F443344

General Info

Members Datasets Scaffolds Average Seq Length
435 195 870 370

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10035706|Ga0207699_100357062
Length 363
Sequence LDLIFVRFIFVVIVAVACYVLQPFGLTPPVDAGVGAIIGVGVVLFELRLHRVSLKRLMGAAAGSVLGILGAYLFSLVIRNSIVPGHTQSFLQLMVMLLMAYIGLIVGANKGDLLNLSALGGIFGGEKQGRKYKVLDTSVIIDGRIADIAETGFLDGIIVIPQFVLRELQLVADSADSLKRNRGRRGLDILQRLQKVASLNIQIVEDDFPAIREVDLKLIELAKVYEGKIITNDFNLNKVAQLQGVEVLNINELANALKPIVLPGETMRVFILKEGKEYNQGVAYLDDGTMVVVDNARKMIGKNIDISVTSVLQTTAGKMIFGRWDERNAPRAEATRTVVVPSPAGPPVASESKKPVLAERPLE

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.67
Rhizosphere 93.1
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10035706 3300025906 Bacteria 2830
2 Ga0065712_10069449 3300005290 Bacteria 7258
3 Ga0065712_10136072 3300005290 Bacteria 1496
4 Ga0065715_10225375 3300005293 Bacteria 1255
5 Ga0070683_100030956 3300005329 Bacteria 4862
6 Ga0070683_100131546 3300005329 Bacteria 2368
7 Ga0070683_100301227 3300005329 Bacteria 1525
8 Ga0070670_100014015 3300005331 Bacteria 6874
9 Ga0068869_100032103 3300005334 Bacteria 3698
10 Ga0068869_100086004 3300005334 Bacteria 2356
11 Ga0070666_10012085 3300005335 Bacteria 5437
12 Ga0070680_100026470 3300005336 Bacteria 4639
13 Ga0070680_100067619 3300005336 Bacteria 2931
14 Ga0068868_100001829 3300005338 Bacteria 14624
15 Ga0068868_100006417 3300005338 Bacteria 8323
16 Ga0070660_100008804 3300005339 Bacteria 7071
17 Ga0070660_100062849 3300005339 Bacteria 2885
18 Ga0070668_100014335 3300005347 Bacteria 5923
19 Ga0070669_100027241 3300005353 Bacteria 4113
20 Ga0070671_100066466 3300005355 Unclassified 3005
21 Ga0070671_100122681 3300005355 Bacteria 2187
22 Ga0070659_100027191 3300005366 Bacteria 4405
23 Ga0070659_100035165 3300005366 Bacteria 3900
24 Ga0070709_10101089 3300005434 Unclassified 1921
25 Ga0070709_10249041 3300005434 Bacteria 1279
26 Ga0070714_100000856 3300005435 Bacteria 21568
27 Ga0070714_100021363 3300005435 Bacteria 5297
28 Ga0070714_100038458 3300005435 Bacteria 4022
29 Ga0070714_100182269 3300005435 Bacteria 1911
30 Ga0070713_100000808 3300005436 Bacteria 20075
31 Ga0070713_100040622 3300005436 Bacteria 3783
32 Ga0070710_10006944 3300005437 Bacteria 5461
33 Ga0070710_10011414 3300005437 Bacteria 4388
34 Ga0070710_10042897 3300005437 Bacteria 2503
35 Ga0070711_100001143 3300005439 Bacteria 14230
36 Ga0070711_100004546 3300005439 Bacteria 8205
37 Ga0070711_100017681 3300005439 Bacteria 4543
38 Ga0070711_100018938 3300005439 Bacteria 4405
39 Ga0070711_100040385 3300005439 Bacteria 3146
40 Ga0070711_100081145 3300005439 Unclassified 2311
41 Ga0070708_100000219 3300005445 Bacteria 42551
42 Ga0070708_100001614 3300005445 Bacteria 17288
43 Ga0070708_100098171 3300005445 Bacteria 2678
44 Ga0070678_100101564 3300005456 Bacteria 2230
45 Ga0070662_100000683 3300005457 Bacteria 20689
46 Ga0070681_10023124 3300005458 Bacteria 6251
47 Ga0070681_10242358 3300005458 Bacteria 1716
48 Ga0070681_10381365 3300005458 Bacteria 1320
49 Ga0068867_100008456 3300005459 Bacteria 7260
50 Ga0068867_100010934 3300005459 Bacteria 6400
51 Ga0070706_100023740 3300005467 Bacteria 5645
52 Ga0070706_100121460 3300005467 Bacteria 2435
53 Ga0070706_100160499 3300005467 Bacteria 2099
54 Ga0070707_100006391 3300005468 Bacteria 10955
55 Ga0070707_100007592 3300005468 Bacteria 10071
56 Ga0070707_100153847 3300005468 Bacteria 2240
57 Ga0070707_100186590 3300005468 Bacteria 2022
58 Ga0070707_100195762 3300005468 Bacteria 1970
59 Ga0070698_100002213 3300005471 Bacteria 21527
60 Ga0070698_100053184 3300005471 Bacteria 4116
61 Ga0070699_100001467 3300005518 Bacteria 21596
62 Ga0070699_100068157 3300005518 Bacteria 3089
63 Ga0070679_100060316 3300005530 Bacteria 3780
64 Ga0070679_100061089 3300005530 Bacteria 3756
65 Ga0070679_100093251 3300005530 Bacteria 2999
66 Ga0070684_100051274 3300005535 Bacteria 3584
67 Ga0070697_100000315 3300005536 Bacteria 38390
68 Ga0070697_100018975 3300005536 Bacteria 5426
69 Ga0070697_100027588 3300005536 Bacteria 4544
