F446413

General Info

Members Datasets Scaffolds Average Seq Length
449 242 898 214

Family's Representative Sequence

Representative Sequence 3300027717|Ga0209998_10049385|Ga0209998_100493851
Length 259
Sequence MTAWDAGPTTLWLMLLLGAYHGVNPGMGWLFAVALGMQNRSARAVAGSLVPIAIGHALAIGAVVAAITLMDVTLPAATIRYVIATLLIALGLYRLVRHRHPRWVRMQVGFRDLVAWSFLMASAHGAGLMVVPLLVGTQGVEAADHASHYGHTAMASPLAGLLASAVHTFGYLTVTGLVAWIVYRKLGLALLRRAWINLDLIWTTALVVSADITVILISPVGSVNDPPAARPSNVDVLGFMSSSHDQLLDRVVARMSSPA

Samples

Sample ID Description Type Environment
1 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.02
Rhizosphere 88.2
Stem 0
Stem Tuber 0
Unclassified 12.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209998_10049385 3300027717 Bacteria 971
2 rootH2_10169024 3300003320 Eukaryota 1031
3 Ga0070683_100000260 3300005329 Bacteria 36410
4 Ga0070670_100050274 3300005331 Bacteria 3582
5 Ga0068869_100283987 3300005334 Unclassified 1332
6 Ga0068869_100575638 3300005334 Bacteria 949
7 Ga0070666_10145582 3300005335 Bacteria 1651
8 Ga0070680_100033739 3300005336 Bacteria 4127
9 Ga0070661_100011880 3300005344 Bacteria 6077
10 Ga0070661_100014700 3300005344 Bacteria 5520
11 Ga0070692_10317268 3300005345 Unclassified 957
12 Ga0070668_100023048 3300005347 Bacteria 4706
13 Ga0070675_100006415 3300005354 Bacteria 9026
14 Ga0070675_100122079 3300005354 Bacteria 2214
15 Ga0070671_100060894 3300005355 Bacteria 3143
16 Ga0070674_100170319 3300005356 Bacteria 1659
17 Ga0070673_100073357 3300005364 Bacteria 2754
18 Ga0070673_100166096 3300005364 Bacteria 1881
19 Ga0070667_100008007 3300005367 Bacteria 8765
20 Ga0070709_10004602 3300005434 Bacteria 7452
21 Ga0070709_10083759 3300005434 Unclassified 2086
22 Ga0070714_100067106 3300005435 Bacteria 3092
23 Ga0070714_100321281 3300005435 Bacteria 1447
24 Ga0070713_100000860 3300005436 Bacteria 19441
25 Ga0070713_100032939 3300005436 Unclassified 4146
26 Ga0070713_100202245 3300005436 Unclassified 1794
27 Ga0070710_10054794 3300005437 Bacteria 2251
28 Ga0070710_10084480 3300005437 Bacteria 1860
29 Ga0070711_100000111 3300005439 Bacteria 42762
30 Ga0070711_100746731 3300005439 Unclassified 827
31 Ga0070700_100015088 3300005441 Bacteria 4373
32 Ga0070694_100259704 3300005444 Bacteria 1317
33 Ga0070708_100011368 3300005445 Bacteria 7240
34 Ga0070708_100016704 3300005445 Bacteria 6098
35 Ga0070678_100030722 3300005456 Bacteria 3696
36 Ga0070662_100014378 3300005457 Bacteria 5286
37 Ga0070662_100197112 3300005457 Bacteria 1596
38 Ga0070681_10140110 3300005458 Bacteria 2349
39 Ga0070681_10479490 3300005458 Bacteria 1157
40 Ga0068867_100230942 3300005459 Bacteria 1495
41 Ga0068867_100423248 3300005459 Bacteria 1128
42 Ga0070685_10228891 3300005466 Bacteria 1221
43 Ga0070706_100014288 3300005467 Bacteria 7337
44 Ga0070706_100138362 3300005467 Bacteria 2273
45 Ga0070706_100452620 3300005467 Bacteria 1194
46 Ga0070707_100053635 3300005468 Bacteria 3866
47 Ga0070707_100097132 3300005468 Bacteria 2853
48 Ga0070707_100100382 3300005468 Bacteria 2804
49 Ga0070707_100252349 3300005468 Bacteria 1717
50 Ga0070698_100018496 3300005471 Bacteria 7337
51 Ga0070699_100005139 3300005518 Bacteria 11511
52 Ga0070699_100564470 3300005518 Bacteria 1036
53 Ga0070679_100027225 3300005530 Bacteria 5624
54 Ga0070684_100008590 3300005535 Bacteria 7999
55 Ga0070684_100510678 3300005535 Bacteria 1113
56 Ga0070697_100013677 3300005536 Bacteria 6368
57 Ga0070697_100147125 3300005536 Bacteria 1984
58 Ga0068853_100005324 3300005539 Bacteria 10074
59 Ga0068853_100457745 3300005539 Unclassified 1200
60 Ga0070672_100023195 3300005543 Bacteria 4570
61 Ga0070672_100276884 3300005543 Bacteria 1418
62 Ga0070686_100151772 3300005544 Bacteria 1623
63 Ga0070695_100245294 3300005545 Bacteria 1301
64 Ga0070695_100350395 3300005545 Bacteria 1106
65 Ga0070696_100101632 3300005546 Bacteria 2061
66 Ga0070693_100255867 3300005547 Unclassified 1162
67 Ga0070704_100004266 3300005549 Bacteria 8264
68 Ga0070704_100038114 3300005549 Bacteria 3290
69 Ga0070704_100088382 3300005549 Bacteria 2302
70 Ga0070664_100001086 3300005564 Bacteria 21433
71 Ga0070664_100124103 3300005564 Bacteria 2263
72 Ga0068857_100130599 3300005577 Bacteria 2265
73 Ga0068854_100019456 3300005578 Bacteria 4576
74 Ga0068854_100164585 3300005578 Bacteria 1721
