F442847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 433 | 169 | 866 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10003295|Ga0157376_100032953 |
| Length | 177 |
| Sequence | MPDISTIPHQLDEKKGTCRAIIETPKGFRNKFDFDPDSNLFMLGGLLPEGMMFPFDFGFVPSTLGEDGDPLDILVLPAHVGCLIEVRLIGIINAQQTEGGKTETNDRLLGVAVHSYNHENLNSIEDMSKTVLDQLEAFFISYNKQRGKKFKVAGTGGPKKAIAFLKMGSKAQKNAKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 44 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 107 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 118 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 164 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.69 |
| Rhizosphere | 98.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157376_10003295 | 3300014969 | Bacteria | 11122 |
| 2 | Ga0070683_100003150 | 3300005329 | Bacteria | 13295 |
| 3 | Ga0070683_100017569 | 3300005329 | Bacteria | 6323 |
| 4 | Ga0070683_100109697 | 3300005329 | Bacteria | 2603 |
| 5 | Ga0070683_100761473 | 3300005329 | Bacteria | 928 |
| 6 | Ga0070670_100364138 | 3300005331 | Unclassified | 1272 |
| 7 | Ga0070670_100521500 | 3300005331 | Unclassified | 1058 |
| 8 | Ga0068869_100046068 | 3300005334 | Bacteria | 3143 |
| 9 | Ga0068869_100189404 | 3300005334 | Unclassified | 1617 |
| 10 | Ga0070666_10042991 | 3300005335 | Unclassified | 3024 |
| 11 | Ga0070666_10113592 | 3300005335 | Bacteria | 1874 |
| 12 | Ga0070666_10141443 | 3300005335 | Bacteria | 1676 |
| 13 | Ga0070680_100315314 | 3300005336 | Bacteria | 1327 |
| 14 | Ga0070680_101064886 | 3300005336 | Bacteria | 699 |
| 15 | Ga0068868_100037704 | 3300005338 | Bacteria | 3749 |
| 16 | Ga0068868_100174274 | 3300005338 | Bacteria | 1782 |
| 17 | Ga0068868_100247736 | 3300005338 | Bacteria | 1499 |
| 18 | Ga0068868_100852347 | 3300005338 | Unclassified | 825 |
| 19 | Ga0068868_100949287 | 3300005338 | Unclassified | 784 |
| 20 | Ga0070660_100239950 | 3300005339 | Unclassified | 1476 |
| 21 | Ga0070661_100316872 | 3300005344 | Unclassified | 1217 |
| 22 | Ga0070661_100880524 | 3300005344 | Unclassified | 738 |
| 23 | Ga0070675_100230025 | 3300005354 | Unclassified | 1617 |
| 24 | Ga0070675_101554443 | 3300005354 | Unclassified | 610 |
| 25 | Ga0070671_100141778 | 3300005355 | Bacteria | 2028 |
| 26 | Ga0070671_100564809 | 3300005355 | Unclassified | 982 |
| 27 | Ga0070673_100171127 | 3300005364 | Unclassified | 1854 |
| 28 | Ga0070667_100085640 | 3300005367 | Unclassified | 2703 |
| 29 | Ga0070709_10234347 | 3300005434 | Bacteria | 1315 |
| 30 | Ga0070709_10665780 | 3300005434 | Unclassified | 807 |
| 31 | Ga0070709_10846949 | 3300005434 | Unclassified | 720 |
| 32 | Ga0070714_100002047 | 3300005435 | Bacteria | 14773 |
| 33 | Ga0070713_100005193 | 3300005436 | Bacteria | 8866 |
| 34 | Ga0070713_100039683 | 3300005436 | Bacteria | 3823 |
| 35 | Ga0070713_100045410 | 3300005436 | Bacteria | 3600 |
| 36 | Ga0070713_100840738 | 3300005436 | Bacteria | 881 |
| 37 | Ga0070710_10634373 | 3300005437 | Unclassified | 747 |
| 38 | Ga0070711_100051407 | 3300005439 | Bacteria | 2830 |
| 39 | Ga0070711_100400382 | 3300005439 | Unclassified | 1114 |
| 40 | Ga0070708_100230128 | 3300005445 | Bacteria | 1739 |
| 41 | Ga0070681_10005895 | 3300005458 | Bacteria | 11864 |
| 42 | Ga0070681_10245571 | 3300005458 | Bacteria | 1703 |
| 43 | Ga0070706_101078890 | 3300005467 | Unclassified | 739 |
| 44 | Ga0070698_100295890 | 3300005471 | Bacteria | 1550 |
| 45 | Ga0070679_100042822 | 3300005530 | Bacteria | 4509 |
| 46 | Ga0070684_100042911 | 3300005535 | Bacteria | 3906 |
| 47 | Ga0070684_100313395 | 3300005535 | Bacteria | 1441 |
| 48 | Ga0070684_100639760 | 3300005535 | Bacteria | 990 |
| 49 | Ga0070697_100195228 | 3300005536 | Bacteria | 1719 |
| 50 | Ga0070697_100446168 | 3300005536 | Bacteria | 1127 |
| 51 | Ga0070697_100753330 | 3300005536 | Unclassified | 861 |
| 52 | Ga0068853_100603741 | 3300005539 | Unclassified | 1042 |
| 53 | Ga0070665_100111825 | 3300005548 | Bacteria | 2734 |
| 54 | Ga0068855_100019988 | 3300005563 | Bacteria | 8043 |
| 55 | Ga0068855_100028178 | 3300005563 | Bacteria | 6719 |
| 56 | Ga0068855_100029521 | 3300005563 | Bacteria | 6553 |
| 57 | Ga0068855_100067452 | 3300005563 | Bacteria | 4167 |
| 58 | Ga0068855_100514656 | 3300005563 | Bacteria | 1299 |
| 59 | Ga0070664_100021458 | 3300005564 | Bacteria | 5323 |
| 60 | Ga0068857_100029975 | 3300005577 | Unclassified | 4801 |
| 61 | Ga0068857_100033801 | 3300005577 | Unclassified | 4522 |
| 62 | Ga0068857_100061431 | 3300005577 | Unclassified | 3338 |
| 63 | Ga0068856_100002189 | 3300005614 | Bacteria | 20283 |
| 64 | Ga0068856_100003485 | 3300005614 | Bacteria | 15879 |
| 65 | Ga0068856_100003899 | 3300005614 | Bacteria | 14959 |
| 66 | Ga0068856_100177744 | 3300005614 | Unclassified | 2141 |
| 67 | Ga0068856_100832722 | 3300005614 | Unclassified | 942 |
| 68 | Ga0068852_100295973 | 3300005616 | Unclassified | 1565 |
| 69 | Ga0068859_100333421 | 3300005617 | Unclassified | 1611 |
| 70 | Ga0068859_100530509 | 3300005617 | Unclassified | 1272 |
| 71 | Ga0068859_100637750 | 3300005617 | Bacteria | 1158 |
| 72 | Ga0068859_100740260 | 3300005617 | Unclassified | 1072 |
| 73 | Ga0068864_100005324 | 3300005618 | Bacteria | 10540 |
| 74 | Ga0068864_100182737 | 3300005618 | Bacteria | 1918 |
| 75 | Ga0068864_100245618 | 3300005618 | Unclassified | 1660 |
| 76 | Ga0068861_100609610 | 3300005719 | Unclassified | 1003 |
| 77 | Ga0068863_100014697 | 3300005841 | Bacteria | 7534 |