70 Ga0070697_100052889 3300005536 Bacteria 3300
71 Ga0070697_100098998 3300005536 Bacteria 2420
72 Ga0068853_100090761 3300005539 Bacteria 2685
73 Ga0068853_100116701 3300005539 Bacteria 2377
74 Ga0070695_100056427 3300005545 Bacteria 2535
75 Ga0070696_100012025 3300005546 Bacteria 5799
76 Ga0070693_100008506 3300005547 Bacteria 5066
77 Ga0070665_100003910 3300005548 Bacteria 15744
78 Ga0068855_100000731 3300005563 Bacteria 40322
79 Ga0068855_100005009 3300005563 Bacteria 16169
80 Ga0068855_100014042 3300005563 Bacteria 9654
81 Ga0068855_100205721 3300005563 Bacteria 2214
82 Ga0070664_100000087 3300005564 Bacteria 58652
83 Ga0070664_100026741 3300005564 Bacteria 4790
84 Ga0068857_100000022 3300005577 Bacteria 87864
85 Ga0068854_100004551 3300005578 Bacteria 8747
86 Ga0068854_100037373 3300005578 Bacteria 3408
87 Ga0068854_100051343 3300005578 Bacteria 2954
88 Ga0068854_100055916 3300005578 Bacteria 2843
89 Ga0068854_100121733 3300005578 Bacteria 1982
90 Ga0068856_100000739 3300005614 Bacteria 35433
91 Ga0068856_100002578 3300005614 Bacteria 18679
92 Ga0068856_100015299 3300005614 Bacteria 7414
93 Ga0068856_100023189 3300005614 Bacteria 6037
94 Ga0068856_100064840 3300005614 Bacteria 3610
95 Ga0068856_100219307 3300005614 Bacteria 1917
96 Ga0068852_100239878 3300005616 Bacteria 1732
97 Ga0068852_100264384 3300005616 Bacteria 1653
98 Ga0068859_100001880 3300005617 Bacteria 21381
99 Ga0068859_100016058 3300005617 Bacteria 7523
100 Ga0068864_100000346 3300005618 Bacteria 40844
101 Ga0068864_100004418 3300005618 Bacteria 11548
102 Ga0068861_100121589 3300005719 Bacteria 2107
103 Ga0068851_10023837 3300005834 Bacteria 2993
104 Ga0068870_10022148 3300005840 Bacteria 3119
105 Ga0068863_100069725 3300005841 Bacteria 3324
106 Ga0068863_100084664 3300005841 Bacteria 3005
107 Ga0068863_100103807 3300005841 Bacteria 2704
108 Ga0068858_100000464 3300005842 Bacteria 42303
109 Ga0068858_100030722 3300005842 Bacteria 4989
110 Ga0068858_100063836 3300005842 Bacteria 3407
111 Ga0068860_100011844 3300005843 Bacteria 8597
112 Ga0068860_100110787 3300005843 Bacteria 2624
113 Ga0068862_100022187 3300005844 Bacteria 5312
114 Ga0070717_10001093 3300006028 Bacteria 18235
115 Ga0070717_10001353 3300006028 Bacteria 16855
116 Ga0070717_10004714 3300006028 Bacteria 9907
117 Ga0070716_100001420 3300006173 Bacteria 10643
118 Ga0070716_100003987 3300006173 Bacteria 7009
119 Ga0070716_100008139 3300006173 Bacteria 5193
120 Ga0070716_100044135 3300006173 Bacteria 2496
121 Ga0070712_100000448 3300006175 Bacteria 23630
122 Ga0070712_100000900 3300006175 Bacteria 17798
123 Ga0070712_100009292 3300006175 Bacteria 6194
124 Ga0070712_100010664 3300006175 Bacteria 5802
125 Ga0070712_100312268 3300006175 Bacteria 1276
126 Ga0097621_100000431 3300006237 Bacteria 29219
127 Ga0097621_100000919 3300006237 Bacteria 20591
128 Ga0097621_100004707 3300006237 Bacteria 9536
129 Ga0097621_100019280 3300006237 Bacteria 5232
130 Ga0097621_100174825 3300006237 Bacteria 1853
131 Ga0068871_100000052 3300006358 Bacteria 64030
132 Ga0068871_100013066 3300006358 Bacteria 6156
133 Ga0068871_100031856 3300006358 Bacteria 4160
134 Ga0068871_100218609 3300006358 Bacteria 1650
135 Ga0068871_100243124 3300006358 Bacteria 1565
136 Ga0075431_100002965 3300006847 Bacteria 16418
137 Ga0075433_10007108 3300006852 Bacteria 8863
138 Ga0075433_10009910 3300006852 Bacteria 7639
139 Ga0075433_10072238 3300006852 Bacteria 3034
140 Ga0075433_10080888 3300006852 Bacteria 2864
141 Ga0075434_100000020 3300006871 Bacteria 72327
142 Ga0075434_100003692 3300006871 Bacteria 13672
143 Ga0075434_100033073 3300006871 Bacteria 5101
144 Ga0075434_100038303 3300006871 Bacteria 4749
145 Ga0075434_100071397 3300006871 Bacteria 3464
146 Ga0075434_100189102 3300006871 Bacteria 2079
147 Ga0075429_100068722 3300006880 Bacteria 3083
148 Ga0068865_100004197 3300006881 Bacteria 8683
149 Ga0075436_100002223 3300006914 Bacteria 13401
150 Ga0097620_100001880 3300006931 Bacteria 21381
151 Ga0097620_100016058 3300006931 Bacteria 7523