75 Ga0068856_100003929 3300005614 Bacteria 14898
76 Ga0068856_100018329 3300005614 Bacteria 6785
77 Ga0068856_100252555 3300005614 Bacteria 1778
78 Ga0068852_100010646 3300005616 Bacteria 6883
79 Ga0068852_101031456 3300005616 Unclassified 842
80 Ga0068859_100048417 3300005617 Bacteria 4270
81 Ga0068864_100366700 3300005618 Bacteria 1362
82 Ga0068861_100328166 3300005719 Bacteria 1335
83 Ga0068851_10408751 3300005834 Unclassified 800
84 Ga0068863_100002136 3300005841 Bacteria 19618
85 Ga0068863_100007159 3300005841 Bacteria 10945
86 Ga0068863_100077141 3300005841 Bacteria 3153
87 Ga0068858_100063521 3300005842 Bacteria 3417
88 Ga0068860_100064181 3300005843 Bacteria 3488
89 Ga0068862_100037163 3300005844 Bacteria 4127
90 Ga0068862_100280991 3300005844 Bacteria 1526
91 Ga0068862_100330333 3300005844 Bacteria 1410
92 Ga0081540_1000915 3300005983 Bacteria 26583
93 Ga0070717_10014792 3300006028 Bacteria 6004
94 Ga0070717_10075511 3300006028 Bacteria 2819
95 Ga0070717_10105414 3300006028 Bacteria 2399
96 Ga0070717_10211835 3300006028 Bacteria 1701
97 Ga0070717_10692981 3300006028 Unclassified 925
98 Ga0070716_100015175 3300006173 Bacteria 3953
99 Ga0070716_100060101 3300006173 Bacteria 2194
100 Ga0070716_100089027 3300006173 Bacteria 1864
101 Ga0070716_100196582 3300006173 Unclassified 1337
102 Ga0070716_100383633 3300006173 Bacteria 1005
103 Ga0070712_100001487 3300006175 Bacteria 14308
104 Ga0070712_100007166 3300006175 Bacteria 6954
105 Ga0070712_100051579 3300006175 Bacteria 2866
106 Ga0070712_100218415 3300006175 Bacteria 1507
107 Ga0097621_100012324 3300006237 Bacteria 6332
108 Ga0097621_100086651 3300006237 Bacteria 2614
109 Ga0097621_100632224 3300006237 Bacteria 981
110 Ga0068871_100100203 3300006358 Bacteria 2426
111 Ga0075434_100049271 3300006871 Bacteria 4182
112 Ga0075434_100066717 3300006871 Bacteria 3585
113 Ga0075434_100447573 3300006871 Bacteria 1313
114 Ga0068865_100016133 3300006881 Unclassified 4772
115 Ga0068865_100018019 3300006881 Bacteria 4551
116 Ga0075436_100006310 3300006914 Bacteria 8123
117 Ga0075436_100025872 3300006914 Bacteria 4039
118 Ga0097620_100048415 3300006931 Bacteria 4270
119 Ga0075435_100270348 3300007076 Bacteria 1450
120 Ga0075435_100294597 3300007076 Bacteria 1387
121 Ga0099794_10068718 3300007265 Unclassified 1732
122 Ga0105240_10083876 3300009093 Unclassified 3909
123 Ga0105240_10192667 3300009093 Bacteria 2396
124 Ga0105240_10642290 3300009093 Bacteria 1164
125 Ga0111539_10006002 3300009094 Bacteria 15694
126 Ga0111539_10236378 3300009094 Bacteria 2127
127 Ga0105245_10000140 3300009098 Bacteria 68524
128 Ga0105245_10011212 3300009098 Bacteria 7802
129 Ga0105245_10070307 3300009098 Unclassified 3176
130 Ga0105245_10527975 3300009098 Bacteria 1200
131 Ga0105247_10020635 3300009101 Bacteria 3961
132 Ga0105247_10351223 3300009101 Bacteria 1037
133 Ga0114129_10006247 3300009147 Bacteria 16889
134 Ga0114129_10026708 3300009147 Bacteria 8177
135 Ga0114129_10649505 3300009147 Bacteria 1362
136 Ga0105241_10007441 3300009174 Bacteria 8061
137 Ga0105241_10019639 3300009174 Bacteria 4986
138 Ga0105241_10073321 3300009174 Bacteria 2663
139 Ga0105242_10198222 3300009176 Unclassified 1782
140 Ga0105242_10422199 3300009176 Unclassified 1250
141 Ga0105248_10011994 3300009177 Bacteria 9557
142 Ga0105248_10050196 3300009177 Bacteria 4678
143 Ga0105248_10145812 3300009177 Bacteria 2671
144 Ga0105237_10051564 3300009545 Bacteria 4133
145 Ga0105237_10230869 3300009545 Bacteria 1851
146 Ga0105237_10513196 3300009545 Bacteria 1205
147 Ga0105237_10675011 3300009545 Bacteria 1040
148 Ga0105238_10454250 3300009551 Bacteria 1278
149 Ga0105249_10028133 3300009553 Bacteria 5074
150 Ga0105249_10712107 3300009553 Bacteria 1064
151 Ga0105239_10025837 3300010375 Bacteria 6468
152 Ga0105239_10034500 3300010375 Bacteria 5557
153 Ga0105239_10118067 3300010375 Bacteria 2944
154 Ga0105239_10985602 3300010375 Unclassified 969
155 Ga0105246_10103278 3300011119 Bacteria 2079
156 Ga0105246_10836415 3300011119 Bacteria 820
157 Ga0157373_10065983 3300013100 Bacteria 2561
158 Ga0157373_10079437 3300013100 Unclassified 2314
159 Ga0157371_10612425 3300013102 Bacteria 811
160 Ga0157369_10024702 3300013105 Bacteria 6678
161 Ga0157374_10017854 3300013296 Bacteria 6252
162 Ga0157374_10176521 3300013296 Bacteria 2085
