F445234

General Info

Members Datasets Scaffolds Average Seq Length
444 171 888 129

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10677784|Ga0070709_106777841
Length 130
Sequence LARKKSPNLTEAELKLMDVVWEKGSATVATVAAALRGKPELAYNTVLTTLRILEHKGYLRHTKSREGEGRAFVYHPVIGREQASRKAVRHLVSRFFSNSPELLVLNLLEDEEISEEEMKRIRTVLAEGGK

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.9
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 43.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10677784 3300005434 Unclassified 800
2 Ga0070658_10539109 3300005327 Unclassified 1009
3 Ga0070658_11672598 3300005327 Unclassified 551
4 Ga0070658_11970151 3300005327 Unclassified 504
5 Ga0070683_100000761 3300005329 Bacteria 23630
6 Ga0070683_100001940 3300005329 Bacteria 16203
7 Ga0070683_100009683 3300005329 Bacteria 8248
8 Ga0070683_100011047 3300005329 Bacteria 7783
9 Ga0070683_100088969 3300005329 Bacteria 2897
10 Ga0070683_100142509 3300005329 Bacteria 2271
11 Ga0070683_100435718 3300005329 Bacteria 1251
12 Ga0070683_100794667 3300005329 Unclassified 907
13 Ga0070683_101431585 3300005329 Bacteria 664
14 Ga0070670_101876127 3300005331 Unclassified 552
15 Ga0068869_101208543 3300005334 Unclassified 664
16 Ga0070680_100455897 3300005336 Unclassified 1092
17 Ga0070680_100518780 3300005336 Unclassified 1020
18 Ga0070660_101696430 3300005339 Unclassified 538
19 Ga0070661_100001692 3300005344 Bacteria 15284
20 Ga0070661_100487039 3300005344 Unclassified 986
21 Ga0070692_10293339 3300005345 Unclassified 990
22 Ga0070671_100557120 3300005355 Unclassified 989
23 Ga0070673_101004819 3300005364 Unclassified 777
24 Ga0070709_10331262 3300005434 Bacteria 1120
25 Ga0070714_100561991 3300005435 Unclassified 1093
26 Ga0070714_101497232 3300005435 Unclassified 659
27 Ga0070713_100099126 3300005436 Bacteria 2520
28 Ga0070713_100198910 3300005436 Bacteria 1809
29 Ga0070711_100213831 3300005439 Bacteria 1495
30 Ga0070708_101636435 3300005445 Unclassified 599
31 Ga0070681_10379341 3300005458 Unclassified 1324
32 Ga0068867_100172939 3300005459 Unclassified 1712
33 Ga0068867_100785987 3300005459 Unclassified 847
34 Ga0070685_10805596 3300005466 Unclassified 693
35 Ga0070679_100000767 3300005530 Bacteria 27851
36 Ga0070679_100164166 3300005530 Unclassified 2195
37 Ga0070679_100528654 3300005530 Bacteria 1123
38 Ga0070679_100873789 3300005530 Bacteria 842
39 Ga0070679_101976113 3300005530 Unclassified 532
40 Ga0070684_100011613 3300005535 Bacteria 7020
41 Ga0070684_100052372 3300005535 Unclassified 3550
42 Ga0070684_100053545 3300005535 Bacteria 3514
43 Ga0070684_100055440 3300005535 Unclassified 3456
44 Ga0070684_100089367 3300005535 Bacteria 2738
45 Ga0070684_100314973 3300005535 Bacteria 1437
46 Ga0070684_100668738 3300005535 Unclassified 967
47 Ga0070684_100819946 3300005535 Unclassified 870
48 Ga0070697_100880501 3300005536 Unclassified 794
49 Ga0068853_100008692 3300005539 Bacteria 8168
50 Ga0068853_100294156 3300005539 Bacteria 1499
51 Ga0070686_100035253 3300005544 Unclassified 3089
52 Ga0070686_101600238 3300005544 Unclassified 551
53 Ga0070695_100120711 3300005545 Bacteria 1792
54 Ga0070693_100052189 3300005547 Unclassified 2344
55 Ga0070693_100393125 3300005547 Unclassified 959
56 Ga0070693_100519268 3300005547 Unclassified 848
57 Ga0070665_100285041 3300005548 Unclassified 1654
58 Ga0068855_100000800 3300005563 Bacteria 38947
59 Ga0068855_100004374 3300005563 Bacteria 17265
60 Ga0068855_100150209 3300005563 Bacteria 2649
61 Ga0068855_100161063 3300005563 Bacteria 2547
62 Ga0070664_102249381 3300005564 Unclassified 517
63 Ga0068857_100012320 3300005577 Bacteria 7441
64 Ga0068857_100178501 3300005577 Bacteria 1932
65 Ga0068857_100183001 3300005577 Bacteria 1907
66 Ga0068857_100193586 3300005577 Bacteria 1852
67 Ga0068854_100010723 3300005578 Bacteria 5948
68 Ga0068856_100010078 3300005614 Bacteria 9184
69 Ga0068856_100702701 3300005614 Bacteria 1031
70 Ga0068856_102085292 3300005614 Bacteria 577
71 Ga0068852_100003344 3300005616 Bacteria 11194
72 Ga0068852_100194803 3300005616 Unclassified 1914
73 Ga0068852_100240702 3300005616 Unclassified 1729
74 Ga0068852_102774522 3300005616 Unclassified 508
75 Ga0068859_100194812 3300005617 Bacteria 2111
76 Ga0068859_101528182 3300005617 Unclassified 737
