F445234
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 444 | 171 | 888 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10677784|Ga0070709_106777841 |
| Length | 130 |
| Sequence | LARKKSPNLTEAELKLMDVVWEKGSATVATVAAALRGKPELAYNTVLTTLRILEHKGYLRHTKSREGEGRAFVYHPVIGREQASRKAVRHLVSRFFSNSPELLVLNLLEDEEISEEEMKRIRTVLAEGGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 117 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 122 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 133 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 134 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 137 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.9 |
| Rhizosphere | 97.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 43.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10677784 | 3300005434 | Unclassified | 800 |
| 2 | Ga0070658_10539109 | 3300005327 | Unclassified | 1009 |
| 3 | Ga0070658_11672598 | 3300005327 | Unclassified | 551 |
| 4 | Ga0070658_11970151 | 3300005327 | Unclassified | 504 |
| 5 | Ga0070683_100000761 | 3300005329 | Bacteria | 23630 |
| 6 | Ga0070683_100001940 | 3300005329 | Bacteria | 16203 |
| 7 | Ga0070683_100009683 | 3300005329 | Bacteria | 8248 |
| 8 | Ga0070683_100011047 | 3300005329 | Bacteria | 7783 |
| 9 | Ga0070683_100088969 | 3300005329 | Bacteria | 2897 |
| 10 | Ga0070683_100142509 | 3300005329 | Bacteria | 2271 |
| 11 | Ga0070683_100435718 | 3300005329 | Bacteria | 1251 |
| 12 | Ga0070683_100794667 | 3300005329 | Unclassified | 907 |
| 13 | Ga0070683_101431585 | 3300005329 | Bacteria | 664 |
| 14 | Ga0070670_101876127 | 3300005331 | Unclassified | 552 |
| 15 | Ga0068869_101208543 | 3300005334 | Unclassified | 664 |
| 16 | Ga0070680_100455897 | 3300005336 | Unclassified | 1092 |
| 17 | Ga0070680_100518780 | 3300005336 | Unclassified | 1020 |
| 18 | Ga0070660_101696430 | 3300005339 | Unclassified | 538 |
| 19 | Ga0070661_100001692 | 3300005344 | Bacteria | 15284 |
| 20 | Ga0070661_100487039 | 3300005344 | Unclassified | 986 |
| 21 | Ga0070692_10293339 | 3300005345 | Unclassified | 990 |
| 22 | Ga0070671_100557120 | 3300005355 | Unclassified | 989 |
| 23 | Ga0070673_101004819 | 3300005364 | Unclassified | 777 |
| 24 | Ga0070709_10331262 | 3300005434 | Bacteria | 1120 |
| 25 | Ga0070714_100561991 | 3300005435 | Unclassified | 1093 |
| 26 | Ga0070714_101497232 | 3300005435 | Unclassified | 659 |
| 27 | Ga0070713_100099126 | 3300005436 | Bacteria | 2520 |
| 28 | Ga0070713_100198910 | 3300005436 | Bacteria | 1809 |
| 29 | Ga0070711_100213831 | 3300005439 | Bacteria | 1495 |
| 30 | Ga0070708_101636435 | 3300005445 | Unclassified | 599 |
| 31 | Ga0070681_10379341 | 3300005458 | Unclassified | 1324 |
| 32 | Ga0068867_100172939 | 3300005459 | Unclassified | 1712 |
| 33 | Ga0068867_100785987 | 3300005459 | Unclassified | 847 |
| 34 | Ga0070685_10805596 | 3300005466 | Unclassified | 693 |
| 35 | Ga0070679_100000767 | 3300005530 | Bacteria | 27851 |
| 36 | Ga0070679_100164166 | 3300005530 | Unclassified | 2195 |
| 37 | Ga0070679_100528654 | 3300005530 | Bacteria | 1123 |
| 38 | Ga0070679_100873789 | 3300005530 | Bacteria | 842 |
| 39 | Ga0070679_101976113 | 3300005530 | Unclassified | 532 |
| 40 | Ga0070684_100011613 | 3300005535 | Bacteria | 7020 |
| 41 | Ga0070684_100052372 | 3300005535 | Unclassified | 3550 |
| 42 | Ga0070684_100053545 | 3300005535 | Bacteria | 3514 |
| 43 | Ga0070684_100055440 | 3300005535 | Unclassified | 3456 |
| 44 | Ga0070684_100089367 | 3300005535 | Bacteria | 2738 |
| 45 | Ga0070684_100314973 | 3300005535 | Bacteria | 1437 |
| 46 | Ga0070684_100668738 | 3300005535 | Unclassified | 967 |
| 47 | Ga0070684_100819946 | 3300005535 | Unclassified | 870 |
| 48 | Ga0070697_100880501 | 3300005536 | Unclassified | 794 |
| 49 | Ga0068853_100008692 | 3300005539 | Bacteria | 8168 |
| 50 | Ga0068853_100294156 | 3300005539 | Bacteria | 1499 |
| 51 | Ga0070686_100035253 | 3300005544 | Unclassified | 3089 |
| 52 | Ga0070686_101600238 | 3300005544 | Unclassified | 551 |
| 53 | Ga0070695_100120711 | 3300005545 | Bacteria | 1792 |
| 54 | Ga0070693_100052189 | 3300005547 | Unclassified | 2344 |
| 55 | Ga0070693_100393125 | 3300005547 | Unclassified | 959 |
| 56 | Ga0070693_100519268 | 3300005547 | Unclassified | 848 |
| 57 | Ga0070665_100285041 | 3300005548 | Unclassified | 1654 |
| 58 | Ga0068855_100000800 | 3300005563 | Bacteria | 38947 |
| 59 | Ga0068855_100004374 | 3300005563 | Bacteria | 17265 |
| 60 | Ga0068855_100150209 | 3300005563 | Bacteria | 2649 |
| 61 | Ga0068855_100161063 | 3300005563 | Bacteria | 2547 |
| 62 | Ga0070664_102249381 | 3300005564 | Unclassified | 517 |
| 63 | Ga0068857_100012320 | 3300005577 | Bacteria | 7441 |
| 64 | Ga0068857_100178501 | 3300005577 | Bacteria | 1932 |
| 65 | Ga0068857_100183001 | 3300005577 | Bacteria | 1907 |
| 66 | Ga0068857_100193586 | 3300005577 | Bacteria | 1852 |
| 67 | Ga0068854_100010723 | 3300005578 | Bacteria | 5948 |
| 68 | Ga0068856_100010078 | 3300005614 | Bacteria | 9184 |
| 69 | Ga0068856_100702701 | 3300005614 | Bacteria | 1031 |
| 70 | Ga0068856_102085292 | 3300005614 | Bacteria | 577 |
| 71 | Ga0068852_100003344 | 3300005616 | Bacteria | 11194 |
| 72 | Ga0068852_100194803 | 3300005616 | Unclassified | 1914 |
| 73 | Ga0068852_100240702 | 3300005616 | Unclassified | 1729 |
| 74 | Ga0068852_102774522 | 3300005616 | Unclassified | 508 |
| 75 | Ga0068859_100194812 | 3300005617 | Bacteria | 2111 |
| 76 | Ga0068859_101528182 | 3300005617 | Unclassified | 737 |
| 77 | Ga0068859_102694287 | 3300005617 | Bacteria | 546 |