| 78 | Ga0068863_100055883 | 3300005841 | Bacteria | 3738 |
| 79 | Ga0068863_100109419 | 3300005841 | Unclassified | 2631 |
| 80 | Ga0068863_100208743 | 3300005841 | Bacteria | 1880 |
| 81 | Ga0068863_100403369 | 3300005841 | Unclassified | 1337 |
| 82 | Ga0068858_100007194 | 3300005842 | Bacteria | 10791 |
| 83 | Ga0068858_100025665 | 3300005842 | Bacteria | 5483 |
| 84 | Ga0068858_100084438 | 3300005842 | Bacteria | 2953 |
| 85 | Ga0068858_101058207 | 3300005842 | Unclassified | 796 |
| 86 | Ga0068860_100039459 | 3300005843 | Unclassified | 4516 |
| 87 | Ga0070717_10038570 | 3300006028 | Bacteria | 3884 |
| 88 | Ga0070717_10131036 | 3300006028 | Bacteria | 2156 |
| 89 | Ga0070717_10245854 | 3300006028 | Bacteria | 1579 |
| 90 | Ga0070717_10337469 | 3300006028 | Bacteria | 1345 |
| 91 | Ga0097621_100003496 | 3300006237 | Bacteria | 10842 |
| 92 | Ga0097621_100065098 | 3300006237 | Bacteria | 2999 |
| 93 | Ga0097621_100096768 | 3300006237 | Unclassified | 2477 |
| 94 | Ga0097621_100150164 | 3300006237 | Bacteria | 1998 |
| 95 | Ga0097621_101072773 | 3300006237 | Unclassified | 755 |
| 96 | Ga0068871_100023914 | 3300006358 | Bacteria | 4734 |
| 97 | Ga0068871_100085886 | 3300006358 | Bacteria | 2614 |
| 98 | Ga0068871_100116675 | 3300006358 | Bacteria | 2251 |
| 99 | Ga0068871_100265216 | 3300006358 | Unclassified | 1499 |
| 100 | Ga0068871_100550407 | 3300006358 | Unclassified | 1045 |
| 101 | Ga0068871_100718818 | 3300006358 | Unclassified | 916 |
| 102 | Ga0068871_100845207 | 3300006358 | Unclassified | 846 |
| 103 | Ga0075434_100367304 | 3300006871 | Archaea | 1460 |
| 104 | Ga0075434_100926409 | 3300006871 | Bacteria | 886 |
| 105 | Ga0068865_100165924 | 3300006881 | Bacteria | 1689 |
| 106 | Ga0075436_100407114 | 3300006914 | Unclassified | 986 |
| 107 | Ga0097620_100333405 | 3300006931 | Unclassified | 1611 |
| 108 | Ga0097620_100530439 | 3300006931 | Unclassified | 1272 |
| 109 | Ga0097620_100637770 | 3300006931 | Bacteria | 1158 |
| 110 | Ga0097620_100740258 | 3300006931 | Unclassified | 1072 |
| 111 | Ga0105240_10003070 | 3300009093 | Bacteria | 26232 |
| 112 | Ga0105240_10006011 | 3300009093 | Bacteria | 17945 |
| 113 | Ga0105240_10029531 | 3300009093 | Bacteria | 7142 |
| 114 | Ga0105240_10071416 | 3300009093 | Bacteria | 4294 |
| 115 | Ga0105240_10077148 | 3300009093 | Bacteria | 4106 |
| 116 | Ga0105240_10207997 | 3300009093 | Bacteria | 2288 |
| 117 | Ga0105240_10359853 | 3300009093 | Unclassified | 1649 |
| 118 | Ga0105240_10528723 | 3300009093 | Bacteria | 1308 |
| 119 | Ga0105245_10029033 | 3300009098 | Bacteria | 4885 |
| 120 | Ga0105245_10050807 | 3300009098 | Unclassified | 3717 |
| 121 | Ga0105245_10170888 | 3300009098 | Bacteria | 2070 |
| 122 | Ga0105245_10178930 | 3300009098 | Unclassified | 2025 |
| 123 | Ga0105245_10225678 | 3300009098 | Bacteria | 1810 |
| 124 | Ga0105245_10349337 | 3300009098 | Bacteria | 1465 |
| 125 | Ga0105245_10359530 | 3300009098 | Bacteria | 1445 |
| 126 | Ga0105245_11689291 | 3300009098 | Unclassified | 685 |
| 127 | Ga0105247_10142085 | 3300009101 | Bacteria | 1574 |
| 128 | Ga0105247_10212526 | 3300009101 | Unclassified | 1305 |
| 129 | Ga0105247_10226109 | 3300009101 | Bacteria | 1269 |
| 130 | Ga0105247_10323512 | 3300009101 | Unclassified | 1077 |
| 131 | Ga0114129_10921037 | 3300009147 | Archaea | 1106 |
| 132 | Ga0105243_10693698 | 3300009148 | Unclassified | 992 |
| 133 | Ga0105241_10005788 | 3300009174 | Bacteria | 9124 |
| 134 | Ga0105241_10012616 | 3300009174 | Bacteria | 6200 |
| 135 | Ga0105241_10121364 | 3300009174 | Unclassified | 2105 |
| 136 | Ga0105241_10209532 | 3300009174 | Unclassified | 1632 |
| 137 | Ga0105241_10239444 | 3300009174 | Bacteria | 1533 |
| 138 | Ga0105241_10480281 | 3300009174 | Bacteria | 1104 |
| 139 | Ga0105241_10603048 | 3300009174 | Bacteria | 992 |
| 140 | Ga0105242_10010642 | 3300009176 | Bacteria | 7062 |
| 141 | Ga0105242_10015468 | 3300009176 | Bacteria | 5925 |
| 142 | Ga0105248_10020445 | 3300009177 | Bacteria | 7336 |
| 143 | Ga0105248_10023542 | 3300009177 | Bacteria | 6841 |
| 144 | Ga0105248_10142955 | 3300009177 | Unclassified | 2699 |
| 145 | Ga0105248_10269261 | 3300009177 | Bacteria | 1918 |
| 146 | Ga0105248_11314348 | 3300009177 | Unclassified | 818 |
| 147 | Ga0105237_10006298 | 3300009545 | Bacteria | 13196 |
| 148 | Ga0105237_10007075 | 3300009545 | Bacteria | 12338 |
| 149 | Ga0105237_10051992 | 3300009545 | Bacteria | 4114 |
| 150 | Ga0105238_10002822 | 3300009551 | Bacteria | 17338 |
| 151 | Ga0105238_10016038 | 3300009551 | Bacteria | 7577 |
| 152 | Ga0105238_10065775 | 3300009551 | Bacteria | 3626 |
| 153 | Ga0105238_10119404 | 3300009551 | Bacteria | 2617 |
| 154 | Ga0105238_10162055 | 3300009551 | Bacteria | 2212 |
| 155 | Ga0105238_10436190 | 3300009551 | Unclassified | 1306 |
| 156 | Ga0105239_10001134 | 3300010375 | Bacteria | 36735 |
| 157 | Ga0105239_10003715 | 3300010375 | Bacteria | 18581 |
| 158 | Ga0105239_10013336 | 3300010375 | Bacteria | 9132 |
| 159 | Ga0105239_10171585 | 3300010375 | Bacteria | 2425 |
| 160 | Ga0105239_10300182 | 3300010375 | Bacteria | 1809 |
| 161 | Ga0105239_10328955 | 3300010375 | Bacteria | 1724 |
| 162 | Ga0105239_10505237 | 3300010375 | Unclassified | 1374 |
| 163 | Ga0105239_10712065 | 3300010375 | Unclassified | 1148 |
| 164 | Ga0105246_10009373 | 3300011119 | Bacteria | 6032 |
| 165 | Ga0105246_10643448 | 3300011119 | Bacteria | 922 |