163 Ga0157374_10297759 3300013296 Bacteria 1595
164 Ga0157374_10355558 3300013296 Bacteria 1456
165 Ga0157374_10357346 3300013296 Bacteria 1452
166 Ga0157378_10019162 3300013297 Bacteria 6013
167 Ga0157378_10031740 3300013297 Bacteria 4666
168 Ga0157378_10216481 3300013297 Unclassified 1819
169 Ga0157378_10277202 3300013297 Bacteria 1615
170 Ga0157378_10400758 3300013297 Bacteria 1352
171 Ga0163162_10000671 3300013306 Bacteria 31762
172 Ga0163162_10044612 3300013306 Bacteria 4441
173 Ga0163162_10302033 3300013306 Bacteria 1733
174 Ga0157372_10021754 3300013307 Bacteria 6931
175 Ga0157372_10230165 3300013307 Bacteria 2149
176 Ga0157375_11022272 3300013308 Bacteria 965
177 Ga0163163_10002751 3300014325 Bacteria 14839
178 Ga0163163_10083541 3300014325 Bacteria 3199
179 Ga0163163_10465056 3300014325 Bacteria 1325
180 Ga0157379_10002994 3300014968 Bacteria 14251
181 Ga0157379_10012385 3300014968 Bacteria 7451
182 Ga0157379_10020784 3300014968 Bacteria 5809
183 Ga0157379_10374760 3300014968 Bacteria 1305
184 Ga0157376_10009086 3300014969 Bacteria 7202
185 Ga0157376_10046626 3300014969 Bacteria 3575
186 Ga0157376_10055327 3300014969 Unclassified 3310
187 Ga0157376_10181044 3300014969 Bacteria 1926
188 Ga0157376_10336763 3300014969 Bacteria 1440
189 Ga0157376_10527614 3300014969 Bacteria 1165
190 Ga0157376_10638967 3300014969 Bacteria 1063
191 Ga0163161_10017254 3300017792 Bacteria 5051
192 Ga0213872_10010252 3300021361 Bacteria 4467
193 Ga0213876_10206612 3300021384 Unclassified 1044
194 Ga0213875_10015738 3300021388 Bacteria 3677
195 Ga0207697_10013096 3300025315 Plasmid 3464
196 Ga0207692_10053959 3300025898 Bacteria 2050
197 Ga0207692_10104613 3300025898 Bacteria 1560
198 Ga0207680_10026502 3300025903 Bacteria 3214
199 Ga0207647_10014346 3300025904 Bacteria 5462
200 Ga0207685_10022608 3300025905 Bacteria 2128
201 Ga0207699_10002392 3300025906 Bacteria 8859
202 Ga0207699_10069885 3300025906 Bacteria 2143
203 Ga0207699_10111281 3300025906 Unclassified 1755
204 Ga0207699_10159463 3300025906 Bacteria 1500
205 Ga0207645_10033197 3300025907 Bacteria 3318
206 Ga0207645_10180367 3300025907 Unclassified 1385
207 Ga0207684_10000445 3300025910 Bacteria 54460
208 Ga0207684_10138205 3300025910 Bacteria 2093
209 Ga0207684_10655509 3300025910 Bacteria 894
210 Ga0207654_10006135 3300025911 Bacteria 6037
211 Ga0207654_10021141 3300025911 Bacteria 3457
212 Ga0207654_10022354 3300025911 Bacteria 3373
213 Ga0207707_10065318 3300025912 Bacteria 3170
214 Ga0207707_10265086 3300025912 Bacteria 1490
215 Ga0207695_10082883 3300025913 Bacteria 3241
216 Ga0207695_10229154 3300025913 Bacteria 1763
217 Ga0207671_10206466 3300025914 Bacteria 1535
218 Ga0207693_10000368 3300025915 Bacteria 41317
219 Ga0207693_10002915 3300025915 Bacteria 14803
220 Ga0207693_10039171 3300025915 Bacteria 3732
221 Ga0207693_10051530 3300025915 Bacteria 3229
222 Ga0207693_10146957 3300025915 Bacteria 1854
223 Ga0207693_10148877 3300025915 Bacteria 1841
224 Ga0207663_10001077 3300025916 Bacteria 12519
225 Ga0207663_10046944 3300025916 Bacteria 2664
226 Ga0207663_10095316 3300025916 Bacteria 1985
227 Ga0207660_10258184 3300025917 Unclassified 1377
228 Ga0207657_10009169 3300025919 Bacteria 9980
229 Ga0207649_10015922 3300025920 Bacteria 4231
230 Ga0207646_10002173 3300025922 Bacteria 23409
231 Ga0207646_10082738 3300025922 Bacteria 2871
232 Ga0207646_10164932 3300025922 Bacteria 2000
233 Ga0207681_10764756 3300025923 Bacteria 806
234 Ga0207659_10032083 3300025926 Bacteria 3602
235 Ga0207659_10079817 3300025926 Bacteria 2415
236 Ga0207687_10000108 3300025927 Bacteria 59942
237 Ga0207687_10001365 3300025927 Bacteria 16702
238 Ga0207687_10058865 3300025927 Bacteria 2704
239 Ga0207700_10005939 3300025928 Bacteria 7347
240 Ga0207700_10053967 3300025928 Bacteria 3014
241 Ga0207700_10070086 3300025928 Unclassified 2694
242 Ga0207700_10115784 3300025928 Bacteria 2165
243 Ga0207700_10190916 3300025928 Unclassified 1721
244 Ga0207664_10296533 3300025929 Bacteria 1422
245 Ga0207664_10362755 3300025929 Bacteria 1284
246 Ga0207664_10782571 3300025929 Bacteria 858
247 Ga0207644_10115826 3300025931 Bacteria 2033
248 Ga0207706_10000251 3300025933 Bacteria 58605
249 Ga0207706_10015048 3300025933 Bacteria 7004
250 Ga0207706_10255297 3300025933 Bacteria 1531