77 Ga0068859_102694287 3300005617 Bacteria 546
78 Ga0068864_100406173 3300005618 Bacteria 1295
79 Ga0068861_100511085 3300005719 Unclassified 1088
80 Ga0068851_10458129 3300005834 Unclassified 759
81 Ga0068863_100206928 3300005841 Bacteria 1889
82 Ga0068858_100073595 3300005842 Bacteria 3171
83 Ga0068858_101945494 3300005842 Bacteria 581
84 Ga0070717_10077769 3300006028 Bacteria 2779
85 Ga0070717_10252241 3300006028 Bacteria 1559
86 Ga0070717_10903967 3300006028 Unclassified 804
87 Ga0070717_11065496 3300006028 Unclassified 736
88 Ga0070717_11850096 3300006028 Bacteria 545
89 Ga0097621_100019041 3300006237 Bacteria 5261
90 Ga0097621_100031925 3300006237 Unclassified 4182
91 Ga0097621_100289490 3300006237 Bacteria 1444
92 Ga0097621_100732523 3300006237 Bacteria 912
93 Ga0097621_101672148 3300006237 Bacteria 606
94 Ga0068871_100034437 3300006358 Unclassified 4018
95 Ga0068871_100238128 3300006358 Bacteria 1581
96 Ga0068871_100358745 3300006358 Bacteria 1291
97 Ga0068871_100601407 3300006358 Bacteria 1000
98 Ga0068865_100190810 3300006881 Bacteria 1584
99 Ga0097620_100194804 3300006931 Bacteria 2111
100 Ga0097620_101528020 3300006931 Unclassified 737
101 Ga0097620_102693390 3300006931 Bacteria 546
102 Ga0105240_10005874 3300009093 Bacteria 18183
103 Ga0105240_10006779 3300009093 Bacteria 16751
104 Ga0105240_10012536 3300009093 Bacteria 11694
105 Ga0105240_10023716 3300009093 Bacteria 8104
106 Ga0105240_10122705 3300009093 Bacteria 3126
107 Ga0105240_10163033 3300009093 Bacteria 2646
108 Ga0105240_10336646 3300009093 Bacteria 1715
109 Ga0105240_10380608 3300009093 Unclassified 1594
110 Ga0105240_10392377 3300009093 Bacteria 1565
111 Ga0105240_10829080 3300009093 Unclassified 1000
112 Ga0105245_10002575 3300009098 Bacteria 16326
113 Ga0105245_10003483 3300009098 Bacteria 14084
114 Ga0105245_10045844 3300009098 Bacteria 3906
115 Ga0105245_10073092 3300009098 Unclassified 3117
116 Ga0105245_11212572 3300009098 Bacteria 803
117 Ga0105245_11296448 3300009098 Unclassified 777
118 Ga0105247_10125501 3300009101 Bacteria 1668
119 Ga0105243_10749207 3300009148 Unclassified 957
120 Ga0105243_12425192 3300009148 Unclassified 563
121 Ga0105241_10014587 3300009174 Bacteria 5754
122 Ga0105241_10019387 3300009174 Bacteria 5015
123 Ga0105241_10024154 3300009174 Bacteria 4514
124 Ga0105241_10075394 3300009174 Bacteria 2628
125 Ga0105241_10163409 3300009174 Unclassified 1832
126 Ga0105241_10684837 3300009174 Bacteria 934
127 Ga0105242_10296049 3300009176 Unclassified 1475
128 Ga0105242_10685433 3300009176 Unclassified 1001
129 Ga0105242_10685698 3300009176 Unclassified 1000
130 Ga0105242_10693503 3300009176 Bacteria 995
131 Ga0105242_10862926 3300009176 Bacteria 902
132 Ga0105242_11590122 3300009176 Unclassified 687
133 Ga0105242_12409273 3300009176 Bacteria 574
134 Ga0105248_10006675 3300009177 Bacteria 12666
135 Ga0105248_10234020 3300009177 Unclassified 2068
136 Ga0105248_10311289 3300009177 Unclassified 1773
137 Ga0105248_10624063 3300009177 Bacteria 1216
138 Ga0105248_10988726 3300009177 Unclassified 950
139 Ga0105248_11317340 3300009177 Bacteria 817
140 Ga0105237_10011489 3300009545 Bacteria 9368
141 Ga0105237_10012851 3300009545 Bacteria 8801
142 Ga0105237_10092996 3300009545 Bacteria 3005
143 Ga0105237_10508635 3300009545 Bacteria 1211
144 Ga0105237_10518533 3300009545 Bacteria 1198
145 Ga0105237_10519767 3300009545 Unclassified 1197
146 Ga0105237_10559898 3300009545 Unclassified 1150
147 Ga0105237_11426094 3300009545 Unclassified 699
148 Ga0105237_11675070 3300009545 Unclassified 643
149 Ga0105238_10001258 3300009551 Bacteria 25478
150 Ga0105238_10002612 3300009551 Bacteria 17963
151 Ga0105238_10014278 3300009551 Bacteria 8028
152 Ga0105238_10038476 3300009551 Bacteria 4858
153 Ga0105238_10039769 3300009551 Bacteria 4768
154 Ga0105238_10423276 3300009551 Unclassified 1326
155 Ga0105238_10428863 3300009551 Bacteria 1318
156 Ga0105238_10440186 3300009551 Bacteria 1300
157 Ga0105249_10022279 3300009553 Bacteria 5675
158 Ga0105249_10834262 3300009553 Unclassified 987
159 Ga0105239_10001337 3300010375 Bacteria 33219
160 Ga0105239_10036324 3300010375 Bacteria 5410
161 Ga0105239_10054412 3300010375 Unclassified 4390
162 Ga0105239_10317191 3300010375 Bacteria 1757