| 78 | Ga0068864_100406173 | 3300005618 | Bacteria | 1295 |
| 79 | Ga0068861_100511085 | 3300005719 | Unclassified | 1088 |
| 80 | Ga0068851_10458129 | 3300005834 | Unclassified | 759 |
| 81 | Ga0068863_100206928 | 3300005841 | Bacteria | 1889 |
| 82 | Ga0068858_100073595 | 3300005842 | Bacteria | 3171 |
| 83 | Ga0068858_101945494 | 3300005842 | Bacteria | 581 |
| 84 | Ga0070717_10077769 | 3300006028 | Bacteria | 2779 |
| 85 | Ga0070717_10252241 | 3300006028 | Bacteria | 1559 |
| 86 | Ga0070717_10903967 | 3300006028 | Unclassified | 804 |
| 87 | Ga0070717_11065496 | 3300006028 | Unclassified | 736 |
| 88 | Ga0070717_11850096 | 3300006028 | Bacteria | 545 |
| 89 | Ga0097621_100019041 | 3300006237 | Bacteria | 5261 |
| 90 | Ga0097621_100031925 | 3300006237 | Unclassified | 4182 |
| 91 | Ga0097621_100289490 | 3300006237 | Bacteria | 1444 |
| 92 | Ga0097621_100732523 | 3300006237 | Bacteria | 912 |
| 93 | Ga0097621_101672148 | 3300006237 | Bacteria | 606 |
| 94 | Ga0068871_100034437 | 3300006358 | Unclassified | 4018 |
| 95 | Ga0068871_100238128 | 3300006358 | Bacteria | 1581 |
| 96 | Ga0068871_100358745 | 3300006358 | Bacteria | 1291 |
| 97 | Ga0068871_100601407 | 3300006358 | Bacteria | 1000 |
| 98 | Ga0068865_100190810 | 3300006881 | Bacteria | 1584 |
| 99 | Ga0097620_100194804 | 3300006931 | Bacteria | 2111 |
| 100 | Ga0097620_101528020 | 3300006931 | Unclassified | 737 |
| 101 | Ga0097620_102693390 | 3300006931 | Bacteria | 546 |
| 102 | Ga0105240_10005874 | 3300009093 | Bacteria | 18183 |
| 103 | Ga0105240_10006779 | 3300009093 | Bacteria | 16751 |
| 104 | Ga0105240_10012536 | 3300009093 | Bacteria | 11694 |
| 105 | Ga0105240_10023716 | 3300009093 | Bacteria | 8104 |
| 106 | Ga0105240_10122705 | 3300009093 | Bacteria | 3126 |
| 107 | Ga0105240_10163033 | 3300009093 | Bacteria | 2646 |
| 108 | Ga0105240_10336646 | 3300009093 | Bacteria | 1715 |
| 109 | Ga0105240_10380608 | 3300009093 | Unclassified | 1594 |
| 110 | Ga0105240_10392377 | 3300009093 | Bacteria | 1565 |
| 111 | Ga0105240_10829080 | 3300009093 | Unclassified | 1000 |
| 112 | Ga0105245_10002575 | 3300009098 | Bacteria | 16326 |
| 113 | Ga0105245_10003483 | 3300009098 | Bacteria | 14084 |
| 114 | Ga0105245_10045844 | 3300009098 | Bacteria | 3906 |
| 115 | Ga0105245_10073092 | 3300009098 | Unclassified | 3117 |
| 116 | Ga0105245_11212572 | 3300009098 | Bacteria | 803 |
| 117 | Ga0105245_11296448 | 3300009098 | Unclassified | 777 |
| 118 | Ga0105247_10125501 | 3300009101 | Bacteria | 1668 |
| 119 | Ga0105243_10749207 | 3300009148 | Unclassified | 957 |
| 120 | Ga0105243_12425192 | 3300009148 | Unclassified | 563 |
| 121 | Ga0105241_10014587 | 3300009174 | Bacteria | 5754 |
| 122 | Ga0105241_10019387 | 3300009174 | Bacteria | 5015 |
| 123 | Ga0105241_10024154 | 3300009174 | Bacteria | 4514 |
| 124 | Ga0105241_10075394 | 3300009174 | Bacteria | 2628 |
| 125 | Ga0105241_10163409 | 3300009174 | Unclassified | 1832 |
| 126 | Ga0105241_10684837 | 3300009174 | Bacteria | 934 |
| 127 | Ga0105242_10296049 | 3300009176 | Unclassified | 1475 |
| 128 | Ga0105242_10685433 | 3300009176 | Unclassified | 1001 |
| 129 | Ga0105242_10685698 | 3300009176 | Unclassified | 1000 |
| 130 | Ga0105242_10693503 | 3300009176 | Bacteria | 995 |
| 131 | Ga0105242_10862926 | 3300009176 | Bacteria | 902 |
| 132 | Ga0105242_11590122 | 3300009176 | Unclassified | 687 |
| 133 | Ga0105242_12409273 | 3300009176 | Bacteria | 574 |
| 134 | Ga0105248_10006675 | 3300009177 | Bacteria | 12666 |
| 135 | Ga0105248_10234020 | 3300009177 | Unclassified | 2068 |
| 136 | Ga0105248_10311289 | 3300009177 | Unclassified | 1773 |
| 137 | Ga0105248_10624063 | 3300009177 | Bacteria | 1216 |
| 138 | Ga0105248_10988726 | 3300009177 | Unclassified | 950 |
| 139 | Ga0105248_11317340 | 3300009177 | Bacteria | 817 |
| 140 | Ga0105237_10011489 | 3300009545 | Bacteria | 9368 |
| 141 | Ga0105237_10012851 | 3300009545 | Bacteria | 8801 |
| 142 | Ga0105237_10092996 | 3300009545 | Bacteria | 3005 |
| 143 | Ga0105237_10508635 | 3300009545 | Bacteria | 1211 |
| 144 | Ga0105237_10518533 | 3300009545 | Bacteria | 1198 |
| 145 | Ga0105237_10519767 | 3300009545 | Unclassified | 1197 |
| 146 | Ga0105237_10559898 | 3300009545 | Unclassified | 1150 |
| 147 | Ga0105237_11426094 | 3300009545 | Unclassified | 699 |
| 148 | Ga0105237_11675070 | 3300009545 | Unclassified | 643 |
| 149 | Ga0105238_10001258 | 3300009551 | Bacteria | 25478 |
| 150 | Ga0105238_10002612 | 3300009551 | Bacteria | 17963 |
| 151 | Ga0105238_10014278 | 3300009551 | Bacteria | 8028 |
| 152 | Ga0105238_10038476 | 3300009551 | Bacteria | 4858 |
| 153 | Ga0105238_10039769 | 3300009551 | Bacteria | 4768 |
| 154 | Ga0105238_10423276 | 3300009551 | Unclassified | 1326 |
| 155 | Ga0105238_10428863 | 3300009551 | Bacteria | 1318 |
| 156 | Ga0105238_10440186 | 3300009551 | Bacteria | 1300 |
| 157 | Ga0105249_10022279 | 3300009553 | Bacteria | 5675 |
| 158 | Ga0105249_10834262 | 3300009553 | Unclassified | 987 |
| 159 | Ga0105239_10001337 | 3300010375 | Bacteria | 33219 |
| 160 | Ga0105239_10036324 | 3300010375 | Bacteria | 5410 |
| 161 | Ga0105239_10054412 | 3300010375 | Unclassified | 4390 |
| 162 | Ga0105239_10317191 | 3300010375 | Bacteria | 1757 |
| 163 | Ga0105239_10421383 | 3300010375 | Unclassified | 1512 |
| 164 | Ga0105239_10430201 | 3300010375 | Unclassified | 1496 |
| 165 | Ga0105239_10614345 | 3300010375 | Unclassified | 1240 |
| 166 | Ga0105239_10995917 | 3300010375 | Bacteria | 963 |
| 167 | Ga0105246_10005959 | 3300011119 | Bacteria | 7442 |