| 166 | Ga0157370_10025552 | 3300013104 | Bacteria | 5846 |
| 167 | Ga0157370_10307803 | 3300013104 | Unclassified | 1462 |
| 168 | Ga0157369_10002040 | 3300013105 | Bacteria | 24347 |
| 169 | Ga0157369_10068309 | 3300013105 | Bacteria | 3818 |
| 170 | Ga0157369_10868325 | 3300013105 | Bacteria | 926 |
| 171 | Ga0157374_10088712 | 3300013296 | Bacteria | 2946 |
| 172 | Ga0157374_10144248 | 3300013296 | Unclassified | 2312 |
| 173 | Ga0157374_10279905 | 3300013296 | Unclassified | 1647 |
| 174 | Ga0157374_10797093 | 3300013296 | Bacteria | 960 |
| 175 | Ga0157374_11302757 | 3300013296 | Unclassified | 748 |
| 176 | Ga0157374_11560244 | 3300013296 | Unclassified | 684 |
| 177 | Ga0157378_10002179 | 3300013297 | Bacteria | 17362 |
| 178 | Ga0157378_10777762 | 3300013297 | Unclassified | 982 |
| 179 | Ga0163162_10061997 | 3300013306 | Bacteria | 3779 |
| 180 | Ga0163162_10490666 | 3300013306 | Bacteria | 1359 |
| 181 | Ga0163162_10712932 | 3300013306 | Bacteria | 1124 |
| 182 | Ga0163162_10843208 | 3300013306 | Bacteria | 1032 |
| 183 | Ga0163162_11048568 | 3300013306 | Bacteria | 923 |
| 184 | Ga0157372_10008283 | 3300013307 | Bacteria | 11054 |
| 185 | Ga0157372_10009581 | 3300013307 | Bacteria | 10296 |
| 186 | Ga0157372_10780492 | 3300013307 | Bacteria | 1110 |
| 187 | Ga0157375_10012141 | 3300013308 | Bacteria | 7633 |
| 188 | Ga0157375_10028063 | 3300013308 | Bacteria | 5271 |
| 189 | Ga0157375_10281466 | 3300013308 | Unclassified | 1826 |
| 190 | Ga0157375_10316108 | 3300013308 | Bacteria | 1726 |
| 191 | Ga0157375_10712847 | 3300013308 | Bacteria | 1156 |
| 192 | Ga0163163_10008537 | 3300014325 | Bacteria | 9105 |
| 193 | Ga0163163_10011601 | 3300014325 | Bacteria | 8005 |
| 194 | Ga0163163_10066753 | 3300014325 | Unclassified | 3574 |
| 195 | Ga0163163_10105344 | 3300014325 | Unclassified | 2846 |
| 196 | Ga0163163_10111200 | 3300014325 | Unclassified | 2768 |
| 197 | Ga0163163_10283685 | 3300014325 | Unclassified | 1708 |
| 198 | Ga0163163_10344088 | 3300014325 | Unclassified | 1547 |
| 199 | Ga0163163_10400185 | 3300014325 | Unclassified | 1431 |
| 200 | Ga0163163_11902491 | 3300014325 | Unclassified | 655 |
| 201 | Ga0157377_10322897 | 3300014745 | Unclassified | 1026 |
| 202 | Ga0157377_10896655 | 3300014745 | Unclassified | 662 |
| 203 | Ga0157379_10047684 | 3300014968 | Bacteria | 3823 |
| 204 | Ga0157379_10671215 | 3300014968 | Unclassified | 971 |
| 205 | Ga0157379_10856869 | 3300014968 | Unclassified | 860 |
| 206 | Ga0157376_10277948 | 3300014969 | Bacteria | 1576 |
| 207 | Ga0157376_10316090 | 3300014969 | Unclassified | 1483 |
| 208 | Ga0157376_10513902 | 3300014969 | Bacteria | 1179 |
| 209 | Ga0157376_10863477 | 3300014969 | Bacteria | 921 |
| 210 | Ga0182007_10100291 | 3300015262 | Unclassified | 958 |
| 211 | Ga0207680_10019765 | 3300025903 | Unclassified | 3610 |
| 212 | Ga0207680_10230095 | 3300025903 | Bacteria | 1274 |
| 213 | Ga0207699_10425814 | 3300025906 | Bacteria | 949 |
| 214 | Ga0207699_10588242 | 3300025906 | Unclassified | 810 |
| 215 | Ga0207645_10308453 | 3300025907 | Unclassified | 1054 |
| 216 | Ga0207654_10003829 | 3300025911 | Bacteria | 7584 |
| 217 | Ga0207654_10030158 | 3300025911 | Bacteria | 2975 |
| 218 | Ga0207654_10216997 | 3300025911 | Unclassified | 1267 |
| 219 | Ga0207654_10642884 | 3300025911 | Bacteria | 759 |
| 220 | Ga0207654_10703244 | 3300025911 | Unclassified | 726 |
| 221 | Ga0207654_10742967 | 3300025911 | Bacteria | 706 |
| 222 | Ga0207707_10014368 | 3300025912 | Bacteria | 6897 |
| 223 | Ga0207707_10044440 | 3300025912 | Bacteria | 3874 |
| 224 | Ga0207695_10006818 | 3300025913 | Bacteria | 14715 |
| 225 | Ga0207695_10013215 | 3300025913 | Bacteria | 9852 |
| 226 | Ga0207695_10043860 | 3300025913 | Bacteria | 4761 |
| 227 | Ga0207695_10359329 | 3300025913 | Bacteria | 1343 |
| 228 | Ga0207695_10659780 | 3300025913 | Unclassified | 927 |
| 229 | Ga0207695_10811901 | 3300025913 | Unclassified | 815 |
| 230 | Ga0207695_10846533 | 3300025913 | Unclassified | 795 |
| 231 | Ga0207671_10060871 | 3300025914 | Bacteria | 2801 |
| 232 | Ga0207671_10100011 | 3300025914 | Bacteria | 2195 |
| 233 | Ga0207671_10384435 | 3300025914 | Bacteria | 1115 |
| 234 | Ga0207663_10018729 | 3300025916 | Bacteria | 3887 |
| 235 | Ga0207657_10227922 | 3300025919 | Unclassified | 1491 |
| 236 | Ga0207649_10103995 | 3300025920 | Bacteria | 1885 |
| 237 | Ga0207652_10039744 | 3300025921 | Bacteria | 3993 |
| 238 | Ga0207694_10043073 | 3300025924 | Bacteria | 3483 |
| 239 | Ga0207694_10047899 | 3300025924 | Unclassified | 3306 |
| 240 | Ga0207694_10601913 | 3300025924 | Unclassified | 924 |
| 241 | Ga0207694_11152153 | 3300025924 | Bacteria | 656 |
| 242 | Ga0207650_10319247 | 3300025925 | Unclassified | 1272 |
| 243 | Ga0207687_10036691 | 3300025927 | Bacteria | 3339 |
| 244 | Ga0207687_10106618 | 3300025927 | Bacteria | 2072 |
| 245 | Ga0207687_10118233 | 3300025927 | Bacteria | 1978 |
| 246 | Ga0207687_10321730 | 3300025927 | Bacteria | 1252 |
| 247 | Ga0207687_10595427 | 3300025927 | Bacteria | 931 |
| 248 | Ga0207700_10057644 | 3300025928 | Bacteria | 2930 |
| 249 | Ga0207700_10059978 | 3300025928 | Bacteria | 2879 |
| 250 | Ga0207664_10012648 | 3300025929 | Bacteria | 6037 |
| 251 | Ga0207664_11550836 | 3300025929 | Unclassified | 584 |
| 252 | Ga0207644_10215286 | 3300025931 | Bacteria | 1520 |
| 253 | Ga0207644_10664341 | 3300025931 | Unclassified | 868 |