163 Ga0105239_10421383 3300010375 Unclassified 1512
164 Ga0105239_10430201 3300010375 Unclassified 1496
165 Ga0105239_10614345 3300010375 Unclassified 1240
166 Ga0105239_10995917 3300010375 Bacteria 963
167 Ga0105246_10005959 3300011119 Bacteria 7442
168 Ga0105246_10598135 3300011119 Unclassified 952
169 Ga0105246_10764184 3300011119 Bacteria 854
170 Ga0157373_10169374 3300013100 Unclassified 1537
171 Ga0157373_10268925 3300013100 Unclassified 1207
172 Ga0157371_10030030 3300013102 Unclassified 3923
173 Ga0157370_10101197 3300013104 Bacteria 2699
174 Ga0157370_10528205 3300013104 Unclassified 1083
175 Ga0157370_10914884 3300013104 Unclassified 796
176 Ga0157369_10002395 3300013105 Bacteria 22527
177 Ga0157369_10006571 3300013105 Bacteria 13455
178 Ga0157369_10014159 3300013105 Bacteria 9011
179 Ga0157369_10207802 3300013105 Bacteria 2053
180 Ga0157369_10357096 3300013105 Unclassified 1517
181 Ga0157369_10390227 3300013105 Unclassified 1444
182 Ga0157369_10581780 3300013105 Unclassified 1156
183 Ga0157369_10729849 3300013105 Unclassified 1020
184 Ga0157369_11539983 3300013105 Unclassified 676
185 Ga0157374_10067542 3300013296 Unclassified 3361
186 Ga0157374_10208014 3300013296 Bacteria 1918
187 Ga0157374_10324756 3300013296 Bacteria 1526
188 Ga0157374_10644501 3300013296 Bacteria 1071
189 Ga0157374_10734879 3300013296 Unclassified 1001
190 Ga0157374_10840876 3300013296 Unclassified 934
191 Ga0157378_10028616 3300013297 Bacteria 4918
192 Ga0157378_10108386 3300013297 Bacteria 2543
193 Ga0157378_12157234 3300013297 Bacteria 608
194 Ga0163162_10831955 3300013306 Unclassified 1039
195 Ga0163162_11441161 3300013306 Unclassified 784
196 Ga0157372_10002403 3300013307 Bacteria 20285
197 Ga0157372_10017836 3300013307 Bacteria 7623
198 Ga0157372_10026797 3300013307 Bacteria 6275
199 Ga0157372_10130356 3300013307 Bacteria 2893
200 Ga0157372_10172073 3300013307 Bacteria 2506
201 Ga0157372_10204293 3300013307 Bacteria 2289
202 Ga0157372_13110070 3300013307 Unclassified 530
203 Ga0157372_13213006 3300013307 Unclassified 521
204 Ga0157375_10006669 3300013308 Bacteria 10051
205 Ga0163163_10016316 3300014325 Bacteria 6895
206 Ga0163163_10039648 3300014325 Bacteria 4598
207 Ga0163163_10054130 3300014325 Bacteria 3963
208 Ga0163163_10071473 3300014325 Bacteria 3458
209 Ga0163163_10297176 3300014325 Bacteria 1667
210 Ga0157377_10438393 3300014745 Unclassified 899
211 Ga0157379_11042940 3300014968 Bacteria 781
212 Ga0157379_12267329 3300014968 Bacteria 540
213 Ga0157376_10098953 3300014969 Bacteria 2543
214 Ga0157376_10352610 3300014969 Bacteria 1409
215 Ga0157376_11420888 3300014969 Unclassified 726
216 Ga0213874_10238442 3300021377 Unclassified 666
217 Ga0207692_10876782 3300025898 Unclassified 590
218 Ga0207699_10274615 3300025906 Unclassified 1169
219 Ga0207699_10400674 3300025906 Unclassified 977
220 Ga0207699_10783678 3300025906 Unclassified 700
221 Ga0207699_11262745 3300025906 Unclassified 547
222 Ga0207705_10433117 3300025909 Unclassified 1019
223 Ga0207654_10008855 3300025911 Bacteria 5105
224 Ga0207654_10054823 3300025911 Unclassified 2305
225 Ga0207654_10091578 3300025911 Bacteria 1855
226 Ga0207654_10149131 3300025911 Unclassified 1499
227 Ga0207654_10151350 3300025911 Unclassified 1489
228 Ga0207654_10564766 3300025911 Unclassified 809
229 Ga0207707_10000358 3300025912 Bacteria 47947
230 Ga0207695_10000391 3300025913 Bacteria 98481
231 Ga0207695_10001641 3300025913 Bacteria 36134
232 Ga0207695_10002536 3300025913 Bacteria 26833
233 Ga0207695_10012400 3300025913 Bacteria 10236
234 Ga0207695_10063270 3300025913 Bacteria 3815
235 Ga0207695_10289229 3300025913 Bacteria 1531
236 Ga0207695_10582398 3300025913 Unclassified 1000
237 Ga0207671_10007423 3300025914 Bacteria 9514
238 Ga0207671_10016667 3300025914 Bacteria 5704
239 Ga0207671_10101307 3300025914 Bacteria 2182
240 Ga0207671_10335533 3300025914 Unclassified 1197
241 Ga0207663_10150773 3300025916 Bacteria 1631
242 Ga0207663_11061545 3300025916 Unclassified 651
243 Ga0207663_11365978 3300025916 Bacteria 571
244 Ga0207660_10463537 3300025917 Unclassified 1025
245 Ga0207649_10010518 3300025920 Bacteria 5086
246 Ga0207649_11484351 3300025920 Unclassified 537
247 Ga0207652_10006494 3300025921 Bacteria 9425