152 Ga0075435_100002129 3300007076 Bacteria 13037
153 Ga0075435_100072095 3300007076 Bacteria 2822
154 Ga0105240_10072458 3300009093 Unclassified 4257
155 Ga0105240_10233766 3300009093 Bacteria 2134
156 Ga0111539_10084297 3300009094 Bacteria 3737
157 Ga0105245_10018256 3300009098 Bacteria 6134
158 Ga0105245_10112429 3300009098 Bacteria 2534
159 Ga0114129_10000153 3300009147 Bacteria 73434
160 Ga0114129_10091452 3300009147 Bacteria 4216
161 Ga0114129_10127482 3300009147 Bacteria 3498
162 Ga0105241_10001940 3300009174 Bacteria 15654
163 Ga0105241_10043341 3300009174 Bacteria 3408
164 Ga0105241_10131781 3300009174 Unclassified 2025
165 Ga0105241_10171649 3300009174 Bacteria 1791
166 Ga0105242_10051466 3300009176 Bacteria 3356
167 Ga0105248_10025757 3300009177 Bacteria 6542
168 Ga0105248_10037308 3300009177 Bacteria 5437
169 Ga0105237_10004117 3300009545 Bacteria 16957
170 Ga0105237_10040547 3300009545 Bacteria 4695
171 Ga0105237_10084719 3300009545 Bacteria 3160
172 Ga0105238_10021811 3300009551 Bacteria 6524
173 Ga0105238_10045155 3300009551 Bacteria 4451
174 Ga0105238_10177143 3300009551 Bacteria 2109
175 Ga0105238_10296192 3300009551 Bacteria 1601
176 Ga0105249_10005707 3300009553 Bacteria 10763
177 Ga0105249_10221075 3300009553 Bacteria 1864
178 Ga0105239_10124777 3300010375 Unclassified 2861
179 Ga0105239_10185085 3300010375 Bacteria 2331
180 Ga0157373_10001268 3300013100 Bacteria 19302
181 Ga0157371_10014241 3300013102 Bacteria 6013
182 Ga0157370_10079017 3300013104 Bacteria 3098
183 Ga0157369_10045982 3300013105 Bacteria 4745
184 Ga0157369_10176142 3300013105 Bacteria 2252
185 Ga0157369_10191400 3300013105 Bacteria 2149
186 Ga0157374_10000592 3300013296 Bacteria 32031
187 Ga0157374_10041699 3300013296 Bacteria 4231
188 Ga0157374_10084240 3300013296 Bacteria 3022
189 Ga0157378_10000401 3300013297 Bacteria 42628
190 Ga0157378_10056950 3300013297 Bacteria 3484
191 Ga0163162_10054790 3300013306 Bacteria 4012
192 Ga0163162_10136722 3300013306 Bacteria 2562
193 Ga0157372_10000528 3300013307 Bacteria 42366
194 Ga0157372_10002399 3300013307 Bacteria 20289
195 Ga0157372_10002459 3300013307 Bacteria 20077
196 Ga0157372_10042003 3300013307 Bacteria 5056
197 Ga0157372_10049146 3300013307 Bacteria 4689
198 Ga0157372_10062823 3300013307 Bacteria 4162
199 Ga0157372_10287125 3300013307 Bacteria 1913
200 Ga0157372_10405071 3300013307 Bacteria 1589
201 Ga0157372_10539185 3300013307 Unclassified 1360
202 Ga0163163_10043316 3300014325 Bacteria 4413
203 Ga0163163_10132397 3300014325 Bacteria 2534
204 Ga0163163_10139715 3300014325 Bacteria 2464
205 Ga0163163_10278891 3300014325 Bacteria 1723
206 Ga0182008_10016851 3300014497 Bacteria 3792
207 Ga0157379_10010716 3300014968 Bacteria 7987
208 Ga0157379_10014817 3300014968 Bacteria 6837
209 Ga0157379_10082294 3300014968 Bacteria 2885
210 Ga0157376_10010779 3300014969 Bacteria 6707
211 Ga0157376_10016796 3300014969 Bacteria 5567
212 Ga0157376_10067158 3300014969 Bacteria 3033
213 Ga0182007_10011632 3300015262 Bacteria 3420
214 Ga0182005_1003173 3300015265 Bacteria 5630
215 Ga0206356_10839637 3300020070 Bacteria 1256
216 Ga0206352_10742175 3300020078 Bacteria 1295
217 Ga0154015_1637636 3300020610 Bacteria 1509
218 Ga0224712_10045167 3300022467 Bacteria 1684
219 Ga0224572_1010228 3300024225 Bacteria 1760
220 Ga0228598_1000130 3300024227 Bacteria 12770
221 Ga0228598_1003266 3300024227 Bacteria 3496
222 Ga0207692_10059450 3300025898 Bacteria 1974
223 Ga0207642_10064860 3300025899 Bacteria 1714
224 Ga0207685_10045729 3300025905 Bacteria 1662
225 Ga0207699_10004394 3300025906 Bacteria 6745
226 Ga0207699_10118964 3300025906 Unclassified 1705
227 Ga0207699_10133250 3300025906 Bacteria 1624
228 Ga0207645_10027307 3300025907 Bacteria 3687
229 Ga0207643_10028006 3300025908 Bacteria 3127
230 Ga0207684_10000395 3300025910 Bacteria 58309
231 Ga0207684_10005106 3300025910 Bacteria 12235
232 Ga0207684_10048466 3300025910 Bacteria 3603
233 Ga0207684_10133523 3300025910 Bacteria 2131
234 Ga0207684_10148461 3300025910 Bacteria 2017