251 Ga0207686_10052911 3300025934 Bacteria 2536
252 Ga0207709_10221008 3300025935 Bacteria 1366
253 Ga0207669_10512028 3300025937 Bacteria 962
254 Ga0207704_10012820 3300025938 Bacteria 4170
255 Ga0207704_10208608 3300025938 Bacteria 1436
256 Ga0207665_10133371 3300025939 Bacteria 1765
257 Ga0207665_10270585 3300025939 Bacteria 1261
258 Ga0207691_10246166 3300025940 Bacteria 1544
259 Ga0207711_10007197 3300025941 Bacteria 9326
260 Ga0207711_10014859 3300025941 Bacteria 6468
261 Ga0207711_10017882 3300025941 Bacteria 5890
262 Ga0207711_10246772 3300025941 Bacteria 1638
263 Ga0207689_10217526 3300025942 Bacteria 1578
264 Ga0207661_10007845 3300025944 Bacteria 7603
265 Ga0207679_10010791 3300025945 Bacteria 5890
266 Ga0207679_10181978 3300025945 Bacteria 1739
267 Ga0207667_10018988 3300025949 Bacteria 7687
268 Ga0207651_10015273 3300025960 Bacteria 4458
269 Ga0207651_10028949 3300025960 Bacteria 3502
270 Ga0207712_10016985 3300025961 Bacteria 4721
271 Ga0207712_10191378 3300025961 Bacteria 1615
272 Ga0207712_10717783 3300025961 Unclassified 873
273 Ga0207668_10008279 3300025972 Bacteria 6196
274 Ga0207640_10026325 3300025981 Bacteria 3530
275 Ga0207640_10129528 3300025981 Bacteria 1822
276 Ga0207658_10727996 3300025986 Bacteria 897
277 Ga0207677_10019898 3300026023 Bacteria 4063
278 Ga0207677_10021384 3300026023 Bacteria 3951
279 Ga0207703_10010155 3300026035 Bacteria 7381
280 Ga0207639_10000904 3300026041 Bacteria 20095
281 Ga0207639_10800633 3300026041 Bacteria 878
282 Ga0207678_10007941 3300026067 Bacteria 9359
283 Ga0207678_10010076 3300026067 Bacteria 8292
284 Ga0207708_10055176 3300026075 Bacteria 3029
285 Ga0207702_10003302 3300026078 Bacteria 14858
286 Ga0207702_10554805 3300026078 Bacteria 1124
287 Ga0207641_10004266 3300026088 Bacteria 12431
288 Ga0207641_10124082 3300026088 Unclassified 2309
289 Ga0207641_10409298 3300026088 Bacteria 1304
290 Ga0207648_10087487 3300026089 Bacteria 2719
291 Ga0207676_10265230 3300026095 Bacteria 1553
292 Ga0207674_10031510 3300026116 Bacteria 5570
293 Ga0207675_100106497 3300026118 Bacteria 2644
294 Ga0207683_10004711 3300026121 Bacteria 11756
295 Ga0207698_10030999 3300026142 Bacteria 3854
296 Ga0207698_10370655 3300026142 Bacteria 1359
297 Ga0268265_10256861 3300028380 Bacteria 1551
298 Ga0268265_10551263 3300028380 Unclassified 1094
299 Ga0265760_10000496 3300031090 Bacteria 11048
300 Ga0265760_10026278 3300031090 Bacteria 1703
301 Ga0307510_10235867 3300033180 Bacteria 1328
302 Ga0373934_0007870 3300035086 Bacteria 3964
303 Ga0373944_0036669 3300035089 Bacteria 1499
304 Ga0373923_0020747 3300035111 Unclassified 2556
305 Ga0373936_0010185 3300035113 Bacteria 3549
306 Ga0373936_0073056 3300035113 Bacteria 1417
307 Ga0373936_0087100 3300035113 Bacteria 1306
308 Ga0373939_0196241 3300035114 Unclassified 761
309 Ga0373945_0001020 3300035116 Bacteria 8390
310 Ga0373954_0008776 3300035118 Bacteria 4446
311 Ga0373957_0081428 3300035120 Unclassified 1278
312 Ga0373960_0012203 3300035121 Bacteria 2132
313 Ga0373943_0000265 3300035170 Bacteria 21513
314 Ga0373943_0333110 3300035170 Unclassified 867
315 Ga0373946_0005364 3300035171 Bacteria 4619
316 Ga0373955_0022955 3300035172 Bacteria 3172
317 Ga0373955_0142375 3300035172 Bacteria 1407
318 Ga0373962_0006735 3300035242 Bacteria 2789
319 Ga0373924_0003179 3300035410 Bacteria 5619
320 Ga0373931_0131233 3300035691 Unclassified 1442
321 Ga0373931_0428638 3300035691 Bacteria 842
322 Ga0373935_0052276 3300035692 Bacteria 2597
323 Ga0373935_0758363 3300035692 Unclassified 715
324 Ga0373927_0000270 3300035695 Bacteria 40992
325 Ga0373927_0175314 3300035695 Bacteria 1406
326 Ga0373927_0295622 3300035695 Bacteria 1066
327 Ga0373933_0003793 3300035724 Bacteria 8350
328 Ga0373947_0000844 3300035725 Bacteria 18520
329 Ga0373937_0012903 3300036401 Bacteria 7359
330 Ga0373937_0475887 3300036401 Bacteria 1186
331 Ga0373925_0007916 3300037068 Bacteria 7738
332 Ga0373925_0019607 3300037068 Bacteria 4921
333 Ga0373925_0035658 3300037068 Bacteria 3671
334 Ga0373925_0736356 3300037068 Bacteria 813
335 Ga0436364_0915998 3300037853 Bacteria 12132
336 Ga0436365_0173497 3300039437 Bacteria 1926
337 Ga0436365_0601289 3300039437 Bacteria 787
338 Ga0436360_0324302 3300039438 Bacteria 5821
339 Ga0439448_0057779 3300042005 Unclassified 1279
