F442847

General Info

Members Datasets Scaffolds Average Seq Length
433 169 866 182

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10003295|Ga0157376_100032953
Length 177
Sequence MPDISTIPHQLDEKKGTCRAIIETPKGFRNKFDFDPDSNLFMLGGLLPEGMMFPFDFGFVPSTLGEDGDPLDILVLPAHVGCLIEVRLIGIINAQQTEGGKTETNDRLLGVAVHSYNHENLNSIEDMSKTVLDQLEAFFISYNKQRGKKFKVAGTGGPKKAIAFLKMGSKAQKNAKH

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 35.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10003295 3300014969 Bacteria 11122
2 Ga0070683_100003150 3300005329 Bacteria 13295
3 Ga0070683_100017569 3300005329 Bacteria 6323
4 Ga0070683_100109697 3300005329 Bacteria 2603
5 Ga0070683_100761473 3300005329 Bacteria 928
6 Ga0070670_100364138 3300005331 Unclassified 1272
7 Ga0070670_100521500 3300005331 Unclassified 1058
8 Ga0068869_100046068 3300005334 Bacteria 3143
9 Ga0068869_100189404 3300005334 Unclassified 1617
10 Ga0070666_10042991 3300005335 Unclassified 3024
11 Ga0070666_10113592 3300005335 Bacteria 1874
12 Ga0070666_10141443 3300005335 Bacteria 1676
13 Ga0070680_100315314 3300005336 Bacteria 1327
14 Ga0070680_101064886 3300005336 Bacteria 699
15 Ga0068868_100037704 3300005338 Bacteria 3749
16 Ga0068868_100174274 3300005338 Bacteria 1782
17 Ga0068868_100247736 3300005338 Bacteria 1499
18 Ga0068868_100852347 3300005338 Unclassified 825
19 Ga0068868_100949287 3300005338 Unclassified 784
20 Ga0070660_100239950 3300005339 Unclassified 1476
21 Ga0070661_100316872 3300005344 Unclassified 1217
22 Ga0070661_100880524 3300005344 Unclassified 738
23 Ga0070675_100230025 3300005354 Unclassified 1617
24 Ga0070675_101554443 3300005354 Unclassified 610
25 Ga0070671_100141778 3300005355 Bacteria 2028
26 Ga0070671_100564809 3300005355 Unclassified 982
27 Ga0070673_100171127 3300005364 Unclassified 1854
28 Ga0070667_100085640 3300005367 Unclassified 2703
29 Ga0070709_10234347 3300005434 Bacteria 1315
30 Ga0070709_10665780 3300005434 Unclassified 807
31 Ga0070709_10846949 3300005434 Unclassified 720
32 Ga0070714_100002047 3300005435 Bacteria 14773
33 Ga0070713_100005193 3300005436 Bacteria 8866
34 Ga0070713_100039683 3300005436 Bacteria 3823
35 Ga0070713_100045410 3300005436 Bacteria 3600
36 Ga0070713_100840738 3300005436 Bacteria 881
37 Ga0070710_10634373 3300005437 Unclassified 747
38 Ga0070711_100051407 3300005439 Bacteria 2830
39 Ga0070711_100400382 3300005439 Unclassified 1114
40 Ga0070708_100230128 3300005445 Bacteria 1739
41 Ga0070681_10005895 3300005458 Bacteria 11864
42 Ga0070681_10245571 3300005458 Bacteria 1703
43 Ga0070706_101078890 3300005467 Unclassified 739
44 Ga0070698_100295890 3300005471 Bacteria 1550
45 Ga0070679_100042822 3300005530 Bacteria 4509
46 Ga0070684_100042911 3300005535 Bacteria 3906
47 Ga0070684_100313395 3300005535 Bacteria 1441
48 Ga0070684_100639760 3300005535 Bacteria 990
49 Ga0070697_100195228 3300005536 Bacteria 1719
50 Ga0070697_100446168 3300005536 Bacteria 1127
51 Ga0070697_100753330 3300005536 Unclassified 861
52 Ga0068853_100603741 3300005539 Unclassified 1042
53 Ga0070665_100111825 3300005548 Bacteria 2734
54 Ga0068855_100019988 3300005563 Bacteria 8043
55 Ga0068855_100028178 3300005563 Bacteria 6719
56 Ga0068855_100029521 3300005563 Bacteria 6553