235 Ga0207654_10004778 3300025911 Bacteria 6866
236 Ga0207654_10006191 3300025911 Bacteria 6015
237 Ga0207654_10027529 3300025911 Bacteria 3090
238 Ga0207654_10041755 3300025911 Bacteria 2592
239 Ga0207654_10162100 3300025911 Bacteria 1445
240 Ga0207707_10004586 3300025912 Bacteria 12139
241 Ga0207707_10005175 3300025912 Bacteria 11431
242 Ga0207707_10023013 3300025912 Bacteria 5450
243 Ga0207707_10025473 3300025912 Bacteria 5174
244 Ga0207707_10158126 3300025912 Bacteria 1981
245 Ga0207707_10188255 3300025912 Bacteria 1801
246 Ga0207707_10191853 3300025912 Bacteria 1782
247 Ga0207695_10049502 3300025913 Bacteria 4429
248 Ga0207695_10191351 3300025913 Bacteria 1963
249 Ga0207671_10016208 3300025914 Bacteria 5802
250 Ga0207671_10060972 3300025914 Bacteria 2799
251 Ga0207693_10000013 3300025915 Bacteria 154365
252 Ga0207693_10002869 3300025915 Bacteria 14933
253 Ga0207693_10006307 3300025915 Bacteria 9836
254 Ga0207693_10021469 3300025915 Bacteria 5130
255 Ga0207693_10050024 3300025915 Bacteria 3282
256 Ga0207663_10009792 3300025916 Bacteria 5074
257 Ga0207663_10015326 3300025916 Bacteria 4227
258 Ga0207663_10059042 3300025916 Bacteria 2425
259 Ga0207660_10045655 3300025917 Bacteria 3087
260 Ga0207657_10005781 3300025919 Bacteria 12894
261 Ga0207657_10028308 3300025919 Bacteria 5114
262 Ga0207649_10044632 3300025920 Bacteria 2715
263 Ga0207652_10015281 3300025921 Bacteria 6232
264 Ga0207652_10160489 3300025921 Bacteria 2015
265 Ga0207652_10174568 3300025921 Bacteria 1929
266 Ga0207652_10293892 3300025921 Bacteria 1466
267 Ga0207646_10000341 3300025922 Bacteria 63056
268 Ga0207646_10007817 3300025922 Bacteria 10806
269 Ga0207646_10113693 3300025922 Bacteria 2431
270 Ga0207681_10037610 3300025923 Bacteria 3200
271 Ga0207694_10002431 3300025924 Bacteria 15191
272 Ga0207650_10001063 3300025925 Bacteria 20425
273 Ga0207687_10020868 3300025927 Bacteria 4347
274 Ga0207700_10003942 3300025928 Bacteria 8678
275 Ga0207700_10013070 3300025928 Bacteria 5387
276 Ga0207700_10040985 3300025928 Bacteria 3384
277 Ga0207700_10066251 3300025928 Bacteria 2760
278 Ga0207700_10094016 3300025928 Bacteria 2374
279 Ga0207700_10154561 3300025928 Bacteria 1899
280 Ga0207664_10000201 3300025929 Bacteria 44962
281 Ga0207664_10016612 3300025929 Bacteria 5374
282 Ga0207664_10030931 3300025929 Bacteria 4091
283 Ga0207664_10031592 3300025929 Bacteria 4052
284 Ga0207664_10197648 3300025929 Bacteria 1734
285 Ga0207664_10197745 3300025929 Bacteria 1734
286 Ga0207664_10218382 3300025929 Bacteria 1652
287 Ga0207644_10023623 3300025931 Bacteria 4214
288 Ga0207706_10000108 3300025933 Bacteria 87903
289 Ga0207706_10209416 3300025933 Bacteria 1709
290 Ga0207670_10096384 3300025936 Bacteria 2103
291 Ga0207665_10006905 3300025939 Bacteria 7513
292 Ga0207665_10011353 3300025939 Bacteria 5849
293 Ga0207665_10014124 3300025939 Bacteria 5253
294 Ga0207665_10015539 3300025939 Bacteria 4996
295 Ga0207665_10049602 3300025939 Bacteria 2821
296 Ga0207711_10005528 3300025941 Bacteria 10689
297 Ga0207711_10034890 3300025941 Bacteria 4261
298 Ga0207689_10019302 3300025942 Bacteria 5746
299 Ga0207661_10082844 3300025944 Bacteria 2653
300 Ga0207679_10001484 3300025945 Bacteria 14693
301 Ga0207679_10172226 3300025945 Bacteria 1783
302 Ga0207667_10000252 3300025949 Bacteria 75421
303 Ga0207667_10000509 3300025949 Bacteria 51354
304 Ga0207667_10005045 3300025949 Bacteria 16122
305 Ga0207712_10043785 3300025961 Bacteria 3090
306 Ga0207668_10030552 3300025972 Bacteria 3541
307 Ga0207640_10002391 3300025981 Bacteria 10040
308 Ga0207677_10011657 3300026023 Bacteria 5018
309 Ga0207677_10034626 3300026023 Bacteria 3272
310 Ga0207677_10061835 3300026023 Bacteria 2595
311 Ga0207703_10001699 3300026035 Bacteria 19791
312 Ga0207703_10018112 3300026035 Bacteria 5501
313 Ga0207703_10053153 3300026035 Bacteria 3292
314 Ga0207639_10173275 3300026041 Bacteria 1829
315 Ga0207678_10000575 3300026067 Bacteria 33645
316 Ga0207678_10144602 3300026067 Bacteria 2030
317 Ga0207702_10000120 3300026078 Bacteria 91853