| 254 | Ga0207706_11272428 | 3300025933 | Unclassified | 609 |
| 255 | Ga0207686_10009299 | 3300025934 | Bacteria | 5332 |
| 256 | Ga0207686_10009972 | 3300025934 | Bacteria | 5165 |
| 257 | Ga0207686_10092950 | 3300025934 | Bacteria | 1996 |
| 258 | Ga0207711_10057077 | 3300025941 | Bacteria | 3356 |
| 259 | Ga0207711_10119076 | 3300025941 | Unclassified | 2356 |
| 260 | Ga0207711_10182337 | 3300025941 | Bacteria | 1910 |
| 261 | Ga0207711_10193713 | 3300025941 | Unclassified | 1853 |
| 262 | Ga0207711_10322391 | 3300025941 | Bacteria | 1428 |
| 263 | Ga0207711_11239628 | 3300025941 | Unclassified | 688 |
| 264 | Ga0207689_10260259 | 3300025942 | Bacteria | 1435 |
| 265 | Ga0207689_10296308 | 3300025942 | Bacteria | 1340 |
| 266 | Ga0207661_10031154 | 3300025944 | Bacteria | 4116 |
| 267 | Ga0207661_10042629 | 3300025944 | Bacteria | 3578 |
| 268 | Ga0207661_10120974 | 3300025944 | Bacteria | 2229 |
| 269 | Ga0207661_10335234 | 3300025944 | Bacteria | 1362 |
| 270 | Ga0207679_10349786 | 3300025945 | Bacteria | 1288 |
| 271 | Ga0207667_10017068 | 3300025949 | Bacteria | 8186 |
| 272 | Ga0207667_10140130 | 3300025949 | Bacteria | 2490 |
| 273 | Ga0207667_10390063 | 3300025949 | Bacteria | 1418 |
| 274 | Ga0207667_10399233 | 3300025949 | Unclassified | 1400 |
| 275 | Ga0207667_10642671 | 3300025949 | Unclassified | 1067 |
| 276 | Ga0207667_10963514 | 3300025949 | Bacteria | 842 |
| 277 | Ga0207712_10229701 | 3300025961 | Bacteria | 1488 |
| 278 | Ga0207640_10028404 | 3300025981 | Bacteria | 3420 |
| 279 | Ga0207658_10073820 | 3300025986 | Unclassified | 2590 |
| 280 | Ga0207677_10188850 | 3300026023 | Bacteria | 1628 |
| 281 | Ga0207677_10191075 | 3300026023 | Bacteria | 1619 |
| 282 | Ga0207677_10238604 | 3300026023 | Unclassified | 1469 |
| 283 | Ga0207677_10522729 | 3300026023 | Bacteria | 1030 |
| 284 | Ga0207703_10009305 | 3300026035 | Bacteria | 7722 |
| 285 | Ga0207703_10027843 | 3300026035 | Bacteria | 4452 |
| 286 | Ga0207703_11012697 | 3300026035 | Unclassified | 797 |
| 287 | Ga0207702_10005068 | 3300026078 | Bacteria | 11574 |
| 288 | Ga0207702_10018379 | 3300026078 | Bacteria | 5785 |
| 289 | Ga0207702_10107968 | 3300026078 | Bacteria | 2469 |
| 290 | Ga0207702_10156683 | 3300026078 | Unclassified | 2077 |
| 291 | Ga0207702_10225101 | 3300026078 | Unclassified | 1750 |
| 292 | Ga0207702_10466857 | 3300026078 | Unclassified | 1227 |
| 293 | Ga0207702_11671271 | 3300026078 | Unclassified | 630 |
| 294 | Ga0207641_10010564 | 3300026088 | Bacteria | 7575 |
| 295 | Ga0207641_10057779 | 3300026088 | Bacteria | 3300 |
| 296 | Ga0207641_10275050 | 3300026088 | Bacteria | 1582 |
| 297 | Ga0207641_10421551 | 3300026088 | Unclassified | 1285 |
| 298 | Ga0207641_10442076 | 3300026088 | Unclassified | 1255 |
| 299 | Ga0207676_10043072 | 3300026095 | Unclassified | 3473 |
| 300 | Ga0207676_10113128 | 3300026095 | Bacteria | 2275 |
| 301 | Ga0207676_10213314 | 3300026095 | Bacteria | 1714 |
| 302 | Ga0207674_10001542 | 3300026116 | Bacteria | 29686 |
| 303 | Ga0207674_10100565 | 3300026116 | Unclassified | 2873 |
| 304 | Ga0207675_100955722 | 3300026118 | Unclassified | 874 |
| 305 | Ga0207675_101236628 | 3300026118 | Unclassified | 767 |
| 306 | Ga0207698_10054177 | 3300026142 | Bacteria | 3084 |
| 307 | Ga0207698_11397086 | 3300026142 | Bacteria | 715 |
| 308 | Ga0207698_11491285 | 3300026142 | Unclassified | 692 |
| 309 | Ga0207698_11563576 | 3300026142 | Bacteria | 675 |
| 310 | Ga0268266_10439101 | 3300028379 | Bacteria | 1239 |
| 311 | Ga0268264_10010879 | 3300028381 | Bacteria | 7518 |
| 312 | Ga0373926_0303480 | 3300035083 | Unclassified | 623 |
| 313 | Ga0373923_0130806 | 3300035111 | Bacteria | 1128 |
| 314 | Ga0373953_0281575 | 3300035117 | Unclassified | 725 |
| 315 | Ga0373954_0000691 | 3300035118 | Bacteria | 12930 |
| 316 | Ga0373954_0158226 | 3300035118 | Bacteria | 1108 |
| 317 | Ga0373956_0402477 | 3300035119 | Bacteria | 653 |
| 318 | Ga0373943_0478998 | 3300035170 | Unclassified | 725 |
| 319 | Ga0373946_0239555 | 3300035171 | Unclassified | 882 |
| 320 | Ga0373946_0341271 | 3300035171 | Unclassified | 747 |
| 321 | Ga0373955_0032897 | 3300035172 | Bacteria | 2727 |
| 322 | Ga0373955_0036969 | 3300035172 | Unclassified | 2595 |
| 323 | Ga0373955_0562288 | 3300035172 | Unclassified | 698 |
| 324 | Ga0373924_0117089 | 3300035410 | Bacteria | 1155 |
| 325 | Ga0373935_0143931 | 3300035692 | Bacteria | 1612 |
| 326 | Ga0373927_0031750 | 3300035695 | Unclassified | 3441 |
| 327 | Ga0373927_0233069 | 3300035695 | Bacteria | 1210 |
| 328 | Ga0373933_0796231 | 3300035724 | Unclassified | 622 |
| 329 | Ga0373947_0088213 | 3300035725 | Bacteria | 1930 |
| 330 | Ga0373947_0161927 | 3300035725 | Bacteria | 1448 |
| 331 | Ga0373937_0005673 | 3300036401 | Bacteria | 10713 |
| 332 | Ga0373937_0112679 | 3300036401 | Bacteria | 2530 |
| 333 | Ga0373937_0962680 | 3300036401 | Unclassified | 802 |
| 334 | Ga0373937_1299256 | 3300036401 | Bacteria | 675 |
| 335 | Ga0373937_1304504 | 3300036401 | Bacteria | 674 |
| 336 | Ga0265778_026521 | 3300036457 | Unclassified | 736 |
| 337 | Ga0373925_0142969 | 3300037068 | Bacteria | 1874 |
| 338 | Ga0373925_0175088 | 3300037068 | Bacteria | 1695 |
| 339 | Ga0373925_0230226 | 3300037068 | Bacteria | 1481 |
| 340 | Ga0373925_0713150 | 3300037068 | Unclassified | 827 |
| 341 | Ga0373925_0836664 | 3300037068 | Bacteria | 759 |
| 342 | Ga0436364_1099359 | 3300037853 | Bacteria | 6594 |
| 343 | Ga0436365_0177005 | 3300039437 | Bacteria | 653 |