340 Ga0466963_0025963 3300044694 Unclassified 3742
341 Ga0466964_0291407 3300044706 Bacteria 819
342 Ga0466959_0129697 3300045049 Bacteria 1787
343 Ga0466967_0751396 3300045976 Bacteria 967
344 Ga0495603_0042465 3300046455 Bacteria 2718
345 Ga0495629_0023148 3300046459 Unclassified 4427
346 Ga0495653_0138262 3300046463 Bacteria 1716
347 Ga0495580_0029783 3300046472 Bacteria 3960
348 Ga0495580_0033442 3300046472 Bacteria 3705
349 Ga0495580_0074674 3300046472 Bacteria 2366
350 Ga0495582_0198527 3300046473 Bacteria 1145
351 Ga0495664_0010815 3300046477 Bacteria 5132
352 Ga0495585_0438512 3300046492 Bacteria 626
353 Ga0495594_0163040 3300046499 Unclassified 1267
354 Ga0495630_0024504 3300046517 Bacteria 4460
355 Ga0495630_0032716 3300046517 Bacteria 3877
356 Ga0495630_0326443 3300046517 Bacteria 1173
357 Ga0495666_0065710 3300046526 Unclassified 1730
358 Ga0495640_0061160 3300046533 Unclassified 2559
359 Ga0495640_0257180 3300046533 Unclassified 1092
360 Ga0495586_0063605 3300046535 Bacteria 2010
361 Ga0495587_0453932 3300046536 Unclassified 710
362 Ga0495645_0045126 3300046543 Bacteria 3216
363 Ga0495645_0088989 3300046543 Bacteria 2208
364 Ga0495657_0200995 3300046675 Unclassified 1215
365 Ga0495657_0312485 3300046675 Unclassified 935
366 Ga0495623_0398330 3300046679 Unclassified 741
367 Ga0495658_0023375 3300046683 Unclassified 3280
368 Ga0495669_0089313 3300046684 Bacteria 1421
369 Ga0495669_0106364 3300046684 Bacteria 1307
370 Ga0495613_0051653 3300046689 Unclassified 3029
371 Ga0495624_0034638 3300046690 Bacteria 3265
372 Ga0495624_0109841 3300046690 Bacteria 1696
373 Ga0495581_0149365 3300047315 Bacteria 1364
374 Ga0495674_0013990 3300047319 Bacteria 7525
375 Ga0495674_0086201 3300047319 Bacteria 2689
376 Ga0495676_0040901 3300047321 Unclassified 3822
377 Ga0495676_0405733 3300047321 Unclassified 904
378 Ga0495680_0047203 3300047322 Bacteria 3389
379 Ga0495593_0069278 3300047673 Bacteria 1835
380 Ga0495602_0173719 3300048088 Bacteria 1670
381 Ga0495602_0402099 3300048088 Unclassified 976
382 Ga0496100_0042858 3300048903 Bacteria 2892
383 Ga0496100_0238627 3300048903 Bacteria 1340
384 Ga0496101_0030466 3300048904 Bacteria 3783
385 Ga0496101_0052947 3300048904 Bacteria 2927
386 Ga0496102_0023530 3300048905 Bacteria 5474
387 Ga0496102_0029987 3300048905 Bacteria 4867
388 Ga0496102_0089220 3300048905 Bacteria 2852
389 Ga0496102_0129292 3300048905 Bacteria 2363
390 Ga0496102_0192923 3300048905 Bacteria 1920
391 Ga0496103_0003591 3300048906 Bacteria 9464
392 Ga0496104_0105059 3300048907 Bacteria 2706
393 Ga0496104_1335096 3300048907 Unclassified 620
394 Ga0496105_0027229 3300048908 Bacteria 4668
395 Ga0496105_0066860 3300048908 Bacteria 2968
396 Ga0496105_0115963 3300048908 Bacteria 2209
397 Ga0496105_0452619 3300048908 Bacteria 1013
398 Ga0496105_0678936 3300048908 Bacteria 792
399 Ga0496106_0026710 3300048909 Bacteria 4299
400 Ga0496106_0350759 3300048909 Bacteria 1185
401 Ga0496107_0011847 3300048910 Bacteria 6090
402 Ga0496107_0055117 3300048910 Bacteria 2871
403 Ga0496107_0075608 3300048910 Bacteria 2452
404 Ga0496107_0937924 3300048910 Bacteria 630
405 Ga0496108_0082040 3300048911 Bacteria 2733
406 Ga0496108_0445820 3300048911 Bacteria 1131
407 Ga0496108_0637240 3300048911 Unclassified 927
408 Ga0496109_0000593 3300048912 Bacteria 30294
409 Ga0496109_0164402 3300048912 Bacteria 2080
410 Ga0496110_0016089 3300048913 Bacteria 6237
411 Ga0496110_0190236 3300048913 Bacteria 1864
412 Ga0496110_1019582 3300048913 Bacteria 735
413 Ga0496111_0031421 3300048914 Bacteria 3782
414 Ga0496112_0034035 3300048915 Bacteria 4957
415 Ga0496112_0245920 3300048915 Bacteria 1740
416 Ga0496112_0406747 3300048915 Bacteria 1300
417 Ga0496112_0748743 3300048915 Bacteria 903
418 Ga0496113_0316771 3300048916 Bacteria 1250
419 Ga0496114_0021185 3300048917 Bacteria 5286
420 Ga0496114_0088285 3300048917 Bacteria 2630
421 Ga0496114_0861145 3300048917 Unclassified 787
422 Ga0496114_0919205 3300048917 Bacteria 757
423 Ga0496115_0075020 3300048918 Bacteria 2747
424 Ga0496115_0125433 3300048918 Bacteria 2114
425 Ga0496115_0228473 3300048918 Bacteria 1535
426 Ga0496115_0283365 3300048918 Bacteria 1360
427 Ga0496126_0062543 3300048929 Bacteria 3339
428 Ga0501040_0114592 3300049576 Bacteria 1887