318 Ga0207702_10000375 3300026078 Bacteria 50994
319 Ga0207702_10008321 3300026078 Bacteria 8760
320 Ga0207702_10010527 3300026078 Bacteria 7733
321 Ga0207702_10023359 3300026078 Bacteria 5128
322 Ga0207702_10043036 3300026078 Bacteria 3790
323 Ga0207641_10081072 3300026088 Bacteria 2817
324 Ga0207676_10001493 3300026095 Bacteria 17281
325 Ga0207676_10029522 3300026095 Bacteria 4107
326 Ga0207676_10243162 3300026095 Bacteria 1616
327 Ga0207674_10000056 3300026116 Bacteria 113265
328 Ga0207674_10016331 3300026116 Bacteria 8132
329 Ga0207674_10043146 3300026116 Bacteria 4652
330 Ga0207674_10079800 3300026116 Bacteria 3276
331 Ga0207674_10208191 3300026116 Bacteria 1905
332 Ga0207674_10256556 3300026116 Bacteria 1695
333 Ga0207698_10011053 3300026142 Bacteria 5836
334 Ga0207698_10011275 3300026142 Bacteria 5788
335 Ga0207698_10047071 3300026142 Unclassified 3263
336 Ga0207698_10153036 3300026142 Bacteria 2005
337 Ga0207698_10346664 3300026142 Bacteria 1401
338 Ga0265354_1001610 3300028016 Bacteria 3156
339 Ga0268266_10078297 3300028379 Bacteria 2876
340 Ga0268265_10035723 3300028380 Bacteria 3634
341 Ga0268264_10242723 3300028381 Bacteria 1669
342 Ga0268264_10247724 3300028381 Unclassified 1654
343 Ga0265338_10019048 3300028800 Bacteria 7309
344 Ga0265762_1002173 3300030760 Bacteria 3552
345 Ga0265760_10004720 3300031090 Bacteria 3903
346 Ga0265760_10005270 3300031090 Bacteria 3706
347 Ga0265330_10014107 3300031235 Bacteria 3710
348 Ga0265332_10020768 3300031238 Bacteria 2901
349 Ga0265328_10009757 3300031239 Bacteria 3895
350 Ga0265325_10006583 3300031241 Bacteria 7037
351 Ga0265339_10005331 3300031249 Bacteria 8569
352 Ga0265339_10044084 3300031249 Bacteria 2462
353 Ga0265316_10073886 3300031344 Bacteria 2625
354 Ga0265316_10090234 3300031344 Bacteria 2338
355 Ga0265314_10004435 3300031711 Bacteria 13025
356 Ga0307416_100517766 3300032002 Bacteria 1260
357 Ga0373936_0058292 3300035113 Bacteria 1572
358 Ga0373954_0010638 3300035118 Bacteria 4063
359 Ga0373943_0102284 3300035170 Bacteria 1500
360 Ga0373931_0013767 3300035691 Bacteria 3943
361 Ga0373931_0040564 3300035691 Bacteria 2443
362 Ga0373931_0041955 3300035691 Unclassified 2405
363 Ga0373927_0062860 3300035695 Bacteria 2401
364 Ga0373937_0116217 3300036401 Bacteria 2491
365 Ga0373925_0006139 3300037068 Bacteria 8874
366 Ga0373925_0035199 3300037068 Bacteria 3694
367 Ga0395905_0019214 3300037471 Bacteria 6480
368 Ga0395905_0020273 3300037471 Bacteria 6300
369 Ga0395905_0100433 3300037471 Bacteria 2717
370 Ga0436365_1168273 3300039437 Unclassified 4169
371 Ga0436362_0352008 3300039453 Bacteria 11344
372 Ga0436362_0391382 3300039453 Bacteria 4141
373 Ga0466964_0061961 3300044706 Bacteria 1559
374 Ga0466957_0046431 3300044842 Bacteria 2637
375 Ga0466959_0000867 3300045049 Bacteria 17849
376 Ga0466967_0002817 3300045976 Bacteria 11027
377 Ga0495580_0000038 3300046472 Bacteria 71800
378 Ga0495580_0001504 3300046472 Bacteria 20499
379 Ga0495580_0027112 3300046472 Bacteria 4171
380 Ga0495580_0065514 3300046472 Bacteria 2544
381 Ga0495580_0147983 3300046472 Bacteria 1627
382 Ga0495665_0085019 3300046531 Bacteria 1663
383 Ga0495659_0003735 3300046664 Unclassified 4843
384 Ga0495604_0149056 3300047317 Bacteria 1664
385 Ga0495674_0020186 3300047319 Bacteria 6172
386 Ga0495680_0129247 3300047322 Bacteria 1858
387 Ga0496100_0012836 3300048903 Bacteria 4816
388 Ga0496101_0082803 3300048904 Bacteria 2374
389 Ga0496101_0107518 3300048904 Bacteria 2096
390 Ga0496102_0001356 3300048905 Bacteria 21921
391 Ga0496102_0042172 3300048905 Bacteria 4135
392 Ga0496102_0119659 3300048905 Bacteria 2459
393 Ga0496103_0001504 3300048906 Bacteria 15602
394 Ga0496103_0088370 3300048906 Bacteria 1954
395 Ga0496104_0041737 3300048907 Bacteria 4303
396 Ga0496104_0129807 3300048907 Unclassified 2421
397 Ga0496104_0181532 3300048907 Bacteria 2015
398 Ga0496104_0195419 3300048907 Bacteria 1935
399 Ga0496105_0053286 3300048908 Bacteria 3341
400 Ga0496106_0188647 3300048909 Unclassified 1638