| 344 | Ga0436363_0659200 | 3300039450 | Bacteria | 909 |
| 345 | Ga0436363_1112611 | 3300039450 | Unclassified | 570 |
| 346 | Ga0495592_0159145 | 3300046454 | Unclassified | 1555 |
| 347 | Ga0495603_0250861 | 3300046455 | Bacteria | 1019 |
| 348 | Ga0495603_0422288 | 3300046455 | Bacteria | 764 |
| 349 | Ga0495629_0031024 | 3300046459 | Bacteria | 3786 |
| 350 | Ga0495651_0409151 | 3300046462 | Unclassified | 884 |
| 351 | Ga0495580_0008865 | 3300046472 | Bacteria | 7958 |
| 352 | Ga0495580_0038515 | 3300046472 | Bacteria | 3424 |
| 353 | Ga0495580_0068436 | 3300046472 | Unclassified | 2483 |
| 354 | Ga0495580_0087147 | 3300046472 | Bacteria | 2175 |
| 355 | Ga0495580_0581615 | 3300046472 | Bacteria | 741 |
| 356 | Ga0495582_0490382 | 3300046473 | Bacteria | 710 |
| 357 | Ga0495662_0077502 | 3300046476 | Bacteria | 1614 |
| 358 | Ga0495664_0018282 | 3300046477 | Bacteria | 4013 |
| 359 | Ga0495664_0049449 | 3300046477 | Bacteria | 2496 |
| 360 | Ga0495664_0114934 | 3300046477 | Unclassified | 1626 |
| 361 | Ga0495664_0142671 | 3300046477 | Bacteria | 1452 |
| 362 | Ga0495664_0348421 | 3300046477 | Bacteria | 892 |
| 363 | Ga0495584_0419464 | 3300046491 | Bacteria | 680 |
| 364 | Ga0495594_0009287 | 3300046499 | Bacteria | 5079 |
| 365 | Ga0495594_0129106 | 3300046499 | Bacteria | 1431 |
| 366 | Ga0495608_0051424 | 3300046511 | Bacteria | 2731 |
| 367 | Ga0495618_0585693 | 3300046514 | Unclassified | 665 |
| 368 | Ga0495628_0205215 | 3300046516 | Bacteria | 1484 |
| 369 | Ga0495628_0267914 | 3300046516 | Bacteria | 1271 |
| 370 | Ga0495630_0114150 | 3300046517 | Bacteria | 2046 |
| 371 | Ga0495652_0042411 | 3300046529 | Bacteria | 3923 |
| 372 | Ga0495652_0201551 | 3300046529 | Unclassified | 1509 |
| 373 | Ga0495665_0388195 | 3300046531 | Bacteria | 709 |
| 374 | Ga0495640_0206851 | 3300046533 | Bacteria | 1242 |
| 375 | Ga0495640_0210682 | 3300046533 | Unclassified | 1229 |
| 376 | Ga0495586_0076218 | 3300046535 | Bacteria | 1837 |
| 377 | Ga0495587_0065659 | 3300046536 | Bacteria | 2118 |
| 378 | Ga0495587_0151037 | 3300046536 | Bacteria | 1324 |
| 379 | Ga0495645_0032186 | 3300046543 | Bacteria | 3825 |
| 380 | Ga0495645_0252265 | 3300046543 | Unclassified | 1172 |
| 381 | Ga0495667_0014735 | 3300046559 | Bacteria | 5283 |
| 382 | Ga0495667_0284928 | 3300046559 | Bacteria | 1048 |
| 383 | Ga0495634_0024795 | 3300046642 | Bacteria | 4204 |
| 384 | Ga0495634_0084522 | 3300046642 | Unclassified | 2069 |
| 385 | Ga0495634_0104035 | 3300046642 | Bacteria | 1832 |
| 386 | Ga0495635_0015329 | 3300046663 | Bacteria | 5361 |
| 387 | Ga0495635_0081883 | 3300046663 | Unclassified | 2209 |
| 388 | Ga0495635_0194901 | 3300046663 | Bacteria | 1375 |
| 389 | Ga0495635_0482178 | 3300046663 | Bacteria | 818 |
| 390 | Ga0495657_0342512 | 3300046675 | Unclassified | 886 |
| 391 | Ga0495657_0564944 | 3300046675 | Bacteria | 660 |
| 392 | Ga0495599_0015513 | 3300046678 | Bacteria | 4729 |
| 393 | Ga0495623_0086021 | 3300046679 | Bacteria | 1938 |
| 394 | Ga0495623_0113226 | 3300046679 | Bacteria | 1641 |
| 395 | Ga0495646_0056500 | 3300046680 | Bacteria | 2353 |
| 396 | Ga0495646_0060983 | 3300046680 | Unclassified | 2248 |
| 397 | Ga0495646_0295412 | 3300046680 | Bacteria | 858 |
| 398 | Ga0495647_0067777 | 3300046681 | Unclassified | 1422 |
| 399 | Ga0495613_0048500 | 3300046689 | Bacteria | 3136 |
| 400 | Ga0495613_0187063 | 3300046689 | Bacteria | 1465 |
| 401 | Ga0495600_0027991 | 3300046809 | Unclassified | 3645 |
| 402 | Ga0495600_0715711 | 3300046809 | Unclassified | 601 |
| 403 | Ga0495604_0111574 | 3300047317 | Bacteria | 1993 |
| 404 | Ga0495674_0024001 | 3300047319 | Bacteria | 5611 |
| 405 | Ga0495674_0038532 | 3300047319 | Bacteria | 4289 |
| 406 | Ga0495674_0064525 | 3300047319 | Unclassified | 3183 |
| 407 | Ga0495674_0094776 | 3300047319 | Bacteria | 2546 |
| 408 | Ga0495674_0151048 | 3300047319 | Bacteria | 1948 |
| 409 | Ga0495674_0191370 | 3300047319 | Unclassified | 1700 |
| 410 | Ga0495674_0702040 | 3300047319 | Unclassified | 794 |
| 411 | Ga0495676_0268424 | 3300047321 | Bacteria | 1159 |
| 412 | Ga0495676_0798907 | 3300047321 | Unclassified | 607 |
| 413 | Ga0495680_0022387 | 3300047322 | Bacteria | 5267 |
| 414 | Ga0495680_0054015 | 3300047322 | Unclassified | 3122 |
| 415 | Ga0495675_0243028 | 3300047444 | Bacteria | 1083 |
| 416 | Ga0495675_0605473 | 3300047444 | Archaea | 621 |
| 417 | Ga0495684_0007666 | 3300047471 | Bacteria | 8352 |
| 418 | Ga0495684_0010071 | 3300047471 | Bacteria | 7307 |
| 419 | Ga0495684_0018344 | 3300047471 | Bacteria | 5394 |
| 420 | Ga0495684_0052680 | 3300047471 | Unclassified | 3105 |
| 421 | Ga0495684_0189421 | 3300047471 | Bacteria | 1521 |
| 422 | Ga0495684_0256146 | 3300047471 | Unclassified | 1271 |
| 423 | Ga0495602_0179520 | 3300048088 | Bacteria | 1634 |
| 424 | Ga0495614_0120496 | 3300048089 | Bacteria | 1157 |
| 425 | Ga0496102_1278276 | 3300048905 | Unclassified | 653 |
| 426 | Ga0496115_0076423 | 3300048918 | Unclassified | 2722 |
| 427 | Ga0496115_0182583 | 3300048918 | Bacteria | 1734 |
| 428 | nmdc:mga05p37_311044_c1 | 3300050507 | Archaea | 1526 |
| 429 | nmdc:mga0n895_409124_c1 | 3300050512 | Archaea | 1372 |
| 430 | nmdc:mga08x19_616644_c1 | 3300050514 | Unclassified | 769 |
| 431 | Ga0495601_0034358 | 3300053077 | Unclassified | 3163 |
| 432 | Ga0495601_0157967 | 3300053077 | Unclassified | 1481 |
| 433 | Ga0495595_0101073 | 3300053084 | Bacteria | 1392 |