57 Ga0068855_100067452 3300005563 Bacteria 4167
58 Ga0068855_100514656 3300005563 Bacteria 1299
59 Ga0070664_100021458 3300005564 Bacteria 5323
60 Ga0068857_100029975 3300005577 Unclassified 4801
61 Ga0068857_100033801 3300005577 Unclassified 4522
62 Ga0068857_100061431 3300005577 Unclassified 3338
63 Ga0068856_100002189 3300005614 Bacteria 20283
64 Ga0068856_100003485 3300005614 Bacteria 15879
65 Ga0068856_100003899 3300005614 Bacteria 14959
66 Ga0068856_100177744 3300005614 Unclassified 2141
67 Ga0068856_100832722 3300005614 Unclassified 942
68 Ga0068852_100295973 3300005616 Unclassified 1565
69 Ga0068859_100333421 3300005617 Unclassified 1611
70 Ga0068859_100530509 3300005617 Unclassified 1272
71 Ga0068859_100637750 3300005617 Bacteria 1158
72 Ga0068859_100740260 3300005617 Unclassified 1072
73 Ga0068864_100005324 3300005618 Bacteria 10540
74 Ga0068864_100182737 3300005618 Bacteria 1918
75 Ga0068864_100245618 3300005618 Unclassified 1660
76 Ga0068861_100609610 3300005719 Unclassified 1003
77 Ga0068863_100014697 3300005841 Bacteria 7534
78 Ga0068863_100055883 3300005841 Bacteria 3738
79 Ga0068863_100109419 3300005841 Unclassified 2631
80 Ga0068863_100208743 3300005841 Bacteria 1880
81 Ga0068863_100403369 3300005841 Unclassified 1337
82 Ga0068858_100007194 3300005842 Bacteria 10791
83 Ga0068858_100025665 3300005842 Bacteria 5483
84 Ga0068858_100084438 3300005842 Bacteria 2953
85 Ga0068858_101058207 3300005842 Unclassified 796
86 Ga0068860_100039459 3300005843 Unclassified 4516
87 Ga0070717_10038570 3300006028 Bacteria 3884
88 Ga0070717_10131036 3300006028 Bacteria 2156
89 Ga0070717_10245854 3300006028 Bacteria 1579
90 Ga0070717_10337469 3300006028 Bacteria 1345
91 Ga0097621_100003496 3300006237 Bacteria 10842
92 Ga0097621_100065098 3300006237 Bacteria 2999
93 Ga0097621_100096768 3300006237 Unclassified 2477
94 Ga0097621_100150164 3300006237 Bacteria 1998
95 Ga0097621_101072773 3300006237 Unclassified 755
96 Ga0068871_100023914 3300006358 Bacteria 4734
97 Ga0068871_100085886 3300006358 Bacteria 2614
98 Ga0068871_100116675 3300006358 Bacteria 2251
99 Ga0068871_100265216 3300006358 Unclassified 1499
100 Ga0068871_100550407 3300006358 Unclassified 1045
101 Ga0068871_100718818 3300006358 Unclassified 916
102 Ga0068871_100845207 3300006358 Unclassified 846
103 Ga0075434_100367304 3300006871 Archaea 1460
104 Ga0075434_100926409 3300006871 Bacteria 886
105 Ga0068865_100165924 3300006881 Bacteria 1689
106 Ga0075436_100407114 3300006914 Unclassified 986
107 Ga0097620_100333405 3300006931 Unclassified 1611
108 Ga0097620_100530439 3300006931 Unclassified 1272
109 Ga0097620_100637770 3300006931 Bacteria 1158
110 Ga0097620_100740258 3300006931 Unclassified 1072
111 Ga0105240_10003070 3300009093 Bacteria 26232
112 Ga0105240_10006011 3300009093 Bacteria 17945
113 Ga0105240_10029531 3300009093 Bacteria 7142
114 Ga0105240_10071416 3300009093 Bacteria 4294
115 Ga0105240_10077148 3300009093 Bacteria 4106
116 Ga0105240_10207997 3300009093 Bacteria 2288
117 Ga0105240_10359853 3300009093 Unclassified 1649
118 Ga0105240_10528723 3300009093 Bacteria 1308
119 Ga0105245_10029033 3300009098 Bacteria 4885
120 Ga0105245_10050807 3300009098 Unclassified 3717
121 Ga0105245_10170888 3300009098 Bacteria 2070