401 Ga0496109_0023235 3300048912 Bacteria 5501
402 Ga0496109_0097121 3300048912 Bacteria 2730
403 Ga0496110_0027929 3300048913 Bacteria 4841
404 Ga0496111_0081422 3300048914 Bacteria 2363
405 Ga0496112_0015470 3300048915 Bacteria 7121
406 Ga0496112_0026626 3300048915 Bacteria 5569
407 Ga0496112_0076960 3300048915 Bacteria 3299
408 Ga0496112_0111266 3300048915 Bacteria 2709
409 Ga0496112_0309959 3300048915 Bacteria 1523
410 Ga0496112_0387375 3300048915 Bacteria 1338
411 Ga0496113_0020819 3300048916 Bacteria 4619
412 Ga0496113_0037931 3300048916 Bacteria 3540
413 Ga0496113_0244622 3300048916 Bacteria 1431
414 Ga0496114_0009186 3300048917 Bacteria 7839
415 Ga0496115_0046840 3300048918 Bacteria 3457
416 nmdc:mga05p37_15158_c1 3300050507 Bacteria 9256
417 nmdc:mga05p37_25868_c1 3300050507 Bacteria 7136
418 nmdc:mga06r32_20249_c1 3300050510 Bacteria 6122
419 nmdc:mga0n895_153_c1 3300050512 Bacteria 42630
420 nmdc:mga0n895_222504_c1 3300050512 Bacteria 1916
421 nmdc:mga0n895_41444_c1 3300050512 Bacteria 4477
422 nmdc:mga0n895_42095_c1 3300050512 Bacteria 4443
423 nmdc:mga0n895_6230_c1 3300050512 Bacteria 10098
424 nmdc:mga0n895_98870_c1 3300050512 Bacteria 2925
425 nmdc:mga0rr50_100_c1 3300050513 Bacteria 48322
426 nmdc:mga0rr50_81798_c1 3300050513 Bacteria 2493
427 nmdc:mga08x19_3709_c1 3300050514 Bacteria 9094
428 nmdc:mga08x19_45881_c1 3300050514 Bacteria 2793
429 nmdc:mga08x19_840_c1 3300050514 Bacteria 19484
430 nmdc:mga0a205_22423_c1 3300050515 Bacteria 5981
431 nmdc:mga0a205_34388_c1 3300050515 Bacteria 4862
432 nmdc:mga0a205_36396_c2 3300050515 Unclassified 2732
433 nmdc:mga0a205_37072_c1 3300050515 Bacteria 4688
434 nmdc:mga0a205_5445_c2 3300050515 Bacteria 10653
435 Ga0495619_0143950 3300053085 Bacteria 1643
436 Ga0207699_10035706
437 Ga0065712_10069449
438 Ga0065712_10136072
439 Ga0065715_10225375
440 Ga0070683_100030956
441 Ga0070683_100131546
442 Ga0070683_100301227
443 Ga0070670_100014015
444 Ga0068869_100032103
445 Ga0068869_100086004
446 Ga0070666_10012085
447 Ga0070680_100026470
448 Ga0070680_100067619
449 Ga0068868_100001829
450 Ga0068868_100006417
451 Ga0070660_100008804
452 Ga0070660_100062849
453 Ga0070668_100014335
454 Ga0070669_100027241
455 Ga0070671_100066466
456 Ga0070671_100122681
457 Ga0070659_100027191
458 Ga0070659_100035165
459 Ga0070709_10101089
460 Ga0070709_10249041
461 Ga0070714_100000856
462 Ga0070714_100021363
463 Ga0070714_100038458
464 Ga0070714_100182269
465 Ga0070713_100000808
466 Ga0070713_100040622
467 Ga0070710_10006944
468 Ga0070710_10011414
469 Ga0070710_10042897
470 Ga0070711_100001143
471 Ga0070711_100004546
472 Ga0070711_100017681
473 Ga0070711_100018938
474 Ga0070711_100040385
475 Ga0070711_100081145
476 Ga0070708_100000219
477 Ga0070708_100001614
478 Ga0070708_100098171
479 Ga0070678_100101564
480 Ga0070662_100000683
481 Ga0070681_10023124
482 Ga0070681_10242358
483 Ga0070681_10381365
484 Ga0068867_100008456
485 Ga0068867_100010934
486 Ga0070706_100023740
487 Ga0070706_100121460
488 Ga0070706_100160499
489 Ga0070707_100006391
490 Ga0070707_100007592
491 Ga0070707_100153847
492 Ga0070707_100186590
493 Ga0070707_100195762
494 Ga0070698_100002213
495 Ga0070698_100053184
496 Ga0070699_100001467
497 Ga0070699_100068157
498 Ga0070679_100060316
499 Ga0070679_100061089
500 Ga0070679_100093251
501 Ga0070684_100051274
502 Ga0070697_100000315
503 Ga0070697_100018975
504 Ga0070697_100027588
505 Ga0070697_100052889
506 Ga0070697_100098998
507 Ga0068853_100090761
508 Ga0068853_100116701
509 Ga0070695_100056427
510 Ga0070696_100012025
511 Ga0070693_100008506
512 Ga0070665_100003910
513 Ga0068855_100000731
514 Ga0068855_100005009
515 Ga0068855_100014042
516 Ga0068855_100205721
517 Ga0070664_100000087
518 Ga0070664_100026741
519 Ga0068857_100000022
520 Ga0068854_100004551
521 Ga0068854_100037373
522 Ga0068854_100051343
523 Ga0068854_100055916
524 Ga0068854_100121733
525 Ga0068856_100000739
526 Ga0068856_100002578
527 Ga0068856_100015299
528 Ga0068856_100023189
529 Ga0068856_100064840
530 Ga0068856_100219307
