005435 Ga0070714_100112211 Ga0070714_1001122112 346
253 3300006028 Ga0070717_10233645 Ga0070717_102336452 346
254 3300035113 Ga0373936_0012913 Ga0373936_0012913_958_2058 346
255 3300035171 Ga0373946_0038485 Ga0373946_0038485_249_1289 346
256 3300035725 Ga0373947_0137161 Ga0373947_0137161_216_1256 346
257 3300037068 Ga0373925_0008560 Ga0373925_0008560_543_1583 346
258 3300037068 Ga0373925_0243002 Ga0373925_0243002_254_1354 346
259 3300037853 Ga0436364_0509219 Ga0436364_0509219_2239_3372 346
260 3300046455 Ga0495603_0034510 Ga0495603_0034510_1731_2771 346
261 3300046459 Ga0495629_0019121 Ga0495629_0019121_3735_4835 346
262 3300046461 Ga0495641_0005906 Ga0495641_0005906_1097_2197 346
263 3300046473 Ga0495582_0007281 Ga0495582_0007281_1171_2271 346
264 3300046477 Ga0495664_0026644 Ga0495664_0026644_1150_2250 346
265 3300046499 Ga0495594_0111915 Ga0495594_0111915_276_1316 346
266 3300046514 Ga0495618_0046286 Ga0495618_0046286_14_1114 346
267 3300046517 Ga0495630_0164604 Ga0495630_0164604_12_1052 346
268 3300046531 Ga0495665_0039553 Ga0495665_0039553_773_1813 346
269 3300046533 Ga0495640_0075471 Ga0495640_0075471_932_2032 346
270 3300046536 Ga0495587_0034978 Ga0495587_0034978_1210_2310 346
271 3300046543 Ga0495645_0219859 Ga0495645_0219859_14_1054 346
272 3300046559 Ga0495667_0012359 Ga0495667_0012359_420_1520 346
273 3300046663 Ga0495635_0139331 Ga0495635_0139331_177_1217 346
274 3300046675 Ga0495657_0007346 Ga0495657_0007346_5905_7005 346
275 3300046681 Ga0495647_0063312 Ga0495647_0063312_126_1166 346
276 3300046683 Ga0495658_0079738 Ga0495658_0079738_482_1582 346
277 3300046689 Ga0495613_0083571 Ga0495613_0083571_470_1510 346
278 3300047315 Ga0495581_0003518 Ga0495581_0003518_7442_8542 346
279 3300047315 Ga0495581_0040925 Ga0495581_0040925_1303_2343 346
280 3300047322 Ga0495680_0023948 Ga0495680_0023948_1619_2719 346
281 3300047471 Ga0495684_0117704 Ga0495684_0117704_457_1557 346
282 3300047471 Ga0495684_0124544 Ga0495684_0124544_381_1421 346
283 3300047673 Ga0495593_0061770 Ga0495593_0061770_277_1317 346
284 3300048089 Ga0495614_0045830 Ga0495614_0045830_627_1667 346
285 3300053077 Ga0495601_0021105 Ga0495601_0021105_1361_2461 346
286 3300053078 Ga0495612_0019553 Ga0495612_0019553_1171_2271 346
287 3300005439 Ga0070711_100061450 Ga0070711_1000614501 348
288 3300005468 Ga0070707_100001010 Ga0070707_10000101025 348
289 3300005471 Ga0070698_100000006 Ga0070698_10000000679 348
290 3300005983 Ga0081540_1009622 Ga0081540_10096227 348
291 3300006844 Ga0075428_100183913 Ga0075428_1001839133 348
292 3300006852 Ga0075433_10246797 Ga0075433_102467971 348
293 3300009094 Ga0111539_10063831 Ga0111539_100638313 348
294 3300025910 Ga0207684_10120939 Ga0207684_101209391 348
295 3300037853 Ga0436364_0951890 Ga0436364_0951890_1454_2539 348
296 3300048929 Ga0496126_0230469 Ga0496126_0230469_145_1332 348
297 3300050507 nmdc:mga05p37_20920_c1 nmdc:mga05p37_20920_c1_6672_7718 348
298 3300050512 nmdc:mga0n895_34758_c1 nmdc:mga0n895_34758_c1_867_1913 348
299 3300050513 nmdc:mga0rr50_84862_c1 nmdc:mga0rr50_84862_c1_1397_2443 348