248 Ga0207694_10002026 3300025924 Bacteria 16771
249 Ga0207694_10004929 3300025924 Bacteria 10348
250 Ga0207694_10006394 3300025924 Bacteria 8976
251 Ga0207694_10059411 3300025924 Bacteria 2973
252 Ga0207694_10521965 3300025924 Unclassified 995
253 Ga0207687_10002516 3300025927 Bacteria 12429
254 Ga0207687_10005222 3300025927 Bacteria 8608
255 Ga0207687_10020350 3300025927 Unclassified 4401
256 Ga0207687_10787659 3300025927 Unclassified 810
257 Ga0207687_11760389 3300025927 Bacteria 531
258 Ga0207700_10001996 3300025928 Bacteria 11638
259 Ga0207700_10120196 3300025928 Bacteria 2129
260 Ga0207700_10919291 3300025928 Bacteria 783
261 Ga0207664_10793939 3300025929 Unclassified 852
262 Ga0207664_11013647 3300025929 Unclassified 744
263 Ga0207664_11343964 3300025929 Unclassified 635
264 Ga0207644_10387373 3300025931 Unclassified 1141
265 Ga0207690_10370219 3300025932 Unclassified 1136
266 Ga0207706_10070769 3300025933 Unclassified 3068
267 Ga0207686_10391372 3300025934 Unclassified 1056
268 Ga0207686_11506298 3300025934 Bacteria 555
269 Ga0207709_10126906 3300025935 Unclassified 1732
270 Ga0207670_10150575 3300025936 Bacteria 1726
271 Ga0207670_10182178 3300025936 Unclassified 1583
272 Ga0207704_10026244 3300025938 Bacteria 3193
273 Ga0207704_10197770 3300025938 Bacteria 1468
274 Ga0207711_10014389 3300025941 Bacteria 6570
275 Ga0207711_10024201 3300025941 Bacteria 5083
276 Ga0207711_10546370 3300025941 Bacteria 1080
277 Ga0207711_10689698 3300025941 Unclassified 953
278 Ga0207711_11519145 3300025941 Bacteria 613
279 Ga0207689_10254628 3300025942 Bacteria 1452
280 Ga0207689_10317367 3300025942 Unclassified 1293
281 Ga0207661_10165092 3300025944 Bacteria 1923
282 Ga0207661_10232549 3300025944 Bacteria 1633
283 Ga0207661_10391902 3300025944 Bacteria 1258
284 Ga0207661_10485278 3300025944 Unclassified 1128
285 Ga0207661_11275882 3300025944 Unclassified 675
286 Ga0207679_10217249 3300025945 Unclassified 1607
287 Ga0207679_10578204 3300025945 Bacteria 1010
288 Ga0207679_11649870 3300025945 Unclassified 587
289 Ga0207667_10003586 3300025949 Bacteria 19181
290 Ga0207667_10022222 3300025949 Bacteria 7012
291 Ga0207667_10070244 3300025949 Bacteria 3645
292 Ga0207667_10133346 3300025949 Unclassified 2559
293 Ga0207667_10306186 3300025949 Bacteria 1623
294 Ga0207651_10934354 3300025960 Unclassified 773
295 Ga0207651_11330211 3300025960 Unclassified 646
296 Ga0207712_10008449 3300025961 Bacteria 6508
297 Ga0207640_10131277 3300025981 Bacteria 1811
298 Ga0207640_10832598 3300025981 Unclassified 802
299 Ga0207658_11152252 3300025986 Unclassified 709
300 Ga0207677_10439030 3300026023 Unclassified 1116
301 Ga0207677_10510658 3300026023 Unclassified 1041
302 Ga0207639_10009595 3300026041 Bacteria 6684
303 Ga0207639_10136148 3300026041 Bacteria 2040
304 Ga0207639_10621738 3300026041 Unclassified 997
305 Ga0207702_10007348 3300026078 Bacteria 9411
306 Ga0207702_10020491 3300026078 Bacteria 5474
307 Ga0207702_10160844 3300026078 Bacteria 2050
308 Ga0207702_10381446 3300026078 Unclassified 1356
309 Ga0207702_10894598 3300026078 Unclassified 880
310 Ga0207702_10936887 3300026078 Unclassified 859
311 Ga0207702_11399291 3300026078 Unclassified 693
312 Ga0207641_10306768 3300026088 Bacteria 1501
313 Ga0207648_10106979 3300026089 Unclassified 2455
314 Ga0207648_11266408 3300026089 Unclassified 693
315 Ga0207676_10347315 3300026095 Bacteria 1371
316 Ga0207674_10000241 3300026116 Bacteria 68328
317 Ga0207674_10004046 3300026116 Bacteria 17795
318 Ga0207674_10324684 3300026116 Bacteria 1489
319 Ga0207674_10374367 3300026116 Bacteria 1376
320 Ga0207683_10677485 3300026121 Unclassified 956
321 Ga0207698_10002591 3300026142 Bacteria 10754
322 Ga0207698_10394957 3300026142 Unclassified 1320
323 Ga0268266_10436811 3300028379 Bacteria 1243
324 Ga0268264_10266898 3300028381 Unclassified 1597
325 Ga0268264_10319098 3300028381 Bacteria 1468
326 Ga0268264_11504739 3300028381 Unclassified 684
327 Ga0265762_1117474 3300030760 Unclassified 605
328 Ga0265760_10039630 3300031090 Bacteria 1402
329 Ga0265330_10311206 3300031235 Unclassified 664
330 Ga0265332_10096973 3300031238 Bacteria 1245
331 Ga0265340_10045823 3300031247 Unclassified 2134
332 Ga0265331_10041952 3300031250 Bacteria 2221