531 Ga0068852_100239878
532 Ga0068852_100264384
533 Ga0068859_100001880
534 Ga0068859_100016058
535 Ga0068864_100000346
536 Ga0068864_100004418
537 Ga0068861_100121589
538 Ga0068851_10023837
539 Ga0068870_10022148
540 Ga0068863_100069725
541 Ga0068863_100084664
542 Ga0068863_100103807
543 Ga0068858_100000464
544 Ga0068858_100030722
545 Ga0068858_100063836
546 Ga0068860_100011844
547 Ga0068860_100110787
548 Ga0068862_100022187
549 Ga0070717_10001093
550 Ga0070717_10001353
551 Ga0070717_10004714
552 Ga0070716_100001420
553 Ga0070716_100003987
554 Ga0070716_100008139
555 Ga0070716_100044135
556 Ga0070712_100000448
557 Ga0070712_100000900
558 Ga0070712_100009292
559 Ga0070712_100010664
560 Ga0070712_100312268
561 Ga0097621_100000431
562 Ga0097621_100000919
563 Ga0097621_100004707
564 Ga0097621_100019280
565 Ga0097621_100174825
566 Ga0068871_100000052
567 Ga0068871_100013066
568 Ga0068871_100031856
569 Ga0068871_100218609
570 Ga0068871_100243124
571 Ga0075431_100002965
572 Ga0075433_10007108
573 Ga0075433_10009910
574 Ga0075433_10072238
575 Ga0075433_10080888
576 Ga0075434_100000020
577 Ga0075434_100003692
578 Ga0075434_100033073
579 Ga0075434_100038303
580 Ga0075434_100071397
581 Ga0075434_100189102
582 Ga0075429_100068722
583 Ga0068865_100004197
584 Ga0075436_100002223
585 Ga0097620_100001880
586 Ga0097620_100016058
587 Ga0075435_100002129
588 Ga0075435_100072095
589 Ga0105240_10072458
590 Ga0105240_10233766
591 Ga0111539_10084297
592 Ga0105245_10018256
593 Ga0105245_10112429
594 Ga0114129_10000153
595 Ga0114129_10091452
596 Ga0114129_10127482
597 Ga0105241_10001940
598 Ga0105241_10043341
599 Ga0105241_10131781
600 Ga0105241_10171649
601 Ga0105242_10051466
602 Ga0105248_10025757
603 Ga0105248_10037308
604 Ga0105237_10004117
605 Ga0105237_10040547
606 Ga0105237_10084719
607 Ga0105238_10021811
608 Ga0105238_10045155
609 Ga0105238_10177143
610 Ga0105238_10296192
611 Ga0105249_10005707
612 Ga0105249_10221075
613 Ga0105239_10124777
614 Ga0105239_10185085
615 Ga0157373_10001268
616 Ga0157371_10014241
617 Ga0157370_10079017
618 Ga0157369_10045982
619 Ga0157369_10176142
620 Ga0157369_10191400
621 Ga0157374_10000592
622 Ga0157374_10041699
623 Ga0157374_10084240
624 Ga0157378_10000401
625 Ga0157378_10056950
626 Ga0163162_10054790
627 Ga0163162_10136722
628 Ga0157372_10000528
629 Ga0157372_10002399
630 Ga0157372_10002459
631 Ga0157372_10042003
632 Ga0157372_10049146
633 Ga0157372_10062823
634 Ga0157372_10287125
635 Ga0157372_10405071
636 Ga0157372_10539185
637 Ga0163163_10043316
638 Ga0163163_10132397
639 Ga0163163_10139715
640 Ga0163163_10278891
641 Ga0182008_10016851
642 Ga0157379_10010716
643 Ga0157379_10014817
644 Ga0157379_10082294
645 Ga0157376_10010779
646 Ga0157376_10016796
647 Ga0157376_10067158
648 Ga0182007_10011632
649 Ga0182005_1003173
650 Ga0206356_10839637
651 Ga0206352_10742175
652 Ga0154015_1637636
653 Ga0224712_10045167
654 Ga0224572_1010228
655 Ga0228598_1000130
656 Ga0228598_1003266
657 Ga0207692_10059450
658 Ga0207642_10064860
659 Ga0207685_10045729
660 Ga0207699_10004394
661 Ga0207699_10118964
662 Ga0207699_10133250
663 Ga0207645_10027307
664 Ga0207643_10028006
665 Ga0207684_10000395
666 Ga0207684_10005106
667 Ga0207684_10048466
668 Ga0207684_10133523
669 Ga0207684_10148461
670 Ga0207654_10004778
671 Ga0207654_10006191
672 Ga0207654_10027529
673 Ga0207654_10041755
674 Ga0207654_10162100
675 Ga0207707_10004586
676 Ga0207707_10005175
677 Ga0207707_10023013
678 Ga0207707_10025473
679 Ga0207707_10158126
680 Ga0207707_10188255
681 Ga0207707_10191853
682 Ga0207695_10049502
683 Ga0207695_10191351
684 Ga0207671_10016208
685 Ga0207671_10060972
686 Ga0207693_10000013
687 Ga0207693_10002869
688 Ga0207693_10006307
689 Ga0207693_10021469
690 Ga0207693_10050024
691 Ga0207663_10009792
692 Ga0207663_10015326
693 Ga0207663_10059042
694 Ga0207660_10045655
695 Ga0207657_10005781
696 Ga0207657_10028308
697 Ga0207649_10044632
698 Ga0207652_10015281
699 Ga0207652_10160489
700 Ga0207652_10174568
701 Ga0207652_10293892
702 Ga0207646_10000341