300 3300050514 nmdc:mga08x19_18272_c1 nmdc:mga08x19_18272_c1_70_1116 348
301 3300050515 nmdc:mga0a205_160192_c1 nmdc:mga0a205_160192_c1_1029_2075 348
302 3300050515 nmdc:mga0a205_336753_c1 nmdc:mga0a205_336753_c1_250_1296 348
303 3300005435 Ga0070714_100349705 Ga0070714_1003497051 349
304 3300005437 Ga0070710_10167149 Ga0070710_101671491 349
305 3300005468 Ga0070707_100131939 Ga0070707_1001319393 349
306 3300005471 Ga0070698_100000554 Ga0070698_10000055422 349
307 3300005471 Ga0070698_100035671 Ga0070698_1000356713 349
308 3300006175 Ga0070712_100084511 Ga0070712_1000845113 349
309 3300006871 Ga0075434_100012579 Ga0075434_1000125795 349
310 3300006914 Ga0075436_100018464 Ga0075436_1000184643 349
311 3300007076 Ga0075435_100003684 Ga0075435_1000036842 349
312 3300025910 Ga0207684_10022686 Ga0207684_100226865 349
313 3300025922 Ga0207646_10122643 Ga0207646_101226432 349
314 3300025929 Ga0207664_10205021 Ga0207664_102050211 349
315 3300035120 Ga0373957_0013785 Ga0373957_0013785_1377_2477 349
316 3300035691 Ga0373931_0039376 Ga0373931_0039376_690_1739 349
317 3300050513 nmdc:mga0rr50_5260_c1 nmdc:mga0rr50_5260_c1_4244_5293 349
318 3300050514 nmdc:mga08x19_4028_c1 nmdc:mga08x19_4028_c1_3045_4094 349
319 3300025922 Ga0207646_10000049 Ga0207646_1000004984 350
320 3300005435 Ga0070714_100044778 Ga0070714_1000447783 351
321 3300005436 Ga0070713_100011428 Ga0070713_1000114282 351
322 3300005468 Ga0070707_100005267 Ga0070707_1000052672 351
323 3300005471 Ga0070698_100175447 Ga0070698_1001754471 351
324 3300025922 Ga0207646_10079959 Ga0207646_100799592 351
325 3300035724 Ga0373933_0018007 Ga0373933_0018007_1860_3020 351
326 3300005437 Ga0070710_10070543 Ga0070710_100705432 352
327 3300005439 Ga0070711_100031243 Ga0070711_1000312434 352
328 3300006173 Ga0070716_100131320 Ga0070716_1001313202 352
329 3300006175 Ga0070712_100093708 Ga0070712_1000937082 352
330 3300025898 Ga0207692_10087813 Ga0207692_100878132 352
331 3300025906 Ga0207699_10052911 Ga0207699_100529112 352
332 3300025915 Ga0207693_10093453 Ga0207693_100934533 352
333 3300025939 Ga0207665_10119170 Ga0207665_101191702 352
334 3300005435 Ga0070714_100251788 Ga0070714_1002517881 353
335 3300006175 Ga0070712_100203271 Ga0070712_1002032712 353
336 3300025915 Ga0207693_10094013 Ga0207693_100940132 353
337 3300025916 Ga0207663_10048802 Ga0207663_100488021 353
338 3300037853 Ga0436364_0051808 Ga0436364_0051808_323_1474 353
339 3300037853 Ga0436364_1121364 Ga0436364_1121364_25_1113 353
340 3300037853 Ga0436364_1370375 Ga0436364_1370375_1105_2259 353
341 3300044693 Ga0466961_0133764 Ga0466961_0133764_177_1241 353
342 3300006028 Ga0070717_10064358 Ga0070717_100643582 354
343 3300006173 Ga0070716_100014970 Ga0070716_1000149702 354
344 3300046477 Ga0495664_0148378 Ga0495664_0148378_247_1332 354
345 3300047319 Ga0495674_0060153 Ga0495674_0060153_320_1405 354
346 3300005618 Ga0068864_100387429 Ga0068864_1003874291 355
347 3300005841 Ga0068863_100354717 Ga0068863_1003547171 355
348 3300006871 Ga0075434_100020063 Ga0075434_1000200633 355
349 3300006914 Ga0075436_100040930 Ga0075436_1000409303 355