| 168 | Ga0105246_10598135 | 3300011119 | Unclassified | 952 |
| 169 | Ga0105246_10764184 | 3300011119 | Bacteria | 854 |
| 170 | Ga0157373_10169374 | 3300013100 | Unclassified | 1537 |
| 171 | Ga0157373_10268925 | 3300013100 | Unclassified | 1207 |
| 172 | Ga0157371_10030030 | 3300013102 | Unclassified | 3923 |
| 173 | Ga0157370_10101197 | 3300013104 | Bacteria | 2699 |
| 174 | Ga0157370_10528205 | 3300013104 | Unclassified | 1083 |
| 175 | Ga0157370_10914884 | 3300013104 | Unclassified | 796 |
| 176 | Ga0157369_10002395 | 3300013105 | Bacteria | 22527 |
| 177 | Ga0157369_10006571 | 3300013105 | Bacteria | 13455 |
| 178 | Ga0157369_10014159 | 3300013105 | Bacteria | 9011 |
| 179 | Ga0157369_10207802 | 3300013105 | Bacteria | 2053 |
| 180 | Ga0157369_10357096 | 3300013105 | Unclassified | 1517 |
| 181 | Ga0157369_10390227 | 3300013105 | Unclassified | 1444 |
| 182 | Ga0157369_10581780 | 3300013105 | Unclassified | 1156 |
| 183 | Ga0157369_10729849 | 3300013105 | Unclassified | 1020 |
| 184 | Ga0157369_11539983 | 3300013105 | Unclassified | 676 |
| 185 | Ga0157374_10067542 | 3300013296 | Unclassified | 3361 |
| 186 | Ga0157374_10208014 | 3300013296 | Bacteria | 1918 |
| 187 | Ga0157374_10324756 | 3300013296 | Bacteria | 1526 |
| 188 | Ga0157374_10644501 | 3300013296 | Bacteria | 1071 |
| 189 | Ga0157374_10734879 | 3300013296 | Unclassified | 1001 |
| 190 | Ga0157374_10840876 | 3300013296 | Unclassified | 934 |
| 191 | Ga0157378_10028616 | 3300013297 | Bacteria | 4918 |
| 192 | Ga0157378_10108386 | 3300013297 | Bacteria | 2543 |
| 193 | Ga0157378_12157234 | 3300013297 | Bacteria | 608 |
| 194 | Ga0163162_10831955 | 3300013306 | Unclassified | 1039 |
| 195 | Ga0163162_11441161 | 3300013306 | Unclassified | 784 |
| 196 | Ga0157372_10002403 | 3300013307 | Bacteria | 20285 |
| 197 | Ga0157372_10017836 | 3300013307 | Bacteria | 7623 |
| 198 | Ga0157372_10026797 | 3300013307 | Bacteria | 6275 |
| 199 | Ga0157372_10130356 | 3300013307 | Bacteria | 2893 |
| 200 | Ga0157372_10172073 | 3300013307 | Bacteria | 2506 |
| 201 | Ga0157372_10204293 | 3300013307 | Bacteria | 2289 |
| 202 | Ga0157372_13110070 | 3300013307 | Unclassified | 530 |
| 203 | Ga0157372_13213006 | 3300013307 | Unclassified | 521 |
| 204 | Ga0157375_10006669 | 3300013308 | Bacteria | 10051 |
| 205 | Ga0163163_10016316 | 3300014325 | Bacteria | 6895 |
| 206 | Ga0163163_10039648 | 3300014325 | Bacteria | 4598 |
| 207 | Ga0163163_10054130 | 3300014325 | Bacteria | 3963 |
| 208 | Ga0163163_10071473 | 3300014325 | Bacteria | 3458 |
| 209 | Ga0163163_10297176 | 3300014325 | Bacteria | 1667 |
| 210 | Ga0157377_10438393 | 3300014745 | Unclassified | 899 |
| 211 | Ga0157379_11042940 | 3300014968 | Bacteria | 781 |
| 212 | Ga0157379_12267329 | 3300014968 | Bacteria | 540 |
| 213 | Ga0157376_10098953 | 3300014969 | Bacteria | 2543 |
| 214 | Ga0157376_10352610 | 3300014969 | Bacteria | 1409 |
| 215 | Ga0157376_11420888 | 3300014969 | Unclassified | 726 |
| 216 | Ga0213874_10238442 | 3300021377 | Unclassified | 666 |
| 217 | Ga0207692_10876782 | 3300025898 | Unclassified | 590 |
| 218 | Ga0207699_10274615 | 3300025906 | Unclassified | 1169 |
| 219 | Ga0207699_10400674 | 3300025906 | Unclassified | 977 |
| 220 | Ga0207699_10783678 | 3300025906 | Unclassified | 700 |
| 221 | Ga0207699_11262745 | 3300025906 | Unclassified | 547 |
| 222 | Ga0207705_10433117 | 3300025909 | Unclassified | 1019 |
| 223 | Ga0207654_10008855 | 3300025911 | Bacteria | 5105 |
| 224 | Ga0207654_10054823 | 3300025911 | Unclassified | 2305 |
| 225 | Ga0207654_10091578 | 3300025911 | Bacteria | 1855 |
| 226 | Ga0207654_10149131 | 3300025911 | Unclassified | 1499 |
| 227 | Ga0207654_10151350 | 3300025911 | Unclassified | 1489 |
| 228 | Ga0207654_10564766 | 3300025911 | Unclassified | 809 |
| 229 | Ga0207707_10000358 | 3300025912 | Bacteria | 47947 |
| 230 | Ga0207695_10000391 | 3300025913 | Bacteria | 98481 |
| 231 | Ga0207695_10001641 | 3300025913 | Bacteria | 36134 |
| 232 | Ga0207695_10002536 | 3300025913 | Bacteria | 26833 |
| 233 | Ga0207695_10012400 | 3300025913 | Bacteria | 10236 |
| 234 | Ga0207695_10063270 | 3300025913 | Bacteria | 3815 |
| 235 | Ga0207695_10289229 | 3300025913 | Bacteria | 1531 |
| 236 | Ga0207695_10582398 | 3300025913 | Unclassified | 1000 |
| 237 | Ga0207671_10007423 | 3300025914 | Bacteria | 9514 |
| 238 | Ga0207671_10016667 | 3300025914 | Bacteria | 5704 |
| 239 | Ga0207671_10101307 | 3300025914 | Bacteria | 2182 |
| 240 | Ga0207671_10335533 | 3300025914 | Unclassified | 1197 |
| 241 | Ga0207663_10150773 | 3300025916 | Bacteria | 1631 |
| 242 | Ga0207663_11061545 | 3300025916 | Unclassified | 651 |
| 243 | Ga0207663_11365978 | 3300025916 | Bacteria | 571 |
| 244 | Ga0207660_10463537 | 3300025917 | Unclassified | 1025 |
| 245 | Ga0207649_10010518 | 3300025920 | Bacteria | 5086 |
| 246 | Ga0207649_11484351 | 3300025920 | Unclassified | 537 |
| 247 | Ga0207652_10006494 | 3300025921 | Bacteria | 9425 |
| 248 | Ga0207694_10002026 | 3300025924 | Bacteria | 16771 |
| 249 | Ga0207694_10004929 | 3300025924 | Bacteria | 10348 |
| 250 | Ga0207694_10006394 | 3300025924 | Bacteria | 8976 |
| 251 | Ga0207694_10059411 | 3300025924 | Bacteria | 2973 |
| 252 | Ga0207694_10521965 | 3300025924 | Unclassified | 995 |
| 253 | Ga0207687_10002516 | 3300025927 | Bacteria | 12429 |
| 254 | Ga0207687_10005222 | 3300025927 | Bacteria | 8608 |
| 255 | Ga0207687_10020350 | 3300025927 | Unclassified | 4401 |
| 256 | Ga0207687_10787659 | 3300025927 | Unclassified | 810 |