333 Ga0265316_10804844 3300031344 Bacteria 659
334 Ga0265313_10214845 3300031595 Unclassified 795
335 Ga0265314_10000463 3300031711 Bacteria 54000
336 Ga0265314_10051692 3300031711 Bacteria 2861
337 Ga0265342_10134825 3300031712 Bacteria 1381
338 Ga0373934_0005466 3300035086 Bacteria 4703
339 Ga0373934_0215554 3300035086 Unclassified 792
340 Ga0373954_0000757 3300035118 Bacteria 12474
341 Ga0373954_0008404 3300035118 Bacteria 4529
342 Ga0373931_0864585 3300035691 Bacteria 606
343 Ga0373935_0544985 3300035692 Bacteria 845
344 Ga0373935_1211947 3300035692 Unclassified 563
345 Ga0373927_0217937 3300035695 Bacteria 1254
346 Ga0373927_0462790 3300035695 Unclassified 838
347 Ga0373933_0166209 3300035724 Unclassified 1402
348 Ga0373947_0112371 3300035725 Bacteria 1723
349 Ga0373947_0470206 3300035725 Unclassified 853
350 Ga0373947_0790492 3300035725 Unclassified 648
351 Ga0373937_0179377 3300036401 Unclassified 1988
352 Ga0373937_0437190 3300036401 Bacteria 1242
353 Ga0373937_0795307 3300036401 Bacteria 894
354 Ga0373937_0873524 3300036401 Bacteria 848
355 Ga0373937_1025905 3300036401 Unclassified 774
356 Ga0373937_1627680 3300036401 Unclassified 593
357 Ga0373925_0021881 3300037068 Bacteria 4661
358 Ga0373925_0162705 3300037068 Unclassified 1759
359 Ga0373925_0858774 3300037068 Unclassified 748
360 Ga0436365_0702052 3300039437 Bacteria 1780
361 Ga0436363_1419486 3300039450 Bacteria 6790
362 Ga0436362_1113886 3300039453 Unclassified 1180
363 Ga0451839_0154637 3300041496 Unclassified 827
364 Ga0451839_1324718 3300041496 Unclassified 592
365 Ga0466969_0073068 3300044656 Unclassified 1646
366 Ga0451576_0048397 3300045051 Bacteria 4466
367 Ga0495592_0280726 3300046454 Bacteria 1089
368 Ga0495592_0498678 3300046454 Bacteria 756
369 Ga0495592_0562317 3300046454 Unclassified 700
370 Ga0495651_0143421 3300046462 Bacteria 1729
371 Ga0495651_0325229 3300046462 Bacteria 1024
372 Ga0495580_0005200 3300046472 Bacteria 10812
373 Ga0495580_0026664 3300046472 Bacteria 4211
374 Ga0495580_0158510 3300046472 Bacteria 1567
375 Ga0495580_0355505 3300046472 Bacteria 992
376 Ga0495580_0507985 3300046472 Bacteria 804
377 Ga0495580_0692460 3300046472 Bacteria 667
378 Ga0495582_0029614 3300046473 Unclassified 3005
379 Ga0495582_0614786 3300046473 Bacteria 629
380 Ga0495582_0666690 3300046473 Bacteria 602
381 Ga0495639_0409449 3300046475 Bacteria 686
382 Ga0495639_0427747 3300046475 Unclassified 671
383 Ga0495664_0348981 3300046477 Bacteria 891
384 Ga0495594_0010377 3300046499 Bacteria 4832
385 Ga0495594_0518370 3300046499 Bacteria 677
386 Ga0495618_0130311 3300046514 Bacteria 1609
387 Ga0495618_0744336 3300046514 Bacteria 574
388 Ga0495628_0336470 3300046516 Unclassified 1112
389 Ga0495630_0220016 3300046517 Bacteria 1450
390 Ga0495652_0057810 3300046529 Unclassified 3287
391 Ga0495652_0240840 3300046529 Unclassified 1346
392 Ga0495665_0019032 3300046531 Unclassified 3691
393 Ga0495665_0406840 3300046531 Unclassified 690
394 Ga0495586_0016929 3300046535 Bacteria 3877
395 Ga0495586_0396748 3300046535 Bacteria 794
396 Ga0495587_0017125 3300046536 Unclassified 4506
397 Ga0495587_0027976 3300046536 Bacteria 3432
398 Ga0495587_0355390 3300046536 Unclassified 816
399 Ga0495587_0595557 3300046536 Bacteria 609
400 Ga0495587_0597149 3300046536 Unclassified 608
401 Ga0495645_0155432 3300046543 Bacteria 1585
402 Ga0495645_0273426 3300046543 Bacteria 1114
403 Ga0495645_0900351 3300046543 Unclassified 525
404 Ga0495667_0125536 3300046559 Bacteria 1656
405 Ga0495667_0302612 3300046559 Bacteria 1013
406 Ga0495667_0828327 3300046559 Unclassified 570
407 Ga0495634_0218334 3300046642 Bacteria 1178
408 Ga0495599_0016327 3300046678 Unclassified 4610
409 Ga0495599_0218528 3300046678 Unclassified 1167
410 Ga0495599_0470030 3300046678 Unclassified 743
411 Ga0495599_0838159 3300046678 Unclassified 524
412 Ga0495623_0021541 3300046679 Bacteria 4162
413 Ga0495623_0370879 3300046679 Bacteria 776
414 Ga0495646_0094106 3300046680 Bacteria 1726
415 Ga0495646_0545891 3300046680 Bacteria 592
416 Ga0495613_0177001 3300046689 Unclassified 1512
417 Ga0495624_0313820 3300046690 Bacteria 945
418 Ga0495624_0801266 3300046690 Bacteria 557
419 Ga0495600_0171353 3300046809 Bacteria 1401