| 434 | Ga0157376_10003295 | |||
| 435 | Ga0070683_100003150 | |||
| 436 | Ga0070683_100017569 | |||
| 437 | Ga0070683_100109697 | |||
| 438 | Ga0070683_100761473 | |||
| 439 | Ga0070670_100364138 | |||
| 440 | Ga0070670_100521500 | |||
| 441 | Ga0068869_100046068 | |||
| 442 | Ga0068869_100189404 | |||
| 443 | Ga0070666_10042991 | |||
| 444 | Ga0070666_10113592 | |||
| 445 | Ga0070666_10141443 | |||
| 446 | Ga0070680_100315314 | |||
| 447 | Ga0070680_101064886 | |||
| 448 | Ga0068868_100037704 | |||
| 449 | Ga0068868_100174274 | |||
| 450 | Ga0068868_100247736 | |||
| 451 | Ga0068868_100852347 | |||
| 452 | Ga0068868_100949287 | |||
| 453 | Ga0070660_100239950 | |||
| 454 | Ga0070661_100316872 | |||
| 455 | Ga0070661_100880524 | |||
| 456 | Ga0070675_100230025 | |||
| 457 | Ga0070675_101554443 | |||
| 458 | Ga0070671_100141778 | |||
| 459 | Ga0070671_100564809 | |||
| 460 | Ga0070673_100171127 | |||
| 461 | Ga0070667_100085640 | |||
| 462 | Ga0070709_10234347 | |||
| 463 | Ga0070709_10665780 | |||
| 464 | Ga0070709_10846949 | |||
| 465 | Ga0070714_100002047 | |||
| 466 | Ga0070713_100005193 | |||
| 467 | Ga0070713_100039683 | |||
| 468 | Ga0070713_100045410 | |||
| 469 | Ga0070713_100840738 | |||
| 470 | Ga0070710_10634373 | |||
| 471 | Ga0070711_100051407 | |||
| 472 | Ga0070711_100400382 | |||
| 473 | Ga0070708_100230128 | |||
| 474 | Ga0070681_10005895 | |||
| 475 | Ga0070681_10245571 | |||
| 476 | Ga0070706_101078890 | |||
| 477 | Ga0070698_100295890 | |||
| 478 | Ga0070679_100042822 | |||
| 479 | Ga0070684_100042911 | |||
| 480 | Ga0070684_100313395 | |||
| 481 | Ga0070684_100639760 | |||
| 482 | Ga0070697_100195228 | |||
| 483 | Ga0070697_100446168 | |||
| 484 | Ga0070697_100753330 | |||
| 485 | Ga0068853_100603741 | |||
| 486 | Ga0070665_100111825 | |||
| 487 | Ga0068855_100019988 | |||
| 488 | Ga0068855_100028178 | |||
| 489 | Ga0068855_100029521 | |||
| 490 | Ga0068855_100067452 | |||
| 491 | Ga0068855_100514656 | |||
| 492 | Ga0070664_100021458 | |||
| 493 | Ga0068857_100029975 | |||
| 494 | Ga0068857_100033801 | |||
| 495 | Ga0068857_100061431 | |||
| 496 | Ga0068856_100002189 | |||
| 497 | Ga0068856_100003485 | |||
| 498 | Ga0068856_100003899 | |||
| 499 | Ga0068856_100177744 | |||
| 500 | Ga0068856_100832722 | |||
| 501 | Ga0068852_100295973 | |||
| 502 | Ga0068859_100333421 | |||
| 503 | Ga0068859_100530509 | |||
| 504 | Ga0068859_100637750 | |||
| 505 | Ga0068859_100740260 | |||
| 506 | Ga0068864_100005324 | |||
| 507 | Ga0068864_100182737 | |||
| 508 | Ga0068864_100245618 | |||
| 509 | Ga0068861_100609610 | |||
| 510 | Ga0068863_100014697 | |||
| 511 | Ga0068863_100055883 | |||
| 512 | Ga0068863_100109419 | |||
| 513 | Ga0068863_100208743 | |||
| 514 | Ga0068863_100403369 | |||
| 515 | Ga0068858_100007194 | |||
| 516 | Ga0068858_100025665 | |||
| 517 | Ga0068858_100084438 | |||
| 518 | Ga0068858_101058207 | |||
| 519 | Ga0068860_100039459 | |||
| 520 | Ga0070717_10038570 | |||
| 521 | Ga0070717_10131036 | |||
| 522 | Ga0070717_10245854 | |||
| 523 | Ga0070717_10337469 | |||
| 524 | Ga0097621_100003496 | |||
| 525 | Ga0097621_100065098 | |||
| 526 | Ga0097621_100096768 | |||
| 527 | Ga0097621_100150164 | |||
| 528 | Ga0097621_101072773 | |||
| 529 | Ga0068871_100023914 | |||
| 530 | Ga0068871_100085886 | |||
| 531 | Ga0068871_100116675 | |||
| 532 | Ga0068871_100265216 | |||
| 533 | Ga0068871_100550407 | |||
| 534 | Ga0068871_100718818 | |||
| 535 | Ga0068871_100845207 | |||
| 536 | Ga0075434_100367304 | |||
| 537 | Ga0075434_100926409 | |||
| 538 | Ga0068865_100165924 | |||
| 539 | Ga0075436_100407114 | |||
| 540 | Ga0097620_100333405 | |||
| 541 | Ga0097620_100530439 | |||
| 542 | Ga0097620_100637770 | |||
| 543 | Ga0097620_100740258 | |||
| 544 | Ga0105240_10003070 | |||
| 545 | Ga0105240_10006011 | |||
| 546 | Ga0105240_10029531 | |||
| 547 | Ga0105240_10071416 | |||
| 548 | Ga0105240_10077148 | |||
| 549 | Ga0105240_10207997 | |||
| 550 | Ga0105240_10359853 | |||
| 551 | Ga0105240_10528723 | |||
| 552 | Ga0105245_10029033 | |||
| 553 | Ga0105245_10050807 | |||
| 554 | Ga0105245_10170888 | |||
| 555 | Ga0105245_10178930 | |||
| 556 | Ga0105245_10225678 | |||
| 557 | Ga0105245_10349337 | |||
| 558 | Ga0105245_10359530 | |||
| 559 | Ga0105245_11689291 | |||
| 560 | Ga0105247_10142085 | |||
| 561 | Ga0105247_10212526 | |||
| 562 | Ga0105247_10226109 | |||
| 563 | Ga0105247_10323512 | |||
| 564 | Ga0114129_10921037 | |||
| 565 | Ga0105243_10693698 | |||
| 566 | Ga0105241_10005788 | |||
| 567 | Ga0105241_10012616 | |||
| 568 | Ga0105241_10121364 | |||
| 569 | Ga0105241_10209532 | |||
| 570 | Ga0105241_10239444 | |||
| 571 | Ga0105241_10480281 | |||
| 572 | Ga0105241_10603048 | |||
| 573 | Ga0105242_10010642 | |||
| 574 | Ga0105242_10015468 | |||
| 575 | Ga0105248_10020445 | |||
| 576 | Ga0105248_10023542 | |||
| 577 | Ga0105248_10142955 | |||
| 578 | Ga0105248_10269261 | |||
| 579 | Ga0105248_11314348 | |||
| 580 | Ga0105237_10006298 | |||
| 581 | Ga0105237_10007075 | |||
| 582 | Ga0105237_10051992 | |||
| 583 | Ga0105238_10002822 | |||
| 584 | Ga0105238_10016038 | |||
| 585 | Ga0105238_10065775 | |||
| 586 | Ga0105238_10119404 | |||
| 587 | Ga0105238_10162055 | |||
| 588 | Ga0105238_10436190 | |||
| 589 | Ga0105239_10001134 | |||
| 590 | Ga0105239_10003715 | |||
| 591 | Ga0105239_10013336 | |||
| 592 | Ga0105239_10171585 | |||
| 593 | Ga0105239_10300182 | |||
| 594 | Ga0105239_10328955 | |||