122 Ga0105245_10178930 3300009098 Unclassified 2025
123 Ga0105245_10225678 3300009098 Bacteria 1810
124 Ga0105245_10349337 3300009098 Bacteria 1465
125 Ga0105245_10359530 3300009098 Bacteria 1445
126 Ga0105245_11689291 3300009098 Unclassified 685
127 Ga0105247_10142085 3300009101 Bacteria 1574
128 Ga0105247_10212526 3300009101 Unclassified 1305
129 Ga0105247_10226109 3300009101 Bacteria 1269
130 Ga0105247_10323512 3300009101 Unclassified 1077
131 Ga0114129_10921037 3300009147 Archaea 1106
132 Ga0105243_10693698 3300009148 Unclassified 992
133 Ga0105241_10005788 3300009174 Bacteria 9124
134 Ga0105241_10012616 3300009174 Bacteria 6200
135 Ga0105241_10121364 3300009174 Unclassified 2105
136 Ga0105241_10209532 3300009174 Unclassified 1632
137 Ga0105241_10239444 3300009174 Bacteria 1533
138 Ga0105241_10480281 3300009174 Bacteria 1104
139 Ga0105241_10603048 3300009174 Bacteria 992
140 Ga0105242_10010642 3300009176 Bacteria 7062
141 Ga0105242_10015468 3300009176 Bacteria 5925
142 Ga0105248_10020445 3300009177 Bacteria 7336
143 Ga0105248_10023542 3300009177 Bacteria 6841
144 Ga0105248_10142955 3300009177 Unclassified 2699
145 Ga0105248_10269261 3300009177 Bacteria 1918
146 Ga0105248_11314348 3300009177 Unclassified 818
147 Ga0105237_10006298 3300009545 Bacteria 13196
148 Ga0105237_10007075 3300009545 Bacteria 12338
149 Ga0105237_10051992 3300009545 Bacteria 4114
150 Ga0105238_10002822 3300009551 Bacteria 17338
151 Ga0105238_10016038 3300009551 Bacteria 7577
152 Ga0105238_10065775 3300009551 Bacteria 3626
153 Ga0105238_10119404 3300009551 Bacteria 2617
154 Ga0105238_10162055 3300009551 Bacteria 2212
155 Ga0105238_10436190 3300009551 Unclassified 1306
156 Ga0105239_10001134 3300010375 Bacteria 36735
157 Ga0105239_10003715 3300010375 Bacteria 18581
158 Ga0105239_10013336 3300010375 Bacteria 9132
159 Ga0105239_10171585 3300010375 Bacteria 2425
160 Ga0105239_10300182 3300010375 Bacteria 1809
161 Ga0105239_10328955 3300010375 Bacteria 1724
162 Ga0105239_10505237 3300010375 Unclassified 1374
163 Ga0105239_10712065 3300010375 Unclassified 1148
164 Ga0105246_10009373 3300011119 Bacteria 6032
165 Ga0105246_10643448 3300011119 Bacteria 922
166 Ga0157370_10025552 3300013104 Bacteria 5846
167 Ga0157370_10307803 3300013104 Unclassified 1462
168 Ga0157369_10002040 3300013105 Bacteria 24347
169 Ga0157369_10068309 3300013105 Bacteria 3818
170 Ga0157369_10868325 3300013105 Bacteria 926
171 Ga0157374_10088712 3300013296 Bacteria 2946
172 Ga0157374_10144248 3300013296 Unclassified 2312
173 Ga0157374_10279905 3300013296 Unclassified 1647
174 Ga0157374_10797093 3300013296 Bacteria 960
175 Ga0157374_11302757 3300013296 Unclassified 748
176 Ga0157374_11560244 3300013296 Unclassified 684
177 Ga0157378_10002179 3300013297 Bacteria 17362
178 Ga0157378_10777762 3300013297 Unclassified 982
179 Ga0163162_10061997 3300013306 Bacteria 3779
180 Ga0163162_10490666 3300013306 Bacteria 1359
181 Ga0163162_10712932 3300013306 Bacteria 1124
182 Ga0163162_10843208 3300013306 Bacteria 1032
183 Ga0163162_11048568 3300013306 Bacteria 923
184 Ga0157372_10008283 3300013307 Bacteria 11054
185 Ga0157372_10009581 3300013307 Bacteria 10296
186 Ga0157372_10780492 3300013307 Bacteria 1110
187 Ga0157375_10012141 3300013308 Bacteria 7633