420 Ga0495600_0336148 3300046809 Unclassified 948
421 Ga0495604_0081609 3300047317 Bacteria 2420
422 Ga0495604_0167507 3300047317 Bacteria 1548
423 Ga0495604_0374908 3300047317 Bacteria 941
424 Ga0495674_0041087 3300047319 Bacteria 4133
425 Ga0495674_0070416 3300047319 Bacteria 3022
426 Ga0495674_0808265 3300047319 Unclassified 729
427 Ga0495674_1210807 3300047319 Unclassified 570
428 Ga0495680_0457238 3300047322 Bacteria 873
429 Ga0495675_0055821 3300047444 Bacteria 2505
430 Ga0495675_0101994 3300047444 Unclassified 1795
431 Ga0495675_0371825 3300047444 Bacteria 837
432 Ga0495684_0065908 3300047471 Unclassified 2753
433 Ga0495684_0096979 3300047471 Bacteria 2231
434 Ga0495684_0463702 3300047471 Bacteria 878
435 Ga0495593_0178650 3300047673 Unclassified 1069
436 Ga0495602_0003454 3300048088 Bacteria 16350
437 Ga0495602_0572794 3300048088 Bacteria 780
438 Ga0495602_1123533 3300048088 Unclassified 514
439 Ga0496102_0776990 3300048905 Unclassified 880
440 Ga0496104_0863910 3300048907 Unclassified 810
441 Ga0496104_1369100 3300048907 Unclassified 611
442 Ga0496114_1269261 3300048917 Bacteria 623
443 Ga0495601_0058365 3300053077 Unclassified 2445
444 Ga0495619_0213377 3300053085 Unclassified 1337
445 Ga0070709_10677784
446 Ga0070658_10539109
447 Ga0070658_11672598
448 Ga0070658_11970151
449 Ga0070683_100000761
450 Ga0070683_100001940
451 Ga0070683_100009683
452 Ga0070683_100011047
453 Ga0070683_100088969
454 Ga0070683_100142509
455 Ga0070683_100435718
456 Ga0070683_100794667
457 Ga0070683_101431585
458 Ga0070670_101876127
459 Ga0068869_101208543
460 Ga0070680_100455897
461 Ga0070680_100518780
462 Ga0070660_101696430
463 Ga0070661_100001692
464 Ga0070661_100487039
465 Ga0070692_10293339
466 Ga0070671_100557120
467 Ga0070673_101004819
468 Ga0070709_10331262
469 Ga0070714_100561991
470 Ga0070714_101497232
471 Ga0070713_100099126
472 Ga0070713_100198910
473 Ga0070711_100213831
474 Ga0070708_101636435
475 Ga0070681_10379341
476 Ga0068867_100172939
477 Ga0068867_100785987
478 Ga0070685_10805596
479 Ga0070679_100000767
480 Ga0070679_100164166
481 Ga0070679_100528654
482 Ga0070679_100873789
483 Ga0070679_101976113
484 Ga0070684_100011613
485 Ga0070684_100052372
486 Ga0070684_100053545
487 Ga0070684_100055440
488 Ga0070684_100089367
489 Ga0070684_100314973
490 Ga0070684_100668738
491 Ga0070684_100819946
492 Ga0070697_100880501
493 Ga0068853_100008692
494 Ga0068853_100294156
495 Ga0070686_100035253
496 Ga0070686_101600238
497 Ga0070695_100120711
498 Ga0070693_100052189
499 Ga0070693_100393125
500 Ga0070693_100519268
501 Ga0070665_100285041
502 Ga0068855_100000800
503 Ga0068855_100004374
504 Ga0068855_100150209
505 Ga0068855_100161063
506 Ga0070664_102249381
507 Ga0068857_100012320
508 Ga0068857_100178501
509 Ga0068857_100183001
510 Ga0068857_100193586
511 Ga0068854_100010723
512 Ga0068856_100010078
513 Ga0068856_100702701
514 Ga0068856_102085292
515 Ga0068852_100003344
516 Ga0068852_100194803
517 Ga0068852_100240702
518 Ga0068852_102774522
519 Ga0068859_100194812
520 Ga0068859_101528182
521 Ga0068859_102694287
522 Ga0068864_100406173
523 Ga0068861_100511085
524 Ga0068851_10458129
525 Ga0068863_100206928
526 Ga0068858_100073595
527 Ga0068858_101945494
528 Ga0070717_10077769
529 Ga0070717_10252241
530 Ga0070717_10903967
531 Ga0070717_11065496
532 Ga0070717_11850096
533 Ga0097621_100019041
534 Ga0097621_100031925
535 Ga0097621_100289490
536 Ga0097621_100732523
537 Ga0097621_101672148
538 Ga0068871_100034437
539 Ga0068871_100238128
540 Ga0068871_100358745
541 Ga0068871_100601407
542 Ga0068865_100190810
543 Ga0097620_100194804
544 Ga0097620_101528020
545 Ga0097620_102693390
546 Ga0105240_10005874
547 Ga0105240_10006779
548 Ga0105240_10012536
549 Ga0105240_10023716
550 Ga0105240_10122705
551 Ga0105240_10163033
552 Ga0105240_10336646
553 Ga0105240_10380608
554 Ga0105240_10392377
555 Ga0105240_10829080
556 Ga0105245_10002575
557 Ga0105245_10003483
558 Ga0105245_10045844
559 Ga0105245_10073092
560 Ga0105245_11212572
561 Ga0105245_11296448
562 Ga0105247_10125501
563 Ga0105243_10749207
564 Ga0105243_12425192
565 Ga0105241_10014587
566 Ga0105241_10019387
567 Ga0105241_10024154
568 Ga0105241_10075394
569 Ga0105241_10163409
570 Ga0105241_10684837
571 Ga0105242_10296049
572 Ga0105242_10685433