350 3300014969 Ga0157376_10048049 Ga0157376_100480493 355
351 3300025898 Ga0207692_10014474 Ga0207692_100144743 355
352 3300025905 Ga0207685_10017437 Ga0207685_100174372 355
353 3300025928 Ga0207700_10007634 Ga0207700_100076346 355
354 3300025928 Ga0207700_10198537 Ga0207700_101985372 355
355 3300025929 Ga0207664_10052981 Ga0207664_100529813 355
356 3300025939 Ga0207665_10037259 Ga0207665_100372593 355
357 3300026078 Ga0207702_10165743 Ga0207702_101657433 355
358 3300034819 Ga0373958_0005531 Ga0373958_0005531_800_1867 355
359 3300035085 Ga0373929_0007055 Ga0373929_0007055_58_1125 355
360 3300035113 Ga0373936_0006872 Ga0373936_0006872_2677_3744 355
361 3300035172 Ga0373955_0082205 Ga0373955_0082205_243_1310 355
362 3300035242 Ga0373962_0005962 Ga0373962_0005962_186_1253 355
363 3300035410 Ga0373924_0022456 Ga0373924_0022456_895_1962 355
364 3300035724 Ga0373933_0003342 Ga0373933_0003342_476_1543 355
365 3300036401 Ga0373937_0011439 Ga0373937_0011439_6208_7275 355
366 3300046459 Ga0495629_0079255 Ga0495629_0079255_525_1592 355
367 3300046476 Ga0495662_0012961 Ga0495662_0012961_555_1622 355
368 3300046511 Ga0495608_0010436 Ga0495608_0010436_547_1614 355
369 3300046536 Ga0495587_0104800 Ga0495587_0104800_525_1592 355
370 3300046683 Ga0495658_0101078 Ga0495658_0101078_299_1366 355
371 3300046690 Ga0495624_0064123 Ga0495624_0064123_610_1677 355
372 3300046809 Ga0495600_0058516 Ga0495600_0058516_824_1891 355
373 3300047315 Ga0495581_0044575 Ga0495581_0044575_965_2032 355
374 3300047317 Ga0495604_0010660 Ga0495604_0010660_345_1412 355
375 3300047319 Ga0495674_0085680 Ga0495674_0085680_118_1185 355
376 3300047321 Ga0495676_0084199 Ga0495676_0084199_317_1384 355
377 3300047322 Ga0495680_0040615 Ga0495680_0040615_2005_3072 355
378 3300047471 Ga0495684_0002879 Ga0495684_0002879_10960_12027 355
379 3300047673 Ga0495593_0020780 Ga0495593_0020780_587_1654 355
380 3300048905 Ga0496102_0097688 Ga0496102_0097688_1133_2200 355
381 3300048907 Ga0496104_0040208 Ga0496104_0040208_1022_2089 355
382 3300048910 Ga0496107_0106390 Ga0496107_0106390_332_1399 355
383 3300048911 Ga0496108_0043614 Ga0496108_0043614_1475_2542 355
384 3300048911 Ga0496108_0069469 Ga0496108_0069469_441_1553 355
385 3300048917 Ga0496114_0075102 Ga0496114_0075102_958_2025 355
386 3300050512 nmdc:mga0n895_91604_c1 nmdc:mga0n895_91604_c1_825_1892 355
387 3300050513 nmdc:mga0rr50_21508_c1 nmdc:mga0rr50_21508_c1_3051_4118 355
388 3300050515 nmdc:mga0a205_141874_c1 nmdc:mga0a205_141874_c1_747_1814 355
389 3300013307 Ga0157372_10450180 Ga0157372_104501801 357
390 3300025944 Ga0207661_10367112 Ga0207661_103671121 358
391 3300005434 Ga0070709_10015283 Ga0070709_100152832 359
392 3300005435 Ga0070714_100005682 Ga0070714_1000056826 359
393 3300005436 Ga0070713_100060531 Ga0070713_1000605311 359
394 3300006175 Ga0070712_100139353 Ga0070712_1001393533 359
395 3300021388 Ga0213875_10000330 Ga0213875_1000033024 359
396 3300025906 Ga0207699_10180841 Ga0207699_101808412 359
397 3300025915 Ga0207693_10050171 Ga0207693_100501712 359
398 3300025928 Ga0207700_10025666 Ga0207700_100256663 359