429 Ga0501042_0252464 3300049578 Bacteria 1273
430 Ga0501075_0260706 3300049591 Bacteria 1321
431 Ga0501076_0180474 3300049592 Bacteria 1721
432 Ga0501076_0793360 3300049592 Bacteria 781
433 Ga0501079_0302703 3300049741 Bacteria 1251
434 Ga0501081_0159717 3300049743 Bacteria 1624
435 nmdc:mga05p37_441112_c1 3300050507 Bacteria 1510
436 nmdc:mga08y16_5159_c1 3300050511 Bacteria 5151
437 nmdc:mga0n895_191332_c1 3300050512 Bacteria 2077
438 nmdc:mga0n895_199796_c1 3300050512 Bacteria 2030
439 nmdc:mga0n895_42237_c1 3300050512 Bacteria 4436
440 nmdc:mga0rr50_29042_c1 3300050513 Bacteria 3894
441 nmdc:mga0rr50_386175_c1 3300050513 Bacteria 1181
442 nmdc:mga08x19_965_c1 3300050514 Bacteria 17983
443 nmdc:mga0a205_437305_c1 3300050515 Bacteria 1169
444 Ga0495601_0529431 3300053077 Bacteria 759
445 Ga0495612_0089190 3300053078 Bacteria 1303
446 Ga0495619_0144522 3300053085 Bacteria 1639
447 Ga0501084_0039501 3300054114 Bacteria 3947
448 Ga0590071_019332 3300059421 Unclassified 1602
449 Ga0501082_0220511 3300060353 Bacteria 1650
450 Ga0209998_10049385
451 rootH2_10169024
452 Ga0070683_100000260
453 Ga0070670_100050274
454 Ga0068869_100283987
455 Ga0068869_100575638
456 Ga0070666_10145582
457 Ga0070680_100033739
458 Ga0070661_100011880
459 Ga0070661_100014700
460 Ga0070692_10317268
461 Ga0070668_100023048
462 Ga0070675_100006415
463 Ga0070675_100122079
464 Ga0070671_100060894
465 Ga0070674_100170319
466 Ga0070673_100073357
467 Ga0070673_100166096
468 Ga0070667_100008007
469 Ga0070709_10004602
470 Ga0070709_10083759
471 Ga0070714_100067106
472 Ga0070714_100321281
473 Ga0070713_100000860
474 Ga0070713_100032939
475 Ga0070713_100202245
476 Ga0070710_10054794
477 Ga0070710_10084480
478 Ga0070711_100000111
479 Ga0070711_100746731
480 Ga0070700_100015088
481 Ga0070694_100259704
482 Ga0070708_100011368
483 Ga0070708_100016704
484 Ga0070678_100030722
485 Ga0070662_100014378
486 Ga0070662_100197112
487 Ga0070681_10140110
488 Ga0070681_10479490
489 Ga0068867_100230942
490 Ga0068867_100423248
491 Ga0070685_10228891
492 Ga0070706_100014288
493 Ga0070706_100138362
494 Ga0070706_100452620
495 Ga0070707_100053635
496 Ga0070707_100097132
497 Ga0070707_100100382
498 Ga0070707_100252349
499 Ga0070698_100018496
500 Ga0070699_100005139
501 Ga0070699_100564470
502 Ga0070679_100027225
503 Ga0070684_100008590
504 Ga0070684_100510678
505 Ga0070697_100013677
506 Ga0070697_100147125
507 Ga0068853_100005324
508 Ga0068853_100457745
509 Ga0070672_100023195
510 Ga0070672_100276884
511 Ga0070686_100151772
512 Ga0070695_100245294
513 Ga0070695_100350395
514 Ga0070696_100101632
515 Ga0070693_100255867
516 Ga0070704_100004266
517 Ga0070704_100038114
518 Ga0070704_100088382
519 Ga0070664_100001086
520 Ga0070664_100124103
521 Ga0068857_100130599
522 Ga0068854_100019456
523 Ga0068854_100164585
524 Ga0068856_100003929
525 Ga0068856_100018329
526 Ga0068856_100252555
527 Ga0068852_100010646
528 Ga0068852_101031456
529 Ga0068859_100048417
530 Ga0068864_100366700
531 Ga0068861_100328166
532 Ga0068851_10408751
533 Ga0068863_100002136
534 Ga0068863_100007159
535 Ga0068863_100077141
536 Ga0068858_100063521
537 Ga0068860_100064181
538 Ga0068862_100037163
539 Ga0068862_100280991
540 Ga0068862_100330333
541 Ga0081540_1000915
542 Ga0070717_10014792
543 Ga0070717_10075511
544 Ga0070717_10105414
545 Ga0070717_10211835
546 Ga0070717_10692981
547 Ga0070716_100015175
548 Ga0070716_100060101
549 Ga0070716_100089027
550 Ga0070716_100196582
551 Ga0070716_100383633
552 Ga0070712_100001487
553 Ga0070712_100007166
554 Ga0070712_100051579
555 Ga0070712_100218415
556 Ga0097621_100012324
557 Ga0097621_100086651
558 Ga0097621_100632224
559 Ga0068871_100100203
560 Ga0075434_100049271
561 Ga0075434_100066717
562 Ga0075434_100447573
563 Ga0068865_100016133
564 Ga0068865_100018019
565 Ga0075436_100006310
566 Ga0075436_100025872
567 Ga0097620_100048415
568 Ga0075435_100270348
569 Ga0075435_100294597
570 Ga0099794_10068718
571 Ga0105240_10083876
572 Ga0105240_10192667
573 Ga0105240_10642290
574 Ga0111539_10006002
575 Ga0111539_10236378
576 Ga0105245_10000140
577 Ga0105245_10011212
578 Ga0105245_10070307
579 Ga0105245_10527975
580 Ga0105247_10020635
581 Ga0105247_10351223
582 Ga0114129_10006247
583 Ga0114129_10026708
584 Ga0114129_10649505
585 Ga0105241_10007441