| 257 | Ga0207687_11760389 | 3300025927 | Bacteria | 531 |
| 258 | Ga0207700_10001996 | 3300025928 | Bacteria | 11638 |
| 259 | Ga0207700_10120196 | 3300025928 | Bacteria | 2129 |
| 260 | Ga0207700_10919291 | 3300025928 | Bacteria | 783 |
| 261 | Ga0207664_10793939 | 3300025929 | Unclassified | 852 |
| 262 | Ga0207664_11013647 | 3300025929 | Unclassified | 744 |
| 263 | Ga0207664_11343964 | 3300025929 | Unclassified | 635 |
| 264 | Ga0207644_10387373 | 3300025931 | Unclassified | 1141 |
| 265 | Ga0207690_10370219 | 3300025932 | Unclassified | 1136 |
| 266 | Ga0207706_10070769 | 3300025933 | Unclassified | 3068 |
| 267 | Ga0207686_10391372 | 3300025934 | Unclassified | 1056 |
| 268 | Ga0207686_11506298 | 3300025934 | Bacteria | 555 |
| 269 | Ga0207709_10126906 | 3300025935 | Unclassified | 1732 |
| 270 | Ga0207670_10150575 | 3300025936 | Bacteria | 1726 |
| 271 | Ga0207670_10182178 | 3300025936 | Unclassified | 1583 |
| 272 | Ga0207704_10026244 | 3300025938 | Bacteria | 3193 |
| 273 | Ga0207704_10197770 | 3300025938 | Bacteria | 1468 |
| 274 | Ga0207711_10014389 | 3300025941 | Bacteria | 6570 |
| 275 | Ga0207711_10024201 | 3300025941 | Bacteria | 5083 |
| 276 | Ga0207711_10546370 | 3300025941 | Bacteria | 1080 |
| 277 | Ga0207711_10689698 | 3300025941 | Unclassified | 953 |
| 278 | Ga0207711_11519145 | 3300025941 | Bacteria | 613 |
| 279 | Ga0207689_10254628 | 3300025942 | Bacteria | 1452 |
| 280 | Ga0207689_10317367 | 3300025942 | Unclassified | 1293 |
| 281 | Ga0207661_10165092 | 3300025944 | Bacteria | 1923 |
| 282 | Ga0207661_10232549 | 3300025944 | Bacteria | 1633 |
| 283 | Ga0207661_10391902 | 3300025944 | Bacteria | 1258 |
| 284 | Ga0207661_10485278 | 3300025944 | Unclassified | 1128 |
| 285 | Ga0207661_11275882 | 3300025944 | Unclassified | 675 |
| 286 | Ga0207679_10217249 | 3300025945 | Unclassified | 1607 |
| 287 | Ga0207679_10578204 | 3300025945 | Bacteria | 1010 |
| 288 | Ga0207679_11649870 | 3300025945 | Unclassified | 587 |
| 289 | Ga0207667_10003586 | 3300025949 | Bacteria | 19181 |
| 290 | Ga0207667_10022222 | 3300025949 | Bacteria | 7012 |
| 291 | Ga0207667_10070244 | 3300025949 | Bacteria | 3645 |
| 292 | Ga0207667_10133346 | 3300025949 | Unclassified | 2559 |
| 293 | Ga0207667_10306186 | 3300025949 | Bacteria | 1623 |
| 294 | Ga0207651_10934354 | 3300025960 | Unclassified | 773 |
| 295 | Ga0207651_11330211 | 3300025960 | Unclassified | 646 |
| 296 | Ga0207712_10008449 | 3300025961 | Bacteria | 6508 |
| 297 | Ga0207640_10131277 | 3300025981 | Bacteria | 1811 |
| 298 | Ga0207640_10832598 | 3300025981 | Unclassified | 802 |
| 299 | Ga0207658_11152252 | 3300025986 | Unclassified | 709 |
| 300 | Ga0207677_10439030 | 3300026023 | Unclassified | 1116 |
| 301 | Ga0207677_10510658 | 3300026023 | Unclassified | 1041 |
| 302 | Ga0207639_10009595 | 3300026041 | Bacteria | 6684 |
| 303 | Ga0207639_10136148 | 3300026041 | Bacteria | 2040 |
| 304 | Ga0207639_10621738 | 3300026041 | Unclassified | 997 |
| 305 | Ga0207702_10007348 | 3300026078 | Bacteria | 9411 |
| 306 | Ga0207702_10020491 | 3300026078 | Bacteria | 5474 |
| 307 | Ga0207702_10160844 | 3300026078 | Bacteria | 2050 |
| 308 | Ga0207702_10381446 | 3300026078 | Unclassified | 1356 |
| 309 | Ga0207702_10894598 | 3300026078 | Unclassified | 880 |
| 310 | Ga0207702_10936887 | 3300026078 | Unclassified | 859 |
| 311 | Ga0207702_11399291 | 3300026078 | Unclassified | 693 |
| 312 | Ga0207641_10306768 | 3300026088 | Bacteria | 1501 |
| 313 | Ga0207648_10106979 | 3300026089 | Unclassified | 2455 |
| 314 | Ga0207648_11266408 | 3300026089 | Unclassified | 693 |
| 315 | Ga0207676_10347315 | 3300026095 | Bacteria | 1371 |
| 316 | Ga0207674_10000241 | 3300026116 | Bacteria | 68328 |
| 317 | Ga0207674_10004046 | 3300026116 | Bacteria | 17795 |
| 318 | Ga0207674_10324684 | 3300026116 | Bacteria | 1489 |
| 319 | Ga0207674_10374367 | 3300026116 | Bacteria | 1376 |
| 320 | Ga0207683_10677485 | 3300026121 | Unclassified | 956 |
| 321 | Ga0207698_10002591 | 3300026142 | Bacteria | 10754 |
| 322 | Ga0207698_10394957 | 3300026142 | Unclassified | 1320 |
| 323 | Ga0268266_10436811 | 3300028379 | Bacteria | 1243 |
| 324 | Ga0268264_10266898 | 3300028381 | Unclassified | 1597 |
| 325 | Ga0268264_10319098 | 3300028381 | Bacteria | 1468 |
| 326 | Ga0268264_11504739 | 3300028381 | Unclassified | 684 |
| 327 | Ga0265762_1117474 | 3300030760 | Unclassified | 605 |
| 328 | Ga0265760_10039630 | 3300031090 | Bacteria | 1402 |
| 329 | Ga0265330_10311206 | 3300031235 | Unclassified | 664 |
| 330 | Ga0265332_10096973 | 3300031238 | Bacteria | 1245 |
| 331 | Ga0265340_10045823 | 3300031247 | Unclassified | 2134 |
| 332 | Ga0265331_10041952 | 3300031250 | Bacteria | 2221 |
| 333 | Ga0265316_10804844 | 3300031344 | Bacteria | 659 |
| 334 | Ga0265313_10214845 | 3300031595 | Unclassified | 795 |
| 335 | Ga0265314_10000463 | 3300031711 | Bacteria | 54000 |
| 336 | Ga0265314_10051692 | 3300031711 | Bacteria | 2861 |
| 337 | Ga0265342_10134825 | 3300031712 | Bacteria | 1381 |
| 338 | Ga0373934_0005466 | 3300035086 | Bacteria | 4703 |
| 339 | Ga0373934_0215554 | 3300035086 | Unclassified | 792 |
| 340 | Ga0373954_0000757 | 3300035118 | Bacteria | 12474 |
| 341 | Ga0373954_0008404 | 3300035118 | Bacteria | 4529 |
| 342 | Ga0373931_0864585 | 3300035691 | Bacteria | 606 |
| 343 | Ga0373935_0544985 | 3300035692 | Bacteria | 845 |
| 344 | Ga0373935_1211947 | 3300035692 | Unclassified | 563 |
| 345 | Ga0373927_0217937 | 3300035695 | Bacteria | 1254 |