399 3300025929 Ga0207664_10004626 Ga0207664_100046261 359
400 3300037853 Ga0436364_0059473 Ga0436364_0059473_26244_27326 359
401 3300005471 Ga0070698_100126391 Ga0070698_1001263913 362
402 3300046462 Ga0495651_0161855 Ga0495651_0161855_57_1169 363
403 3300045976 Ga0466967_0023475 Ga0466967_0023475_1196_2302 368
404 3300005444 Ga0070694_100212866 Ga0070694_1002128661 369
405 3300005563 Ga0068855_100383930 Ga0068855_1003839302 369
406 3300005334 Ga0068869_100107674 Ga0068869_1001076742 370
407 3300005336 Ga0070680_100293627 Ga0070680_1002936271 370
408 3300005337 Ga0070682_100101284 Ga0070682_1001012842 370
409 3300005458 Ga0070681_10201102 Ga0070681_102011021 370
410 3300005618 Ga0068864_100020816 Ga0068864_1000208164 370
411 3300005983 Ga0081540_1001127 Ga0081540_100112716 370
412 3300006173 Ga0070716_100114759 Ga0070716_1001147591 370
413 3300009551 Ga0105238_10163826 Ga0105238_101638262 370
414 3300013105 Ga0157369_10189367 Ga0157369_101893671 370
415 3300013297 Ga0157378_10370666 Ga0157378_103706661 370
416 3300025916 Ga0207663_10090161 Ga0207663_100901612 370
417 3300025924 Ga0207694_10173335 Ga0207694_101733351 370
418 3300025929 Ga0207664_10121384 Ga0207664_101213842 370
419 3300025942 Ga0207689_10160488 Ga0207689_101604881 370
420 3300025949 Ga0207667_10144400 Ga0207667_101444001 370
421 3300026088 Ga0207641_10120875 Ga0207641_101208752 370
422 3300028379 Ga0268266_10296605 Ga0268266_102966051 370
423 3300035086 Ga0373934_0088700 Ga0373934_0088700_58_1170 370
424 3300035113 Ga0373936_0016572 Ga0373936_0016572_862_1974 370
425 3300035116 Ga0373945_0000757 Ga0373945_0000757_771_1883 370
426 3300035692 Ga0373935_0024522 Ga0373935_0024522_1713_2825 370
427 3300046462 Ga0495651_0058683 Ga0495651_0058683_39_1151 370
428 3300046517 Ga0495630_0043176 Ga0495630_0043176_1768_2880 370
429 3300046529 Ga0495652_0002603 Ga0495652_0002603_16758_17870 370
430 3300046535 Ga0495586_0116393 Ga0495586_0116393_65_1177 370
431 3300046536 Ga0495587_0048908 Ga0495587_0048908_19_1131 370
432 3300047322 Ga0495680_0013295 Ga0495680_0013295_2470_3582 370
433 3300047471 Ga0495684_0176936 Ga0495684_0176936_297_1409 370
434 3300048088 Ga0495602_0165112 Ga0495602_0165112_322_1434 370
435 3300048905 Ga0496102_0140973 Ga0496102_0140973_295_1452 370
436 3300048913 Ga0496110_0121468 Ga0496110_0121468_597_1754 370
437 3300048916 Ga0496113_0098844 Ga0496113_0098844_597_1754 370
438 3300053084 Ga0495595_0102400 Ga0495595_0102400_253_1365 370
439 3300013296 Ga0157374_10153960 Ga0157374_101539602 372
440 3300013306 Ga0163162_10326749 Ga0163162_103267491 372
441 3300025927 Ga0207687_10079518 Ga0207687_100795181 373
442 3300026116 Ga0207674_10059754 Ga0207674_100597544 373
443 3300005549 Ga0070704_100287534 Ga0070704_1002875341 375
444 3300003659 JGI25404J52841_10021680 JGI25404J52841_100216801 385
445 3300005547 Ga0070693_100159199 Ga0070693_1001591991 385
446 3300006871 Ga0075434_100089364 Ga0075434_1000893643 385
447 3300006881 Ga0068865_100188757 Ga0068865_1001887571 385
448 3300009098 Ga0105245_10192701 Ga0105245_101927012 385