573 Ga0105242_10685698
574 Ga0105242_10693503
575 Ga0105242_10862926
576 Ga0105242_11590122
577 Ga0105242_12409273
578 Ga0105248_10006675
579 Ga0105248_10234020
580 Ga0105248_10311289
581 Ga0105248_10624063
582 Ga0105248_10988726
583 Ga0105248_11317340
584 Ga0105237_10011489
585 Ga0105237_10012851
586 Ga0105237_10092996
587 Ga0105237_10508635
588 Ga0105237_10518533
589 Ga0105237_10519767
590 Ga0105237_10559898
591 Ga0105237_11426094
592 Ga0105237_11675070
593 Ga0105238_10001258
594 Ga0105238_10002612
595 Ga0105238_10014278
596 Ga0105238_10038476
597 Ga0105238_10039769
598 Ga0105238_10423276
599 Ga0105238_10428863
600 Ga0105238_10440186
601 Ga0105249_10022279
602 Ga0105249_10834262
603 Ga0105239_10001337
604 Ga0105239_10036324
605 Ga0105239_10054412
606 Ga0105239_10317191
607 Ga0105239_10421383
608 Ga0105239_10430201
609 Ga0105239_10614345
610 Ga0105239_10995917
611 Ga0105246_10005959
612 Ga0105246_10598135
613 Ga0105246_10764184
614 Ga0157373_10169374
615 Ga0157373_10268925
616 Ga0157371_10030030
617 Ga0157370_10101197
618 Ga0157370_10528205
619 Ga0157370_10914884
620 Ga0157369_10002395
621 Ga0157369_10006571
622 Ga0157369_10014159
623 Ga0157369_10207802
624 Ga0157369_10357096
625 Ga0157369_10390227
626 Ga0157369_10581780
627 Ga0157369_10729849
628 Ga0157369_11539983
629 Ga0157374_10067542
630 Ga0157374_10208014
631 Ga0157374_10324756
632 Ga0157374_10644501
633 Ga0157374_10734879
634 Ga0157374_10840876
635 Ga0157378_10028616
636 Ga0157378_10108386
637 Ga0157378_12157234
638 Ga0163162_10831955
639 Ga0163162_11441161
640 Ga0157372_10002403
641 Ga0157372_10017836
642 Ga0157372_10026797
643 Ga0157372_10130356
644 Ga0157372_10172073
645 Ga0157372_10204293
646 Ga0157372_13110070
647 Ga0157372_13213006
648 Ga0157375_10006669
649 Ga0163163_10016316
650 Ga0163163_10039648
651 Ga0163163_10054130
652 Ga0163163_10071473
653 Ga0163163_10297176
654 Ga0157377_10438393
655 Ga0157379_11042940
656 Ga0157379_12267329
657 Ga0157376_10098953
658 Ga0157376_10352610
659 Ga0157376_11420888
660 Ga0213874_10238442
661 Ga0207692_10876782
662 Ga0207699_10274615
663 Ga0207699_10400674
664 Ga0207699_10783678
665 Ga0207699_11262745
666 Ga0207705_10433117
667 Ga0207654_10008855
668 Ga0207654_10054823
669 Ga0207654_10091578
670 Ga0207654_10149131
671 Ga0207654_10151350
672 Ga0207654_10564766
673 Ga0207707_10000358
674 Ga0207695_10000391
675 Ga0207695_10001641
676 Ga0207695_10002536
677 Ga0207695_10012400
678 Ga0207695_10063270
679 Ga0207695_10289229
680 Ga0207695_10582398
681 Ga0207671_10007423
682 Ga0207671_10016667
683 Ga0207671_10101307
684 Ga0207671_10335533
685 Ga0207663_10150773
686 Ga0207663_11061545
687 Ga0207663_11365978
688 Ga0207660_10463537
689 Ga0207649_10010518
690 Ga0207649_11484351
691 Ga0207652_10006494
692 Ga0207694_10002026
693 Ga0207694_10004929
694 Ga0207694_10006394
695 Ga0207694_10059411
696 Ga0207694_10521965
697 Ga0207687_10002516
698 Ga0207687_10005222
699 Ga0207687_10020350
700 Ga0207687_10787659
701 Ga0207687_11760389
702 Ga0207700_10001996
703 Ga0207700_10120196
704 Ga0207700_10919291
705 Ga0207664_10793939
706 Ga0207664_11013647
707 Ga0207664_11343964
708 Ga0207644_10387373
709 Ga0207690_10370219
710 Ga0207706_10070769
711 Ga0207686_10391372
712 Ga0207686_11506298
713 Ga0207709_10126906
714 Ga0207670_10150575
715 Ga0207670_10182178
716 Ga0207704_10026244
717 Ga0207704_10197770
718 Ga0207711_10014389
719 Ga0207711_10024201
720 Ga0207711_10546370
721 Ga0207711_10689698
722 Ga0207711_11519145
723 Ga0207689_10254628
724 Ga0207689_10317367
725 Ga0207661_10165092
726 Ga0207661_10232549
727 Ga0207661_10391902
728 Ga0207661_10485278
729 Ga0207661_11275882
730 Ga0207679_10217249
731 Ga0207679_10578204
732 Ga0207679_11649870
733 Ga0207667_10003586
734 Ga0207667_10022222
735 Ga0207667_10070244
736 Ga0207667_10133346
737 Ga0207667_10306186
738 Ga0207651_10934354
739 Ga0207651_11330211
740 Ga0207712_10008449
741 Ga0207640_10131277
742 Ga0207640_10832598
743 Ga0207658_11152252
744 Ga0207677_10439030
745 Ga0207677_10510658
746 Ga0207639_10009595
747 Ga0207639_10136148
748 Ga0207639_10621738
749 Ga0207702_10007348
750 Ga0207702_10020491
751 Ga0207702_10160844
752 Ga0207702_10381446
753 Ga0207702_10894598
754 Ga0207702_10936887
755 Ga0207702_11399291