| 346 | Ga0373927_0462790 | 3300035695 | Unclassified | 838 |
| 347 | Ga0373933_0166209 | 3300035724 | Unclassified | 1402 |
| 348 | Ga0373947_0112371 | 3300035725 | Bacteria | 1723 |
| 349 | Ga0373947_0470206 | 3300035725 | Unclassified | 853 |
| 350 | Ga0373947_0790492 | 3300035725 | Unclassified | 648 |
| 351 | Ga0373937_0179377 | 3300036401 | Unclassified | 1988 |
| 352 | Ga0373937_0437190 | 3300036401 | Bacteria | 1242 |
| 353 | Ga0373937_0795307 | 3300036401 | Bacteria | 894 |
| 354 | Ga0373937_0873524 | 3300036401 | Bacteria | 848 |
| 355 | Ga0373937_1025905 | 3300036401 | Unclassified | 774 |
| 356 | Ga0373937_1627680 | 3300036401 | Unclassified | 593 |
| 357 | Ga0373925_0021881 | 3300037068 | Bacteria | 4661 |
| 358 | Ga0373925_0162705 | 3300037068 | Unclassified | 1759 |
| 359 | Ga0373925_0858774 | 3300037068 | Unclassified | 748 |
| 360 | Ga0436365_0702052 | 3300039437 | Bacteria | 1780 |
| 361 | Ga0436363_1419486 | 3300039450 | Bacteria | 6790 |
| 362 | Ga0436362_1113886 | 3300039453 | Unclassified | 1180 |
| 363 | Ga0451839_0154637 | 3300041496 | Unclassified | 827 |
| 364 | Ga0451839_1324718 | 3300041496 | Unclassified | 592 |
| 365 | Ga0466969_0073068 | 3300044656 | Unclassified | 1646 |
| 366 | Ga0451576_0048397 | 3300045051 | Bacteria | 4466 |
| 367 | Ga0495592_0280726 | 3300046454 | Bacteria | 1089 |
| 368 | Ga0495592_0498678 | 3300046454 | Bacteria | 756 |
| 369 | Ga0495592_0562317 | 3300046454 | Unclassified | 700 |
| 370 | Ga0495651_0143421 | 3300046462 | Bacteria | 1729 |
| 371 | Ga0495651_0325229 | 3300046462 | Bacteria | 1024 |
| 372 | Ga0495580_0005200 | 3300046472 | Bacteria | 10812 |
| 373 | Ga0495580_0026664 | 3300046472 | Bacteria | 4211 |
| 374 | Ga0495580_0158510 | 3300046472 | Bacteria | 1567 |
| 375 | Ga0495580_0355505 | 3300046472 | Bacteria | 992 |
| 376 | Ga0495580_0507985 | 3300046472 | Bacteria | 804 |
| 377 | Ga0495580_0692460 | 3300046472 | Bacteria | 667 |
| 378 | Ga0495582_0029614 | 3300046473 | Unclassified | 3005 |
| 379 | Ga0495582_0614786 | 3300046473 | Bacteria | 629 |
| 380 | Ga0495582_0666690 | 3300046473 | Bacteria | 602 |
| 381 | Ga0495639_0409449 | 3300046475 | Bacteria | 686 |
| 382 | Ga0495639_0427747 | 3300046475 | Unclassified | 671 |
| 383 | Ga0495664_0348981 | 3300046477 | Bacteria | 891 |
| 384 | Ga0495594_0010377 | 3300046499 | Bacteria | 4832 |
| 385 | Ga0495594_0518370 | 3300046499 | Bacteria | 677 |
| 386 | Ga0495618_0130311 | 3300046514 | Bacteria | 1609 |
| 387 | Ga0495618_0744336 | 3300046514 | Bacteria | 574 |
| 388 | Ga0495628_0336470 | 3300046516 | Unclassified | 1112 |
| 389 | Ga0495630_0220016 | 3300046517 | Bacteria | 1450 |
| 390 | Ga0495652_0057810 | 3300046529 | Unclassified | 3287 |
| 391 | Ga0495652_0240840 | 3300046529 | Unclassified | 1346 |
| 392 | Ga0495665_0019032 | 3300046531 | Unclassified | 3691 |
| 393 | Ga0495665_0406840 | 3300046531 | Unclassified | 690 |
| 394 | Ga0495586_0016929 | 3300046535 | Bacteria | 3877 |
| 395 | Ga0495586_0396748 | 3300046535 | Bacteria | 794 |
| 396 | Ga0495587_0017125 | 3300046536 | Unclassified | 4506 |
| 397 | Ga0495587_0027976 | 3300046536 | Bacteria | 3432 |
| 398 | Ga0495587_0355390 | 3300046536 | Unclassified | 816 |
| 399 | Ga0495587_0595557 | 3300046536 | Bacteria | 609 |
| 400 | Ga0495587_0597149 | 3300046536 | Unclassified | 608 |
| 401 | Ga0495645_0155432 | 3300046543 | Bacteria | 1585 |
| 402 | Ga0495645_0273426 | 3300046543 | Bacteria | 1114 |
| 403 | Ga0495645_0900351 | 3300046543 | Unclassified | 525 |
| 404 | Ga0495667_0125536 | 3300046559 | Bacteria | 1656 |
| 405 | Ga0495667_0302612 | 3300046559 | Bacteria | 1013 |
| 406 | Ga0495667_0828327 | 3300046559 | Unclassified | 570 |
| 407 | Ga0495634_0218334 | 3300046642 | Bacteria | 1178 |
| 408 | Ga0495599_0016327 | 3300046678 | Unclassified | 4610 |
| 409 | Ga0495599_0218528 | 3300046678 | Unclassified | 1167 |
| 410 | Ga0495599_0470030 | 3300046678 | Unclassified | 743 |
| 411 | Ga0495599_0838159 | 3300046678 | Unclassified | 524 |
| 412 | Ga0495623_0021541 | 3300046679 | Bacteria | 4162 |
| 413 | Ga0495623_0370879 | 3300046679 | Bacteria | 776 |
| 414 | Ga0495646_0094106 | 3300046680 | Bacteria | 1726 |
| 415 | Ga0495646_0545891 | 3300046680 | Bacteria | 592 |
| 416 | Ga0495613_0177001 | 3300046689 | Unclassified | 1512 |
| 417 | Ga0495624_0313820 | 3300046690 | Bacteria | 945 |
| 418 | Ga0495624_0801266 | 3300046690 | Bacteria | 557 |
| 419 | Ga0495600_0171353 | 3300046809 | Bacteria | 1401 |
| 420 | Ga0495600_0336148 | 3300046809 | Unclassified | 948 |
| 421 | Ga0495604_0081609 | 3300047317 | Bacteria | 2420 |
| 422 | Ga0495604_0167507 | 3300047317 | Bacteria | 1548 |
| 423 | Ga0495604_0374908 | 3300047317 | Bacteria | 941 |
| 424 | Ga0495674_0041087 | 3300047319 | Bacteria | 4133 |
| 425 | Ga0495674_0070416 | 3300047319 | Bacteria | 3022 |
| 426 | Ga0495674_0808265 | 3300047319 | Unclassified | 729 |
| 427 | Ga0495674_1210807 | 3300047319 | Unclassified | 570 |
| 428 | Ga0495680_0457238 | 3300047322 | Bacteria | 873 |
| 429 | Ga0495675_0055821 | 3300047444 | Bacteria | 2505 |
| 430 | Ga0495675_0101994 | 3300047444 | Unclassified | 1795 |
| 431 | Ga0495675_0371825 | 3300047444 | Bacteria | 837 |
| 432 | Ga0495684_0065908 | 3300047471 | Unclassified | 2753 |
| 433 | Ga0495684_0096979 | 3300047471 | Bacteria | 2231 |
| 434 | Ga0495684_0463702 | 3300047471 | Bacteria | 878 |
| 435 | Ga0495593_0178650 | 3300047673 | Unclassified | 1069 |
| 436 | Ga0495602_0003454 | 3300048088 | Bacteria | 16350 |
| 437 | Ga0495602_0572794 | 3300048088 | Bacteria | 780 |