586 Ga0105241_10019639
587 Ga0105241_10073321
588 Ga0105242_10198222
589 Ga0105242_10422199
590 Ga0105248_10011994
591 Ga0105248_10050196
592 Ga0105248_10145812
593 Ga0105237_10051564
594 Ga0105237_10230869
595 Ga0105237_10513196
596 Ga0105237_10675011
597 Ga0105238_10454250
598 Ga0105249_10028133
599 Ga0105249_10712107
600 Ga0105239_10025837
601 Ga0105239_10034500
602 Ga0105239_10118067
603 Ga0105239_10985602
604 Ga0105246_10103278
605 Ga0105246_10836415
606 Ga0157373_10065983
607 Ga0157373_10079437
608 Ga0157371_10612425
609 Ga0157369_10024702
610 Ga0157374_10017854
611 Ga0157374_10176521
612 Ga0157374_10297759
613 Ga0157374_10355558
614 Ga0157374_10357346
615 Ga0157378_10019162
616 Ga0157378_10031740
617 Ga0157378_10216481
618 Ga0157378_10277202
619 Ga0157378_10400758
620 Ga0163162_10000671
621 Ga0163162_10044612
622 Ga0163162_10302033
623 Ga0157372_10021754
624 Ga0157372_10230165
625 Ga0157375_11022272
626 Ga0163163_10002751
627 Ga0163163_10083541
628 Ga0163163_10465056
629 Ga0157379_10002994
630 Ga0157379_10012385
631 Ga0157379_10020784
632 Ga0157379_10374760
633 Ga0157376_10009086
634 Ga0157376_10046626
635 Ga0157376_10055327
636 Ga0157376_10181044
637 Ga0157376_10336763
638 Ga0157376_10527614
639 Ga0157376_10638967
640 Ga0163161_10017254
641 Ga0213872_10010252
642 Ga0213876_10206612
643 Ga0213875_10015738
644 Ga0207697_10013096
645 Ga0207692_10053959
646 Ga0207692_10104613
647 Ga0207680_10026502
648 Ga0207647_10014346
649 Ga0207685_10022608
650 Ga0207699_10002392
651 Ga0207699_10069885
652 Ga0207699_10111281
653 Ga0207699_10159463
654 Ga0207645_10033197
655 Ga0207645_10180367
656 Ga0207684_10000445
657 Ga0207684_10138205
658 Ga0207684_10655509
659 Ga0207654_10006135
660 Ga0207654_10021141
661 Ga0207654_10022354
662 Ga0207707_10065318
663 Ga0207707_10265086
664 Ga0207695_10082883
665 Ga0207695_10229154
666 Ga0207671_10206466
667 Ga0207693_10000368
668 Ga0207693_10002915
669 Ga0207693_10039171
670 Ga0207693_10051530
671 Ga0207693_10146957
672 Ga0207693_10148877
673 Ga0207663_10001077
674 Ga0207663_10046944
675 Ga0207663_10095316
676 Ga0207660_10258184
677 Ga0207657_10009169
678 Ga0207649_10015922
679 Ga0207646_10002173
680 Ga0207646_10082738
681 Ga0207646_10164932
682 Ga0207681_10764756
683 Ga0207659_10032083
684 Ga0207659_10079817
685 Ga0207687_10000108
686 Ga0207687_10001365
687 Ga0207687_10058865
688 Ga0207700_10005939
689 Ga0207700_10053967
690 Ga0207700_10070086
691 Ga0207700_10115784
692 Ga0207700_10190916
693 Ga0207664_10296533
694 Ga0207664_10362755
695 Ga0207664_10782571
696 Ga0207644_10115826
697 Ga0207706_10000251
698 Ga0207706_10015048
699 Ga0207706_10255297
700 Ga0207686_10052911
701 Ga0207709_10221008
702 Ga0207669_10512028
703 Ga0207704_10012820
704 Ga0207704_10208608
705 Ga0207665_10133371
706 Ga0207665_10270585
707 Ga0207691_10246166
708 Ga0207711_10007197
709 Ga0207711_10014859
710 Ga0207711_10017882
711 Ga0207711_10246772
712 Ga0207689_10217526
713 Ga0207661_10007845
714 Ga0207679_10010791
715 Ga0207679_10181978
716 Ga0207667_10018988
717 Ga0207651_10015273
718 Ga0207651_10028949
719 Ga0207712_10016985
720 Ga0207712_10191378
721 Ga0207712_10717783
722 Ga0207668_10008279
723 Ga0207640_10026325
724 Ga0207640_10129528
725 Ga0207658_10727996
726 Ga0207677_10019898
727 Ga0207677_10021384
728 Ga0207703_10010155
729 Ga0207639_10000904
730 Ga0207639_10800633
731 Ga0207678_10007941
732 Ga0207678_10010076
733 Ga0207708_10055176
734 Ga0207702_10003302
735 Ga0207702_10554805
736 Ga0207641_10004266
737 Ga0207641_10124082
738 Ga0207641_10409298
739 Ga0207648_10087487
740 Ga0207676_10265230
741 Ga0207674_10031510
742 Ga0207675_100106497
743 Ga0207683_10004711
744 Ga0207698_10030999
745 Ga0207698_10370655
746 Ga0268265_10256861
747 Ga0268265_10551263
748 Ga0265760_10000496
749 Ga0265760_10026278
750 Ga0307510_10235867
751 Ga0373934_0007870
752 Ga0373944_0036669
753 Ga0373923_0020747
754 Ga0373936_0010185
755 Ga0373936_0073056
756 Ga0373936_0087100
757 Ga0373939_0196241
758 Ga0373945_0001020
759 Ga0373954_0008776
760 Ga0373957_0081428
761 Ga0373960_0012203
762 Ga0373943_0000265
763 Ga0373943_0333110
764 Ga0373946_0005364
765 Ga0373955_0022955
766 Ga0373955_0142375
767 Ga0373962_0006735
768 Ga0373924_0003179
769 Ga0373931_0131233
770 Ga0373931_0428638
771 Ga0373935_0052276