188 Ga0157375_10028063 3300013308 Bacteria 5271
189 Ga0157375_10281466 3300013308 Unclassified 1826
190 Ga0157375_10316108 3300013308 Bacteria 1726
191 Ga0157375_10712847 3300013308 Bacteria 1156
192 Ga0163163_10008537 3300014325 Bacteria 9105
193 Ga0163163_10011601 3300014325 Bacteria 8005
194 Ga0163163_10066753 3300014325 Unclassified 3574
195 Ga0163163_10105344 3300014325 Unclassified 2846
196 Ga0163163_10111200 3300014325 Unclassified 2768
197 Ga0163163_10283685 3300014325 Unclassified 1708
198 Ga0163163_10344088 3300014325 Unclassified 1547
199 Ga0163163_10400185 3300014325 Unclassified 1431
200 Ga0163163_11902491 3300014325 Unclassified 655
201 Ga0157377_10322897 3300014745 Unclassified 1026
202 Ga0157377_10896655 3300014745 Unclassified 662
203 Ga0157379_10047684 3300014968 Bacteria 3823
204 Ga0157379_10671215 3300014968 Unclassified 971
205 Ga0157379_10856869 3300014968 Unclassified 860
206 Ga0157376_10277948 3300014969 Bacteria 1576
207 Ga0157376_10316090 3300014969 Unclassified 1483
208 Ga0157376_10513902 3300014969 Bacteria 1179
209 Ga0157376_10863477 3300014969 Bacteria 921
210 Ga0182007_10100291 3300015262 Unclassified 958
211 Ga0207680_10019765 3300025903 Unclassified 3610
212 Ga0207680_10230095 3300025903 Bacteria 1274
213 Ga0207699_10425814 3300025906 Bacteria 949
214 Ga0207699_10588242 3300025906 Unclassified 810
215 Ga0207645_10308453 3300025907 Unclassified 1054
216 Ga0207654_10003829 3300025911 Bacteria 7584
217 Ga0207654_10030158 3300025911 Bacteria 2975
218 Ga0207654_10216997 3300025911 Unclassified 1267
219 Ga0207654_10642884 3300025911 Bacteria 759
220 Ga0207654_10703244 3300025911 Unclassified 726
221 Ga0207654_10742967 3300025911 Bacteria 706
222 Ga0207707_10014368 3300025912 Bacteria 6897
223 Ga0207707_10044440 3300025912 Bacteria 3874
224 Ga0207695_10006818 3300025913 Bacteria 14715
225 Ga0207695_10013215 3300025913 Bacteria 9852
226 Ga0207695_10043860 3300025913 Bacteria 4761
227 Ga0207695_10359329 3300025913 Bacteria 1343
228 Ga0207695_10659780 3300025913 Unclassified 927
229 Ga0207695_10811901 3300025913 Unclassified 815
230 Ga0207695_10846533 3300025913 Unclassified 795
231 Ga0207671_10060871 3300025914 Bacteria 2801
232 Ga0207671_10100011 3300025914 Bacteria 2195
233 Ga0207671_10384435 3300025914 Bacteria 1115
234 Ga0207663_10018729 3300025916 Bacteria 3887
235 Ga0207657_10227922 3300025919 Unclassified 1491
236 Ga0207649_10103995 3300025920 Bacteria 1885
237 Ga0207652_10039744 3300025921 Bacteria 3993
238 Ga0207694_10043073 3300025924 Bacteria 3483
239 Ga0207694_10047899 3300025924 Unclassified 3306
240 Ga0207694_10601913 3300025924 Unclassified 924
241 Ga0207694_11152153 3300025924 Bacteria 656
242 Ga0207650_10319247 3300025925 Unclassified 1272
243 Ga0207687_10036691 3300025927 Bacteria 3339
244 Ga0207687_10106618 3300025927 Bacteria 2072
245 Ga0207687_10118233 3300025927 Bacteria 1978
246 Ga0207687_10321730 3300025927 Bacteria 1252
247 Ga0207687_10595427 3300025927 Bacteria 931
248 Ga0207700_10057644 3300025928 Bacteria 2930
249 Ga0207700_10059978 3300025928 Bacteria 2879
250 Ga0207664_10012648 3300025929 Bacteria 6037
251 Ga0207664_11550836 3300025929 Unclassified 584
252 Ga0207644_10215286 3300025931 Bacteria 1520