| 438 | Ga0495602_1123533 | 3300048088 | Unclassified | 514 |
| 439 | Ga0496102_0776990 | 3300048905 | Unclassified | 880 |
| 440 | Ga0496104_0863910 | 3300048907 | Unclassified | 810 |
| 441 | Ga0496104_1369100 | 3300048907 | Unclassified | 611 |
| 442 | Ga0496114_1269261 | 3300048917 | Bacteria | 623 |
| 443 | Ga0495601_0058365 | 3300053077 | Unclassified | 2445 |
| 444 | Ga0495619_0213377 | 3300053085 | Unclassified | 1337 |
| 445 | Ga0070709_10677784 | |||
| 446 | Ga0070658_10539109 | |||
| 447 | Ga0070658_11672598 | |||
| 448 | Ga0070658_11970151 | |||
| 449 | Ga0070683_100000761 | |||
| 450 | Ga0070683_100001940 | |||
| 451 | Ga0070683_100009683 | |||
| 452 | Ga0070683_100011047 | |||
| 453 | Ga0070683_100088969 | |||
| 454 | Ga0070683_100142509 | |||
| 455 | Ga0070683_100435718 | |||
| 456 | Ga0070683_100794667 | |||
| 457 | Ga0070683_101431585 | |||
| 458 | Ga0070670_101876127 | |||
| 459 | Ga0068869_101208543 | |||
| 460 | Ga0070680_100455897 | |||
| 461 | Ga0070680_100518780 | |||
| 462 | Ga0070660_101696430 | |||
| 463 | Ga0070661_100001692 | |||
| 464 | Ga0070661_100487039 | |||
| 465 | Ga0070692_10293339 | |||
| 466 | Ga0070671_100557120 | |||
| 467 | Ga0070673_101004819 | |||
| 468 | Ga0070709_10331262 | |||
| 469 | Ga0070714_100561991 | |||
| 470 | Ga0070714_101497232 | |||
| 471 | Ga0070713_100099126 | |||
| 472 | Ga0070713_100198910 | |||
| 473 | Ga0070711_100213831 | |||
| 474 | Ga0070708_101636435 | |||
| 475 | Ga0070681_10379341 | |||
| 476 | Ga0068867_100172939 | |||
| 477 | Ga0068867_100785987 | |||
| 478 | Ga0070685_10805596 | |||
| 479 | Ga0070679_100000767 | |||
| 480 | Ga0070679_100164166 | |||
| 481 | Ga0070679_100528654 | |||
| 482 | Ga0070679_100873789 | |||
| 483 | Ga0070679_101976113 | |||
| 484 | Ga0070684_100011613 | |||
| 485 | Ga0070684_100052372 | |||
| 486 | Ga0070684_100053545 | |||
| 487 | Ga0070684_100055440 | |||
| 488 | Ga0070684_100089367 | |||
| 489 | Ga0070684_100314973 | |||
| 490 | Ga0070684_100668738 | |||
| 491 | Ga0070684_100819946 | |||
| 492 | Ga0070697_100880501 | |||
| 493 | Ga0068853_100008692 | |||
| 494 | Ga0068853_100294156 | |||
| 495 | Ga0070686_100035253 | |||
| 496 | Ga0070686_101600238 | |||
| 497 | Ga0070695_100120711 | |||
| 498 | Ga0070693_100052189 | |||
| 499 | Ga0070693_100393125 | |||
| 500 | Ga0070693_100519268 | |||
| 501 | Ga0070665_100285041 | |||
| 502 | Ga0068855_100000800 | |||
| 503 | Ga0068855_100004374 | |||
| 504 | Ga0068855_100150209 | |||
| 505 | Ga0068855_100161063 | |||
| 506 | Ga0070664_102249381 | |||
| 507 | Ga0068857_100012320 | |||
| 508 | Ga0068857_100178501 | |||
| 509 | Ga0068857_100183001 | |||
| 510 | Ga0068857_100193586 | |||
| 511 | Ga0068854_100010723 | |||
| 512 | Ga0068856_100010078 | |||
| 513 | Ga0068856_100702701 | |||
| 514 | Ga0068856_102085292 | |||
| 515 | Ga0068852_100003344 | |||
| 516 | Ga0068852_100194803 | |||
| 517 | Ga0068852_100240702 | |||
| 518 | Ga0068852_102774522 | |||
| 519 | Ga0068859_100194812 | |||
| 520 | Ga0068859_101528182 | |||
| 521 | Ga0068859_102694287 | |||
| 522 | Ga0068864_100406173 | |||
| 523 | Ga0068861_100511085 | |||
| 524 | Ga0068851_10458129 | |||
| 525 | Ga0068863_100206928 | |||
| 526 | Ga0068858_100073595 | |||
| 527 | Ga0068858_101945494 | |||
| 528 | Ga0070717_10077769 | |||
| 529 | Ga0070717_10252241 | |||
| 530 | Ga0070717_10903967 | |||
| 531 | Ga0070717_11065496 | |||
| 532 | Ga0070717_11850096 | |||
| 533 | Ga0097621_100019041 | |||
| 534 | Ga0097621_100031925 | |||
| 535 | Ga0097621_100289490 | |||
| 536 | Ga0097621_100732523 | |||
| 537 | Ga0097621_101672148 | |||
| 538 | Ga0068871_100034437 | |||
| 539 | Ga0068871_100238128 | |||
| 540 | Ga0068871_100358745 | |||
| 541 | Ga0068871_100601407 | |||
| 542 | Ga0068865_100190810 | |||
| 543 | Ga0097620_100194804 | |||
| 544 | Ga0097620_101528020 | |||
| 545 | Ga0097620_102693390 | |||
| 546 | Ga0105240_10005874 | |||
| 547 | Ga0105240_10006779 | |||
| 548 | Ga0105240_10012536 | |||
| 549 | Ga0105240_10023716 | |||
| 550 | Ga0105240_10122705 | |||
| 551 | Ga0105240_10163033 | |||
| 552 | Ga0105240_10336646 | |||
| 553 | Ga0105240_10380608 | |||
| 554 | Ga0105240_10392377 | |||
| 555 | Ga0105240_10829080 | |||
| 556 | Ga0105245_10002575 | |||
| 557 | Ga0105245_10003483 | |||
| 558 | Ga0105245_10045844 | |||
| 559 | Ga0105245_10073092 | |||
| 560 | Ga0105245_11212572 | |||
| 561 | Ga0105245_11296448 | |||
| 562 | Ga0105247_10125501 | |||
| 563 | Ga0105243_10749207 | |||
| 564 | Ga0105243_12425192 | |||
| 565 | Ga0105241_10014587 | |||
| 566 | Ga0105241_10019387 | |||
| 567 | Ga0105241_10024154 | |||
| 568 | Ga0105241_10075394 | |||
| 569 | Ga0105241_10163409 | |||
| 570 | Ga0105241_10684837 | |||
| 571 | Ga0105242_10296049 | |||
| 572 | Ga0105242_10685433 | |||
| 573 | Ga0105242_10685698 | |||
| 574 | Ga0105242_10693503 | |||
| 575 | Ga0105242_10862926 | |||
| 576 | Ga0105242_11590122 | |||
| 577 | Ga0105242_12409273 | |||
| 578 | Ga0105248_10006675 | |||
| 579 | Ga0105248_10234020 | |||
| 580 | Ga0105248_10311289 | |||
| 581 | Ga0105248_10624063 | |||
| 582 | Ga0105248_10988726 | |||
| 583 | Ga0105248_11317340 | |||
| 584 | Ga0105237_10011489 | |||
| 585 | Ga0105237_10012851 | |||
| 586 | Ga0105237_10092996 | |||
| 587 | Ga0105237_10508635 | |||
| 588 | Ga0105237_10518533 | |||
| 589 | Ga0105237_10519767 | |||
| 590 | Ga0105237_10559898 | |||
| 591 | Ga0105237_11426094 | |||
| 592 | Ga0105237_11675070 | |||
| 593 | Ga0105238_10001258 | |||
| 594 | Ga0105238_10002612 | |||
| 595 | Ga0105238_10014278 | |||