| 595 | Ga0105239_10505237 | |||
| 596 | Ga0105239_10712065 | |||
| 597 | Ga0105246_10009373 | |||
| 598 | Ga0105246_10643448 | |||
| 599 | Ga0157370_10025552 | |||
| 600 | Ga0157370_10307803 | |||
| 601 | Ga0157369_10002040 | |||
| 602 | Ga0157369_10068309 | |||
| 603 | Ga0157369_10868325 | |||
| 604 | Ga0157374_10088712 | |||
| 605 | Ga0157374_10144248 | |||
| 606 | Ga0157374_10279905 | |||
| 607 | Ga0157374_10797093 | |||
| 608 | Ga0157374_11302757 | |||
| 609 | Ga0157374_11560244 | |||
| 610 | Ga0157378_10002179 | |||
| 611 | Ga0157378_10777762 | |||
| 612 | Ga0163162_10061997 | |||
| 613 | Ga0163162_10490666 | |||
| 614 | Ga0163162_10712932 | |||
| 615 | Ga0163162_10843208 | |||
| 616 | Ga0163162_11048568 | |||
| 617 | Ga0157372_10008283 | |||
| 618 | Ga0157372_10009581 | |||
| 619 | Ga0157372_10780492 | |||
| 620 | Ga0157375_10012141 | |||
| 621 | Ga0157375_10028063 | |||
| 622 | Ga0157375_10281466 | |||
| 623 | Ga0157375_10316108 | |||
| 624 | Ga0157375_10712847 | |||
| 625 | Ga0163163_10008537 | |||
| 626 | Ga0163163_10011601 | |||
| 627 | Ga0163163_10066753 | |||
| 628 | Ga0163163_10105344 | |||
| 629 | Ga0163163_10111200 | |||
| 630 | Ga0163163_10283685 | |||
| 631 | Ga0163163_10344088 | |||
| 632 | Ga0163163_10400185 | |||
| 633 | Ga0163163_11902491 | |||
| 634 | Ga0157377_10322897 | |||
| 635 | Ga0157377_10896655 | |||
| 636 | Ga0157379_10047684 | |||
| 637 | Ga0157379_10671215 | |||
| 638 | Ga0157379_10856869 | |||
| 639 | Ga0157376_10277948 | |||
| 640 | Ga0157376_10316090 | |||
| 641 | Ga0157376_10513902 | |||
| 642 | Ga0157376_10863477 | |||
| 643 | Ga0182007_10100291 | |||
| 644 | Ga0207680_10019765 | |||
| 645 | Ga0207680_10230095 | |||
| 646 | Ga0207699_10425814 | |||
| 647 | Ga0207699_10588242 | |||
| 648 | Ga0207645_10308453 | |||
| 649 | Ga0207654_10003829 | |||
| 650 | Ga0207654_10030158 | |||
| 651 | Ga0207654_10216997 | |||
| 652 | Ga0207654_10642884 | |||
| 653 | Ga0207654_10703244 | |||
| 654 | Ga0207654_10742967 | |||
| 655 | Ga0207707_10014368 | |||
| 656 | Ga0207707_10044440 | |||
| 657 | Ga0207695_10006818 | |||
| 658 | Ga0207695_10013215 | |||
| 659 | Ga0207695_10043860 | |||
| 660 | Ga0207695_10359329 | |||
| 661 | Ga0207695_10659780 | |||
| 662 | Ga0207695_10811901 | |||
| 663 | Ga0207695_10846533 | |||
| 664 | Ga0207671_10060871 | |||
| 665 | Ga0207671_10100011 | |||
| 666 | Ga0207671_10384435 | |||
| 667 | Ga0207663_10018729 | |||
| 668 | Ga0207657_10227922 | |||
| 669 | Ga0207649_10103995 | |||
| 670 | Ga0207652_10039744 | |||
| 671 | Ga0207694_10043073 | |||
| 672 | Ga0207694_10047899 | |||
| 673 | Ga0207694_10601913 | |||
| 674 | Ga0207694_11152153 | |||
| 675 | Ga0207650_10319247 | |||
| 676 | Ga0207687_10036691 | |||
| 677 | Ga0207687_10106618 | |||
| 678 | Ga0207687_10118233 | |||
| 679 | Ga0207687_10321730 | |||
| 680 | Ga0207687_10595427 | |||
| 681 | Ga0207700_10057644 | |||
| 682 | Ga0207700_10059978 | |||
| 683 | Ga0207664_10012648 | |||
| 684 | Ga0207664_11550836 | |||
| 685 | Ga0207644_10215286 | |||
| 686 | Ga0207644_10664341 | |||
| 687 | Ga0207706_11272428 | |||
| 688 | Ga0207686_10009299 | |||
| 689 | Ga0207686_10009972 | |||
| 690 | Ga0207686_10092950 | |||
| 691 | Ga0207711_10057077 | |||
| 692 | Ga0207711_10119076 | |||
| 693 | Ga0207711_10182337 | |||
| 694 | Ga0207711_10193713 | |||
| 695 | Ga0207711_10322391 | |||
| 696 | Ga0207711_11239628 | |||
| 697 | Ga0207689_10260259 | |||
| 698 | Ga0207689_10296308 | |||
| 699 | Ga0207661_10031154 | |||
| 700 | Ga0207661_10042629 | |||
| 701 | Ga0207661_10120974 | |||
| 702 | Ga0207661_10335234 | |||
| 703 | Ga0207679_10349786 | |||
| 704 | Ga0207667_10017068 | |||
| 705 | Ga0207667_10140130 | |||
| 706 | Ga0207667_10390063 | |||
| 707 | Ga0207667_10399233 | |||
| 708 | Ga0207667_10642671 | |||
| 709 | Ga0207667_10963514 | |||
| 710 | Ga0207712_10229701 | |||
| 711 | Ga0207640_10028404 | |||
| 712 | Ga0207658_10073820 | |||
| 713 | Ga0207677_10188850 | |||
| 714 | Ga0207677_10191075 | |||
| 715 | Ga0207677_10238604 | |||
| 716 | Ga0207677_10522729 | |||
| 717 | Ga0207703_10009305 | |||
| 718 | Ga0207703_10027843 | |||
| 719 | Ga0207703_11012697 | |||
| 720 | Ga0207702_10005068 | |||
| 721 | Ga0207702_10018379 | |||
| 722 | Ga0207702_10107968 | |||
| 723 | Ga0207702_10156683 | |||
| 724 | Ga0207702_10225101 | |||
| 725 | Ga0207702_10466857 | |||
| 726 | Ga0207702_11671271 | |||
| 727 | Ga0207641_10010564 | |||
| 728 | Ga0207641_10057779 | |||
| 729 | Ga0207641_10275050 | |||
| 730 | Ga0207641_10421551 | |||
| 731 | Ga0207641_10442076 | |||
| 732 | Ga0207676_10043072 | |||
| 733 | Ga0207676_10113128 | |||
| 734 | Ga0207676_10213314 | |||
| 735 | Ga0207674_10001542 | |||
| 736 | Ga0207674_10100565 | |||
| 737 | Ga0207675_100955722 | |||
| 738 | Ga0207675_101236628 | |||
| 739 | Ga0207698_10054177 | |||
| 740 | Ga0207698_11397086 | |||
| 741 | Ga0207698_11491285 | |||
| 742 | Ga0207698_11563576 | |||
| 743 | Ga0268266_10439101 | |||
| 744 | Ga0268264_10010879 | |||
| 745 | Ga0373926_0303480 | |||
| 746 | Ga0373923_0130806 | |||
| 747 | Ga0373953_0281575 | |||
| 748 | Ga0373954_0000691 | |||
| 749 | Ga0373954_0158226 | |||
| 750 | Ga0373956_0402477 | |||
| 751 | Ga0373943_0478998 | |||
| 752 | Ga0373946_0239555 | |||
| 753 | Ga0373946_0341271 | |||
| 754 | Ga0373955_0032897 | |||
| 755 | Ga0373955_0036969 | |||
| 756 | Ga0373955_0562288 | |||
| 757 | Ga0373924_0117089 | |||
| 758 | Ga0373935_0143931 | |||