772 Ga0373935_0758363
773 Ga0373927_0000270
774 Ga0373927_0175314
775 Ga0373927_0295622
776 Ga0373933_0003793
777 Ga0373947_0000844
778 Ga0373937_0012903
779 Ga0373937_0475887
780 Ga0373925_0007916
781 Ga0373925_0019607
782 Ga0373925_0035658
783 Ga0373925_0736356
784 Ga0436364_0915998
785 Ga0436365_0173497
786 Ga0436365_0601289
787 Ga0436360_0324302
788 Ga0439448_0057779
789 Ga0466963_0025963
790 Ga0466964_0291407
791 Ga0466959_0129697
792 Ga0466967_0751396
793 Ga0495603_0042465
794 Ga0495629_0023148
795 Ga0495653_0138262
796 Ga0495580_0029783
797 Ga0495580_0033442
798 Ga0495580_0074674
799 Ga0495582_0198527
800 Ga0495664_0010815
801 Ga0495585_0438512
802 Ga0495594_0163040
803 Ga0495630_0024504
804 Ga0495630_0032716
805 Ga0495630_0326443
806 Ga0495666_0065710
807 Ga0495640_0061160
808 Ga0495640_0257180
809 Ga0495586_0063605
810 Ga0495587_0453932
811 Ga0495645_0045126
812 Ga0495645_0088989
813 Ga0495657_0200995
814 Ga0495657_0312485
815 Ga0495623_0398330
816 Ga0495658_0023375
817 Ga0495669_0089313
818 Ga0495669_0106364
819 Ga0495613_0051653
820 Ga0495624_0034638
821 Ga0495624_0109841
822 Ga0495581_0149365
823 Ga0495674_0013990
824 Ga0495674_0086201
825 Ga0495676_0040901
826 Ga0495676_0405733
827 Ga0495680_0047203
828 Ga0495593_0069278
829 Ga0495602_0173719
830 Ga0495602_0402099
831 Ga0496100_0042858
832 Ga0496100_0238627
833 Ga0496101_0030466
834 Ga0496101_0052947
835 Ga0496102_0023530
836 Ga0496102_0029987
837 Ga0496102_0089220
838 Ga0496102_0129292
839 Ga0496102_0192923
840 Ga0496103_0003591
841 Ga0496104_0105059
842 Ga0496104_1335096
843 Ga0496105_0027229
844 Ga0496105_0066860
845 Ga0496105_0115963
846 Ga0496105_0452619
847 Ga0496105_0678936
848 Ga0496106_0026710
849 Ga0496106_0350759
850 Ga0496107_0011847
851 Ga0496107_0055117
852 Ga0496107_0075608
853 Ga0496107_0937924
854 Ga0496108_0082040
855 Ga0496108_0445820
856 Ga0496108_0637240
857 Ga0496109_0000593
858 Ga0496109_0164402
859 Ga0496110_0016089
860 Ga0496110_0190236
861 Ga0496110_1019582
862 Ga0496111_0031421
863 Ga0496112_0034035
864 Ga0496112_0245920
865 Ga0496112_0406747
866 Ga0496112_0748743
867 Ga0496113_0316771
868 Ga0496114_0021185
869 Ga0496114_0088285
870 Ga0496114_0861145
871 Ga0496114_0919205
872 Ga0496115_0075020
873 Ga0496115_0125433
874 Ga0496115_0228473
875 Ga0496115_0283365
876 Ga0496126_0062543
877 Ga0501040_0114592
878 Ga0501042_0252464
879 Ga0501075_0260706
880 Ga0501076_0180474
881 Ga0501076_0793360
882 Ga0501079_0302703
883 Ga0501081_0159717
884 nmdc:mga05p37_441112_c1
885 nmdc:mga08y16_5159_c1
886 nmdc:mga0n895_191332_c1
887 nmdc:mga0n895_199796_c1
888 nmdc:mga0n895_42237_c1
889 nmdc:mga0rr50_29042_c1
890 nmdc:mga0rr50_386175_c1
891 nmdc:mga08x19_965_c1
892 nmdc:mga0a205_437305_c1
893 Ga0495601_0529431
894 Ga0495612_0089190
895 Ga0495619_0144522
896 Ga0501084_0039501
897 Ga0590071_019332
898 Ga0501082_0220511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wik-assembly1.cif.gz_A cryo-em structure of slc40/ferroportin with fab in the presence of hepcidin 0.4732 8 216
6gv1-assembly1.cif.gz_A crystal structure of e.coli multidrug/h+ antiporter mdfa in outward open conformation with bound fab fragment 0.4431 8 215
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.434 9 216
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.4306 14 216
4ja4-assembly1.cif.gz_A inward open conformation of the xylose transporter xyle from e. coli 0.4257 3 215
ID Description Score Start End Superfamily
4ja3A03 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4798 11 215 1.20.1250.20
af_P75870_401_526_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4747 29 182 1.10.1760.20
4ja3A03 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4629 11 215 1.20.1250.20
af_Q09812_93_510_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4614 3 215 1.20.1250.20
af_O96156_55_269_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4594 9 215 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A554S1U0-F1-model_v4 Uncharacterized protein 0.7959 6 195 GO:0016020
AF-A0A368SXS1-F1-model_v4 Cell wall anchor protein 0.7906 6 216 GO:0016020
AF-A0A2V9T394-F1-model_v4 Uncharacterized protein 0.7836 10 217 GO:0016020
AF-A0A223QB89-F1-model_v4 deleted 0.7801 6 216
AF-A0A0M8XWF7-F1-model_v4 Cell wall anchor protein 0.7788 6 216 GO:0016020

Map