| 596 | Ga0105238_10038476 | |||
| 597 | Ga0105238_10039769 | |||
| 598 | Ga0105238_10423276 | |||
| 599 | Ga0105238_10428863 | |||
| 600 | Ga0105238_10440186 | |||
| 601 | Ga0105249_10022279 | |||
| 602 | Ga0105249_10834262 | |||
| 603 | Ga0105239_10001337 | |||
| 604 | Ga0105239_10036324 | |||
| 605 | Ga0105239_10054412 | |||
| 606 | Ga0105239_10317191 | |||
| 607 | Ga0105239_10421383 | |||
| 608 | Ga0105239_10430201 | |||
| 609 | Ga0105239_10614345 | |||
| 610 | Ga0105239_10995917 | |||
| 611 | Ga0105246_10005959 | |||
| 612 | Ga0105246_10598135 | |||
| 613 | Ga0105246_10764184 | |||
| 614 | Ga0157373_10169374 | |||
| 615 | Ga0157373_10268925 | |||
| 616 | Ga0157371_10030030 | |||
| 617 | Ga0157370_10101197 | |||
| 618 | Ga0157370_10528205 | |||
| 619 | Ga0157370_10914884 | |||
| 620 | Ga0157369_10002395 | |||
| 621 | Ga0157369_10006571 | |||
| 622 | Ga0157369_10014159 | |||
| 623 | Ga0157369_10207802 | |||
| 624 | Ga0157369_10357096 | |||
| 625 | Ga0157369_10390227 | |||
| 626 | Ga0157369_10581780 | |||
| 627 | Ga0157369_10729849 | |||
| 628 | Ga0157369_11539983 | |||
| 629 | Ga0157374_10067542 | |||
| 630 | Ga0157374_10208014 | |||
| 631 | Ga0157374_10324756 | |||
| 632 | Ga0157374_10644501 | |||
| 633 | Ga0157374_10734879 | |||
| 634 | Ga0157374_10840876 | |||
| 635 | Ga0157378_10028616 | |||
| 636 | Ga0157378_10108386 | |||
| 637 | Ga0157378_12157234 | |||
| 638 | Ga0163162_10831955 | |||
| 639 | Ga0163162_11441161 | |||
| 640 | Ga0157372_10002403 | |||
| 641 | Ga0157372_10017836 | |||
| 642 | Ga0157372_10026797 | |||
| 643 | Ga0157372_10130356 | |||
| 644 | Ga0157372_10172073 | |||
| 645 | Ga0157372_10204293 | |||
| 646 | Ga0157372_13110070 | |||
| 647 | Ga0157372_13213006 | |||
| 648 | Ga0157375_10006669 | |||
| 649 | Ga0163163_10016316 | |||
| 650 | Ga0163163_10039648 | |||
| 651 | Ga0163163_10054130 | |||
| 652 | Ga0163163_10071473 | |||
| 653 | Ga0163163_10297176 | |||
| 654 | Ga0157377_10438393 | |||
| 655 | Ga0157379_11042940 | |||
| 656 | Ga0157379_12267329 | |||
| 657 | Ga0157376_10098953 | |||
| 658 | Ga0157376_10352610 | |||
| 659 | Ga0157376_11420888 | |||
| 660 | Ga0213874_10238442 | |||
| 661 | Ga0207692_10876782 | |||
| 662 | Ga0207699_10274615 | |||
| 663 | Ga0207699_10400674 | |||
| 664 | Ga0207699_10783678 | |||
| 665 | Ga0207699_11262745 | |||
| 666 | Ga0207705_10433117 | |||
| 667 | Ga0207654_10008855 | |||
| 668 | Ga0207654_10054823 | |||
| 669 | Ga0207654_10091578 | |||
| 670 | Ga0207654_10149131 | |||
| 671 | Ga0207654_10151350 | |||
| 672 | Ga0207654_10564766 | |||
| 673 | Ga0207707_10000358 | |||
| 674 | Ga0207695_10000391 | |||
| 675 | Ga0207695_10001641 | |||
| 676 | Ga0207695_10002536 | |||
| 677 | Ga0207695_10012400 | |||
| 678 | Ga0207695_10063270 | |||
| 679 | Ga0207695_10289229 | |||
| 680 | Ga0207695_10582398 | |||
| 681 | Ga0207671_10007423 | |||
| 682 | Ga0207671_10016667 | |||
| 683 | Ga0207671_10101307 | |||
| 684 | Ga0207671_10335533 | |||
| 685 | Ga0207663_10150773 | |||
| 686 | Ga0207663_11061545 | |||
| 687 | Ga0207663_11365978 | |||
| 688 | Ga0207660_10463537 | |||
| 689 | Ga0207649_10010518 | |||
| 690 | Ga0207649_11484351 | |||
| 691 | Ga0207652_10006494 | |||
| 692 | Ga0207694_10002026 | |||
| 693 | Ga0207694_10004929 | |||
| 694 | Ga0207694_10006394 | |||
| 695 | Ga0207694_10059411 | |||
| 696 | Ga0207694_10521965 | |||
| 697 | Ga0207687_10002516 | |||
| 698 | Ga0207687_10005222 | |||
| 699 | Ga0207687_10020350 | |||
| 700 | Ga0207687_10787659 | |||
| 701 | Ga0207687_11760389 | |||
| 702 | Ga0207700_10001996 | |||
| 703 | Ga0207700_10120196 | |||
| 704 | Ga0207700_10919291 | |||
| 705 | Ga0207664_10793939 | |||
| 706 | Ga0207664_11013647 | |||
| 707 | Ga0207664_11343964 | |||
| 708 | Ga0207644_10387373 | |||
| 709 | Ga0207690_10370219 | |||
| 710 | Ga0207706_10070769 | |||
| 711 | Ga0207686_10391372 | |||
| 712 | Ga0207686_11506298 | |||
| 713 | Ga0207709_10126906 | |||
| 714 | Ga0207670_10150575 | |||
| 715 | Ga0207670_10182178 | |||
| 716 | Ga0207704_10026244 | |||
| 717 | Ga0207704_10197770 | |||
| 718 | Ga0207711_10014389 | |||
| 719 | Ga0207711_10024201 | |||
| 720 | Ga0207711_10546370 | |||
| 721 | Ga0207711_10689698 | |||
| 722 | Ga0207711_11519145 | |||
| 723 | Ga0207689_10254628 | |||
| 724 | Ga0207689_10317367 | |||
| 725 | Ga0207661_10165092 | |||
| 726 | Ga0207661_10232549 | |||
| 727 | Ga0207661_10391902 | |||
| 728 | Ga0207661_10485278 | |||
| 729 | Ga0207661_11275882 | |||
| 730 | Ga0207679_10217249 | |||
| 731 | Ga0207679_10578204 | |||
| 732 | Ga0207679_11649870 | |||
| 733 | Ga0207667_10003586 | |||
| 734 | Ga0207667_10022222 | |||
| 735 | Ga0207667_10070244 | |||
| 736 | Ga0207667_10133346 | |||
| 737 | Ga0207667_10306186 | |||
| 738 | Ga0207651_10934354 | |||
| 739 | Ga0207651_11330211 | |||
| 740 | Ga0207712_10008449 | |||
| 741 | Ga0207640_10131277 | |||
| 742 | Ga0207640_10832598 | |||
| 743 | Ga0207658_11152252 | |||
| 744 | Ga0207677_10439030 | |||
| 745 | Ga0207677_10510658 | |||
| 746 | Ga0207639_10009595 | |||
| 747 | Ga0207639_10136148 | |||
| 748 | Ga0207639_10621738 | |||
| 749 | Ga0207702_10007348 | |||
| 750 | Ga0207702_10020491 | |||
| 751 | Ga0207702_10160844 | |||
| 752 | Ga0207702_10381446 | |||
| 753 | Ga0207702_10894598 | |||
| 754 | Ga0207702_10936887 | |||
| 755 | Ga0207702_11399291 | |||
| 756 | Ga0207641_10306768 | |||
| 757 | Ga0207648_10106979 | |||
| 758 | Ga0207648_11266408 | |||
| 759 | Ga0207676_10347315 | |||
| 760 | Ga0207674_10000241 | |||
| 761 | Ga0207674_10004046 | |||
| 762 | Ga0207674_10324684 | |||