| 759 | Ga0373927_0031750 | |||
| 760 | Ga0373927_0233069 | |||
| 761 | Ga0373933_0796231 | |||
| 762 | Ga0373947_0088213 | |||
| 763 | Ga0373947_0161927 | |||
| 764 | Ga0373937_0005673 | |||
| 765 | Ga0373937_0112679 | |||
| 766 | Ga0373937_0962680 | |||
| 767 | Ga0373937_1299256 | |||
| 768 | Ga0373937_1304504 | |||
| 769 | Ga0265778_026521 | |||
| 770 | Ga0373925_0142969 | |||
| 771 | Ga0373925_0175088 | |||
| 772 | Ga0373925_0230226 | |||
| 773 | Ga0373925_0713150 | |||
| 774 | Ga0373925_0836664 | |||
| 775 | Ga0436364_1099359 | |||
| 776 | Ga0436365_0177005 | |||
| 777 | Ga0436363_0659200 | |||
| 778 | Ga0436363_1112611 | |||
| 779 | Ga0495592_0159145 | |||
| 780 | Ga0495603_0250861 | |||
| 781 | Ga0495603_0422288 | |||
| 782 | Ga0495629_0031024 | |||
| 783 | Ga0495651_0409151 | |||
| 784 | Ga0495580_0008865 | |||
| 785 | Ga0495580_0038515 | |||
| 786 | Ga0495580_0068436 | |||
| 787 | Ga0495580_0087147 | |||
| 788 | Ga0495580_0581615 | |||
| 789 | Ga0495582_0490382 | |||
| 790 | Ga0495662_0077502 | |||
| 791 | Ga0495664_0018282 | |||
| 792 | Ga0495664_0049449 | |||
| 793 | Ga0495664_0114934 | |||
| 794 | Ga0495664_0142671 | |||
| 795 | Ga0495664_0348421 | |||
| 796 | Ga0495584_0419464 | |||
| 797 | Ga0495594_0009287 | |||
| 798 | Ga0495594_0129106 | |||
| 799 | Ga0495608_0051424 | |||
| 800 | Ga0495618_0585693 | |||
| 801 | Ga0495628_0205215 | |||
| 802 | Ga0495628_0267914 | |||
| 803 | Ga0495630_0114150 | |||
| 804 | Ga0495652_0042411 | |||
| 805 | Ga0495652_0201551 | |||
| 806 | Ga0495665_0388195 | |||
| 807 | Ga0495640_0206851 | |||
| 808 | Ga0495640_0210682 | |||
| 809 | Ga0495586_0076218 | |||
| 810 | Ga0495587_0065659 | |||
| 811 | Ga0495587_0151037 | |||
| 812 | Ga0495645_0032186 | |||
| 813 | Ga0495645_0252265 | |||
| 814 | Ga0495667_0014735 | |||
| 815 | Ga0495667_0284928 | |||
| 816 | Ga0495634_0024795 | |||
| 817 | Ga0495634_0084522 | |||
| 818 | Ga0495634_0104035 | |||
| 819 | Ga0495635_0015329 | |||
| 820 | Ga0495635_0081883 | |||
| 821 | Ga0495635_0194901 | |||
| 822 | Ga0495635_0482178 | |||
| 823 | Ga0495657_0342512 | |||
| 824 | Ga0495657_0564944 | |||
| 825 | Ga0495599_0015513 | |||
| 826 | Ga0495623_0086021 | |||
| 827 | Ga0495623_0113226 | |||
| 828 | Ga0495646_0056500 | |||
| 829 | Ga0495646_0060983 | |||
| 830 | Ga0495646_0295412 | |||
| 831 | Ga0495647_0067777 | |||
| 832 | Ga0495613_0048500 | |||
| 833 | Ga0495613_0187063 | |||
| 834 | Ga0495600_0027991 | |||
| 835 | Ga0495600_0715711 | |||
| 836 | Ga0495604_0111574 | |||
| 837 | Ga0495674_0024001 | |||
| 838 | Ga0495674_0038532 | |||
| 839 | Ga0495674_0064525 | |||
| 840 | Ga0495674_0094776 | |||
| 841 | Ga0495674_0151048 | |||
| 842 | Ga0495674_0191370 | |||
| 843 | Ga0495674_0702040 | |||
| 844 | Ga0495676_0268424 | |||
| 845 | Ga0495676_0798907 | |||
| 846 | Ga0495680_0022387 | |||
| 847 | Ga0495680_0054015 | |||
| 848 | Ga0495675_0243028 | |||
| 849 | Ga0495675_0605473 | |||
| 850 | Ga0495684_0007666 | |||
| 851 | Ga0495684_0010071 | |||
| 852 | Ga0495684_0018344 | |||
| 853 | Ga0495684_0052680 | |||
| 854 | Ga0495684_0189421 | |||
| 855 | Ga0495684_0256146 | |||
| 856 | Ga0495602_0179520 | |||
| 857 | Ga0495614_0120496 | |||
| 858 | Ga0496102_1278276 | |||
| 859 | Ga0496115_0076423 | |||
| 860 | Ga0496115_0182583 | |||
| 861 | nmdc:mga05p37_311044_c1 | |||
| 862 | nmdc:mga0n895_409124_c1 | |||
| 863 | nmdc:mga08x19_616644_c1 | |||
| 864 | Ga0495601_0034358 | |||
| 865 | Ga0495601_0157967 | |||
| 866 | Ga0495595_0101073 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1twl-assembly1.cif.gz_A | inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 | 0.8078 | 3 | 178 |
| 3r6e-assembly1.cif.gz_B | the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate | 0.8048 | 16 | 178 |
| 1twl-assembly1.cif.gz_A | inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 | 0.7993 | 3 | 178 |
| 6mt2-assembly1.cif.gz_B | crystal structure of inorganic pyrophosphatase from medicago truncatula (i23 crystal form) | 0.7943 | 1 | 178 |
| 2bqy-assembly1.cif.gz_A | inorganic pyrophosphatase from the pathogenic bacterium helicobacter pylori-kinetic and structural properties | 0.7888 | 8 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kx8A03 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.8546 | 95 | 107 | 2.60.40.1910 |
| af_A0A1D6HHJ7_152_313_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.8084 | 17 | 181 | 3.90.80.10 |
| af_A0A1D6HHJ7_152_313_3.90.80.10 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.7989 | 17 | 181 | 3.90.80.10 |
| 2prdA00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.786 | 2 | 176 | 3.90.80.10 |
| 4z71B00 | Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase | 0.7786 | 17 | 176 | 3.90.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A369QQ60-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9866 | 89 | 178 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A2V9RL42-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.979 | 76 | 169 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 GO:0016020 |
| AF-A0A537VRL8-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9708 | 75 | 178 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A537JRT9-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9701 | 70 | 170 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |
| AF-A0A0E9N3S9-F1-model_v4 | inorganic diphosphatase (EC 3.6.1.1) | 0.9518 | 51 | 171 |
GO:0000287
GO:0004427 GO:0005737 GO:0006796 |