449 3300009101 Ga0105247_10090678 Ga0105247_100906781 385
450 3300009545 Ga0105237_10310926 Ga0105237_103109261 385
451 3300010375 Ga0105239_10462807 Ga0105239_104628071 385
452 3300012478 Ga0157328_1000556 Ga0157328_10005561 385
453 3300012480 Ga0157346_1000606 Ga0157346_10006061 385
454 3300012488 Ga0157343_1000333 Ga0157343_10003332 385
455 3300012507 Ga0157342_1000265 Ga0157342_10002651 385
456 3300013104 Ga0157370_10130822 Ga0157370_101308221 385
457 3300014325 Ga0163163_10264754 Ga0163163_102647541 385
458 3300025900 Ga0207710_10106965 Ga0207710_101069651 385
459 3300025910 Ga0207684_10159717 Ga0207684_101597172 385
460 3300025929 Ga0207664_10044539 Ga0207664_100445392 385
461 3300025939 Ga0207665_10024322 Ga0207665_100243223 385
462 3300025941 Ga0207711_10126438 Ga0207711_101264381 385
463 3300025986 Ga0207658_10145213 Ga0207658_101452131 385
464 3300026121 Ga0207683_10106092 Ga0207683_101060921 385
465 3300034816 Ga0373930_0020395 Ga0373930_0020395_90_1247 385
466 3300035089 Ga0373944_0005510 Ga0373944_0005510_1973_3130 385
467 3300035724 Ga0373933_0197536 Ga0373933_0197536_78_1235 385
468 3300036401 Ga0373937_0120804 Ga0373937_0120804_892_2049 385
469 3300046461 Ga0495641_0005777 Ga0495641_0005777_5300_6457 385
470 3300046511 Ga0495608_0037781 Ga0495608_0037781_845_2002 385
471 3300046526 Ga0495666_0101070 Ga0495666_0101070_32_1189 385
472 3300046690 Ga0495624_0045471 Ga0495624_0045471_780_1937 385
473 3300050515 nmdc:mga0a205_338262_c1 nmdc:mga0a205_338262_c1_134_1291 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03631

Virul_fac_BrkB

Virulence factor BrkB

32

278

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nim-assembly1.cif.gz_A ethr complex 0.3426 122 289
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.3327 58 298
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.3274 58 298
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.3268 58 298
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.3231 58 298
ID Description Score Start End Superfamily
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4235 126 258 1.10.1760.20
af_Q9N2Z6_260_461_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3728 107 309 1.20.1640.10
af_P39398_249_450_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3724 136 309 1.20.1250.20
af_Q2FYK0_57_218_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3712 126 258 1.10.1760.20
af_Q20404_233_449_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3529 106 295 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A6G2FXU1-F1-model_v4 YihY/virulence factor BrkB family protein 0.7241 158 295 GO:0005886
AF-A0A848UDF8-F1-model_v4 YihY/virulence factor BrkB family protein 0.7161 15 230 GO:0005886
AF-A0A2R6HNT0-F1-model_v4 YihY/virulence factor BrkB family protein 0.7066 23 300 GO:0005886
AF-A0A815UCD7-F1-model_v4 Uncharacterized protein 0.705 58 262 GO:0005886
AF-A0A848UDF8-F1-model_v4 YihY/virulence factor BrkB family protein 0.7038 15 230 GO:0005886

Feature Viewer

pLDDT pTM Quality
64.28 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map