756 Ga0207641_10306768
757 Ga0207648_10106979
758 Ga0207648_11266408
759 Ga0207676_10347315
760 Ga0207674_10000241
761 Ga0207674_10004046
762 Ga0207674_10324684
763 Ga0207674_10374367
764 Ga0207683_10677485
765 Ga0207698_10002591
766 Ga0207698_10394957
767 Ga0268266_10436811
768 Ga0268264_10266898
769 Ga0268264_10319098
770 Ga0268264_11504739
771 Ga0265762_1117474
772 Ga0265760_10039630
773 Ga0265330_10311206
774 Ga0265332_10096973
775 Ga0265340_10045823
776 Ga0265331_10041952
777 Ga0265316_10804844
778 Ga0265313_10214845
779 Ga0265314_10000463
780 Ga0265314_10051692
781 Ga0265342_10134825
782 Ga0373934_0005466
783 Ga0373934_0215554
784 Ga0373954_0000757
785 Ga0373954_0008404
786 Ga0373931_0864585
787 Ga0373935_0544985
788 Ga0373935_1211947
789 Ga0373927_0217937
790 Ga0373927_0462790
791 Ga0373933_0166209
792 Ga0373947_0112371
793 Ga0373947_0470206
794 Ga0373947_0790492
795 Ga0373937_0179377
796 Ga0373937_0437190
797 Ga0373937_0795307
798 Ga0373937_0873524
799 Ga0373937_1025905
800 Ga0373937_1627680
801 Ga0373925_0021881
802 Ga0373925_0162705
803 Ga0373925_0858774
804 Ga0436365_0702052
805 Ga0436363_1419486
806 Ga0436362_1113886
807 Ga0451839_0154637
808 Ga0451839_1324718
809 Ga0466969_0073068
810 Ga0451576_0048397
811 Ga0495592_0280726
812 Ga0495592_0498678
813 Ga0495592_0562317
814 Ga0495651_0143421
815 Ga0495651_0325229
816 Ga0495580_0005200
817 Ga0495580_0026664
818 Ga0495580_0158510
819 Ga0495580_0355505
820 Ga0495580_0507985
821 Ga0495580_0692460
822 Ga0495582_0029614
823 Ga0495582_0614786
824 Ga0495582_0666690
825 Ga0495639_0409449
826 Ga0495639_0427747
827 Ga0495664_0348981
828 Ga0495594_0010377
829 Ga0495594_0518370
830 Ga0495618_0130311
831 Ga0495618_0744336
832 Ga0495628_0336470
833 Ga0495630_0220016
834 Ga0495652_0057810
835 Ga0495652_0240840
836 Ga0495665_0019032
837 Ga0495665_0406840
838 Ga0495586_0016929
839 Ga0495586_0396748
840 Ga0495587_0017125
841 Ga0495587_0027976
842 Ga0495587_0355390
843 Ga0495587_0595557
844 Ga0495587_0597149
845 Ga0495645_0155432
846 Ga0495645_0273426
847 Ga0495645_0900351
848 Ga0495667_0125536
849 Ga0495667_0302612
850 Ga0495667_0828327
851 Ga0495634_0218334
852 Ga0495599_0016327
853 Ga0495599_0218528
854 Ga0495599_0470030
855 Ga0495599_0838159
856 Ga0495623_0021541
857 Ga0495623_0370879
858 Ga0495646_0094106
859 Ga0495646_0545891
860 Ga0495613_0177001
861 Ga0495624_0313820
862 Ga0495624_0801266
863 Ga0495600_0171353
864 Ga0495600_0336148
865 Ga0495604_0081609
866 Ga0495604_0167507
867 Ga0495604_0374908
868 Ga0495674_0041087
869 Ga0495674_0070416
870 Ga0495674_0808265
871 Ga0495674_1210807
872 Ga0495680_0457238
873 Ga0495675_0055821
874 Ga0495675_0101994
875 Ga0495675_0371825
876 Ga0495684_0065908
877 Ga0495684_0096979
878 Ga0495684_0463702
879 Ga0495593_0178650
880 Ga0495602_0003454
881 Ga0495602_0572794
882 Ga0495602_1123533
883 Ga0496102_0776990
884 Ga0496104_0863910
885 Ga0496104_1369100
886 Ga0496114_1269261
887 Ga0495601_0058365
888 Ga0495619_0213377

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

9

127

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8889 11 76
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8794 11 76
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8741 7 77
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.867 7 77
4i7h-assembly1.cif.gz_A structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes 0.8594 8 74
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9177 9 73 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9046 10 75 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.902 11 74 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8989 11 75 1.10.10.10
1sd6A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8961 10 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A261F6A8-F1-model_v4 Penicillinase repressor 0.9034 10 84 GO:0003677
GO:0045892
AF-A0A3D5P045-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.8774 1 86 GO:0003677
GO:0045892
AF-A0A2E6LMD4-F1-model_v4 TrmB family transcriptional regulator 0.8717 7 106 GO:0003677
GO:0045892
AF-A0A4Y3G2C0-F1-model_v4 Cell division control protein 6 0.8625 9 78 GO:0006260
GO:0016887
GO:0051301
AF-A0A1R1BFV5-F1-model_v4 Transcriptional regulator 0.8578 3 78 GO:0003677
GO:0045892

Map