| 763 | Ga0207674_10374367 | |||
| 764 | Ga0207683_10677485 | |||
| 765 | Ga0207698_10002591 | |||
| 766 | Ga0207698_10394957 | |||
| 767 | Ga0268266_10436811 | |||
| 768 | Ga0268264_10266898 | |||
| 769 | Ga0268264_10319098 | |||
| 770 | Ga0268264_11504739 | |||
| 771 | Ga0265762_1117474 | |||
| 772 | Ga0265760_10039630 | |||
| 773 | Ga0265330_10311206 | |||
| 774 | Ga0265332_10096973 | |||
| 775 | Ga0265340_10045823 | |||
| 776 | Ga0265331_10041952 | |||
| 777 | Ga0265316_10804844 | |||
| 778 | Ga0265313_10214845 | |||
| 779 | Ga0265314_10000463 | |||
| 780 | Ga0265314_10051692 | |||
| 781 | Ga0265342_10134825 | |||
| 782 | Ga0373934_0005466 | |||
| 783 | Ga0373934_0215554 | |||
| 784 | Ga0373954_0000757 | |||
| 785 | Ga0373954_0008404 | |||
| 786 | Ga0373931_0864585 | |||
| 787 | Ga0373935_0544985 | |||
| 788 | Ga0373935_1211947 | |||
| 789 | Ga0373927_0217937 | |||
| 790 | Ga0373927_0462790 | |||
| 791 | Ga0373933_0166209 | |||
| 792 | Ga0373947_0112371 | |||
| 793 | Ga0373947_0470206 | |||
| 794 | Ga0373947_0790492 | |||
| 795 | Ga0373937_0179377 | |||
| 796 | Ga0373937_0437190 | |||
| 797 | Ga0373937_0795307 | |||
| 798 | Ga0373937_0873524 | |||
| 799 | Ga0373937_1025905 | |||
| 800 | Ga0373937_1627680 | |||
| 801 | Ga0373925_0021881 | |||
| 802 | Ga0373925_0162705 | |||
| 803 | Ga0373925_0858774 | |||
| 804 | Ga0436365_0702052 | |||
| 805 | Ga0436363_1419486 | |||
| 806 | Ga0436362_1113886 | |||
| 807 | Ga0451839_0154637 | |||
| 808 | Ga0451839_1324718 | |||
| 809 | Ga0466969_0073068 | |||
| 810 | Ga0451576_0048397 | |||
| 811 | Ga0495592_0280726 | |||
| 812 | Ga0495592_0498678 | |||
| 813 | Ga0495592_0562317 | |||
| 814 | Ga0495651_0143421 | |||
| 815 | Ga0495651_0325229 | |||
| 816 | Ga0495580_0005200 | |||
| 817 | Ga0495580_0026664 | |||
| 818 | Ga0495580_0158510 | |||
| 819 | Ga0495580_0355505 | |||
| 820 | Ga0495580_0507985 | |||
| 821 | Ga0495580_0692460 | |||
| 822 | Ga0495582_0029614 | |||
| 823 | Ga0495582_0614786 | |||
| 824 | Ga0495582_0666690 | |||
| 825 | Ga0495639_0409449 | |||
| 826 | Ga0495639_0427747 | |||
| 827 | Ga0495664_0348981 | |||
| 828 | Ga0495594_0010377 | |||
| 829 | Ga0495594_0518370 | |||
| 830 | Ga0495618_0130311 | |||
| 831 | Ga0495618_0744336 | |||
| 832 | Ga0495628_0336470 | |||
| 833 | Ga0495630_0220016 | |||
| 834 | Ga0495652_0057810 | |||
| 835 | Ga0495652_0240840 | |||
| 836 | Ga0495665_0019032 | |||
| 837 | Ga0495665_0406840 | |||
| 838 | Ga0495586_0016929 | |||
| 839 | Ga0495586_0396748 | |||
| 840 | Ga0495587_0017125 | |||
| 841 | Ga0495587_0027976 | |||
| 842 | Ga0495587_0355390 | |||
| 843 | Ga0495587_0595557 | |||
| 844 | Ga0495587_0597149 | |||
| 845 | Ga0495645_0155432 | |||
| 846 | Ga0495645_0273426 | |||
| 847 | Ga0495645_0900351 | |||
| 848 | Ga0495667_0125536 | |||
| 849 | Ga0495667_0302612 | |||
| 850 | Ga0495667_0828327 | |||
| 851 | Ga0495634_0218334 | |||
| 852 | Ga0495599_0016327 | |||
| 853 | Ga0495599_0218528 | |||
| 854 | Ga0495599_0470030 | |||
| 855 | Ga0495599_0838159 | |||
| 856 | Ga0495623_0021541 | |||
| 857 | Ga0495623_0370879 | |||
| 858 | Ga0495646_0094106 | |||
| 859 | Ga0495646_0545891 | |||
| 860 | Ga0495613_0177001 | |||
| 861 | Ga0495624_0313820 | |||
| 862 | Ga0495624_0801266 | |||
| 863 | Ga0495600_0171353 | |||
| 864 | Ga0495600_0336148 | |||
| 865 | Ga0495604_0081609 | |||
| 866 | Ga0495604_0167507 | |||
| 867 | Ga0495604_0374908 | |||
| 868 | Ga0495674_0041087 | |||
| 869 | Ga0495674_0070416 | |||
| 870 | Ga0495674_0808265 | |||
| 871 | Ga0495674_1210807 | |||
| 872 | Ga0495680_0457238 | |||
| 873 | Ga0495675_0055821 | |||
| 874 | Ga0495675_0101994 | |||
| 875 | Ga0495675_0371825 | |||
| 876 | Ga0495684_0065908 | |||
| 877 | Ga0495684_0096979 | |||
| 878 | Ga0495684_0463702 | |||
| 879 | Ga0495593_0178650 | |||
| 880 | Ga0495602_0003454 | |||
| 881 | Ga0495602_0572794 | |||
| 882 | Ga0495602_1123533 | |||
| 883 | Ga0496102_0776990 | |||
| 884 | Ga0496104_0863910 | |||
| 885 | Ga0496104_1369100 | |||
| 886 | Ga0496114_1269261 | |||
| 887 | Ga0495601_0058365 | |||
| 888 | Ga0495619_0213377 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.8889 | 11 | 76 |
| 4lb5-assembly1.cif.gz_B | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.8794 | 11 | 76 |
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8741 | 7 | 77 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.867 | 7 | 77 |
| 4i7h-assembly1.cif.gz_A | structural basis for peroxide sensing and gene regulation by perr from streptococcus pyogenes | 0.8594 | 8 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9177 | 9 | 73 | 1.10.10.10 |
| 1saxB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9046 | 10 | 75 | 1.10.10.10 |
| 1sd4B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.902 | 11 | 74 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8989 | 11 | 75 | 1.10.10.10 |
| 1sd6A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8961 | 10 | 75 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A261F6A8-F1-model_v4 | Penicillinase repressor | 0.9034 | 10 | 84 |
GO:0003677
GO:0045892 |
| AF-A0A3D5P045-F1-model_v4 | BlaI/MecI/CopY family transcriptional regulator | 0.8774 | 1 | 86 |
GO:0003677
GO:0045892 |
| AF-A0A2E6LMD4-F1-model_v4 | TrmB family transcriptional regulator | 0.8717 | 7 | 106 |
GO:0003677
GO:0045892 |
| AF-A0A4Y3G2C0-F1-model_v4 | Cell division control protein 6 | 0.8625 | 9 | 78 |
GO:0006260
GO:0016887 GO:0051301 |
| AF-A0A1R1BFV5-F1-model_v4 | Transcriptional regulator | 0.8578 | 3 | 78 |
GO:0003677
GO:0045892 |