703 Ga0207646_10007817
704 Ga0207646_10113693
705 Ga0207681_10037610
706 Ga0207694_10002431
707 Ga0207650_10001063
708 Ga0207687_10020868
709 Ga0207700_10003942
710 Ga0207700_10013070
711 Ga0207700_10040985
712 Ga0207700_10066251
713 Ga0207700_10094016
714 Ga0207700_10154561
715 Ga0207664_10000201
716 Ga0207664_10016612
717 Ga0207664_10030931
718 Ga0207664_10031592
719 Ga0207664_10197648
720 Ga0207664_10197745
721 Ga0207664_10218382
722 Ga0207644_10023623
723 Ga0207706_10000108
724 Ga0207706_10209416
725 Ga0207670_10096384
726 Ga0207665_10006905
727 Ga0207665_10011353
728 Ga0207665_10014124
729 Ga0207665_10015539
730 Ga0207665_10049602
731 Ga0207711_10005528
732 Ga0207711_10034890
733 Ga0207689_10019302
734 Ga0207661_10082844
735 Ga0207679_10001484
736 Ga0207679_10172226
737 Ga0207667_10000252
738 Ga0207667_10000509
739 Ga0207667_10005045
740 Ga0207712_10043785
741 Ga0207668_10030552
742 Ga0207640_10002391
743 Ga0207677_10011657
744 Ga0207677_10034626
745 Ga0207677_10061835
746 Ga0207703_10001699
747 Ga0207703_10018112
748 Ga0207703_10053153
749 Ga0207639_10173275
750 Ga0207678_10000575
751 Ga0207678_10144602
752 Ga0207702_10000120
753 Ga0207702_10000375
754 Ga0207702_10008321
755 Ga0207702_10010527
756 Ga0207702_10023359
757 Ga0207702_10043036
758 Ga0207641_10081072
759 Ga0207676_10001493
760 Ga0207676_10029522
761 Ga0207676_10243162
762 Ga0207674_10000056
763 Ga0207674_10016331
764 Ga0207674_10043146
765 Ga0207674_10079800
766 Ga0207674_10208191
767 Ga0207674_10256556
768 Ga0207698_10011053
769 Ga0207698_10011275
770 Ga0207698_10047071
771 Ga0207698_10153036
772 Ga0207698_10346664
773 Ga0265354_1001610
774 Ga0268266_10078297
775 Ga0268265_10035723
776 Ga0268264_10242723
777 Ga0268264_10247724
778 Ga0265338_10019048
779 Ga0265762_1002173
780 Ga0265760_10004720
781 Ga0265760_10005270
782 Ga0265330_10014107
783 Ga0265332_10020768
784 Ga0265328_10009757
785 Ga0265325_10006583
786 Ga0265339_10005331
787 Ga0265339_10044084
788 Ga0265316_10073886
789 Ga0265316_10090234
790 Ga0265314_10004435
791 Ga0307416_100517766
792 Ga0373936_0058292
793 Ga0373954_0010638
794 Ga0373943_0102284
795 Ga0373931_0013767
796 Ga0373931_0040564
797 Ga0373931_0041955
798 Ga0373927_0062860
799 Ga0373937_0116217
800 Ga0373925_0006139
801 Ga0373925_0035199
802 Ga0395905_0019214
803 Ga0395905_0020273
804 Ga0395905_0100433
805 Ga0436365_1168273
806 Ga0436362_0352008
807 Ga0436362_0391382
808 Ga0466964_0061961
809 Ga0466957_0046431
810 Ga0466959_0000867
811 Ga0466967_0002817
812 Ga0495580_0000038
813 Ga0495580_0001504
814 Ga0495580_0027112
815 Ga0495580_0065514
816 Ga0495580_0147983
817 Ga0495665_0085019
818 Ga0495659_0003735
819 Ga0495604_0149056
820 Ga0495674_0020186
821 Ga0495680_0129247
822 Ga0496100_0012836
823 Ga0496101_0082803
824 Ga0496101_0107518
825 Ga0496102_0001356
826 Ga0496102_0042172
827 Ga0496102_0119659
828 Ga0496103_0001504
829 Ga0496103_0088370
830 Ga0496104_0041737
831 Ga0496104_0129807
832 Ga0496104_0181532
833 Ga0496104_0195419
834 Ga0496105_0053286
835 Ga0496106_0188647
836 Ga0496109_0023235
837 Ga0496109_0097121
838 Ga0496110_0027929
839 Ga0496111_0081422
840 Ga0496112_0015470
841 Ga0496112_0026626
842 Ga0496112_0076960
843 Ga0496112_0111266
844 Ga0496112_0309959
845 Ga0496112_0387375
846 Ga0496113_0020819
847 Ga0496113_0037931
848 Ga0496113_0244622
849 Ga0496114_0009186
850 Ga0496115_0046840
851 nmdc:mga05p37_15158_c1
852 nmdc:mga05p37_25868_c1
853 nmdc:mga06r32_20249_c1
854 nmdc:mga0n895_153_c1
855 nmdc:mga0n895_222504_c1
856 nmdc:mga0n895_41444_c1
857 nmdc:mga0n895_42095_c1
858 nmdc:mga0n895_6230_c1
859 nmdc:mga0n895_98870_c1
860 nmdc:mga0rr50_100_c1
861 nmdc:mga0rr50_81798_c1
862 nmdc:mga08x19_3709_c1
863 nmdc:mga08x19_45881_c1
864 nmdc:mga08x19_840_c1
865 nmdc:mga0a205_22423_c1
866 nmdc:mga0a205_34388_c1
867 nmdc:mga0a205_36396_c2
868 nmdc:mga0a205_37072_c1
869 nmdc:mga0a205_5445_c2
870 Ga0495619_0143950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

133

242

0.92

PF01938

TRAM

TRAM domain

261

317

0.89

Map