253 Ga0207644_10664341 3300025931 Unclassified 868
254 Ga0207706_11272428 3300025933 Unclassified 609
255 Ga0207686_10009299 3300025934 Bacteria 5332
256 Ga0207686_10009972 3300025934 Bacteria 5165
257 Ga0207686_10092950 3300025934 Bacteria 1996
258 Ga0207711_10057077 3300025941 Bacteria 3356
259 Ga0207711_10119076 3300025941 Unclassified 2356
260 Ga0207711_10182337 3300025941 Bacteria 1910
261 Ga0207711_10193713 3300025941 Unclassified 1853
262 Ga0207711_10322391 3300025941 Bacteria 1428
263 Ga0207711_11239628 3300025941 Unclassified 688
264 Ga0207689_10260259 3300025942 Bacteria 1435
265 Ga0207689_10296308 3300025942 Bacteria 1340
266 Ga0207661_10031154 3300025944 Bacteria 4116
267 Ga0207661_10042629 3300025944 Bacteria 3578
268 Ga0207661_10120974 3300025944 Bacteria 2229
269 Ga0207661_10335234 3300025944 Bacteria 1362
270 Ga0207679_10349786 3300025945 Bacteria 1288
271 Ga0207667_10017068 3300025949 Bacteria 8186
272 Ga0207667_10140130 3300025949 Bacteria 2490
273 Ga0207667_10390063 3300025949 Bacteria 1418
274 Ga0207667_10399233 3300025949 Unclassified 1400
275 Ga0207667_10642671 3300025949 Unclassified 1067
276 Ga0207667_10963514 3300025949 Bacteria 842
277 Ga0207712_10229701 3300025961 Bacteria 1488
278 Ga0207640_10028404 3300025981 Bacteria 3420
279 Ga0207658_10073820 3300025986 Unclassified 2590
280 Ga0207677_10188850 3300026023 Bacteria 1628
281 Ga0207677_10191075 3300026023 Bacteria 1619
282 Ga0207677_10238604 3300026023 Unclassified 1469
283 Ga0207677_10522729 3300026023 Bacteria 1030
284 Ga0207703_10009305 3300026035 Bacteria 7722
285 Ga0207703_10027843 3300026035 Bacteria 4452
286 Ga0207703_11012697 3300026035 Unclassified 797
287 Ga0207702_10005068 3300026078 Bacteria 11574
288 Ga0207702_10018379 3300026078 Bacteria 5785
289 Ga0207702_10107968 3300026078 Bacteria 2469
290 Ga0207702_10156683 3300026078 Unclassified 2077
291 Ga0207702_10225101 3300026078 Unclassified 1750
292 Ga0207702_10466857 3300026078 Unclassified 1227
293 Ga0207702_11671271 3300026078 Unclassified 630
294 Ga0207641_10010564 3300026088 Bacteria 7575
295 Ga0207641_10057779 3300026088 Bacteria 3300
296 Ga0207641_10275050 3300026088 Bacteria 1582
297 Ga0207641_10421551 3300026088 Unclassified 1285
298 Ga0207641_10442076 3300026088 Unclassified 1255
299 Ga0207676_10043072 3300026095 Unclassified 3473
300 Ga0207676_10113128 3300026095 Bacteria 2275
301 Ga0207676_10213314 3300026095 Bacteria 1714
302 Ga0207674_10001542 3300026116 Bacteria 29686
303 Ga0207674_10100565 3300026116 Unclassified 2873
304 Ga0207675_100955722 3300026118 Unclassified 874
305 Ga0207675_101236628 3300026118 Unclassified 767
306 Ga0207698_10054177 3300026142 Bacteria 3084
307 Ga0207698_11397086 3300026142 Bacteria 715
308 Ga0207698_11491285 3300026142 Unclassified 692
309 Ga0207698_11563576 3300026142 Bacteria 675
310 Ga0268266_10439101 3300028379 Bacteria 1239
311 Ga0268264_10010879 3300028381 Bacteria 7518
312 Ga0373926_0303480 3300035083 Unclassified 623
313 Ga0373923_0130806 3300035111 Bacteria 1128
314 Ga0373953_0281575 3300035117 Unclassified 725
315 Ga0373954_0000691 3300035118 Bacteria 12930
316 Ga0373954_0158226 3300035118 Bacteria 1108
317 Ga0373956_0402477 3300035119 Bacteria 653
318 Ga0373943_0478998 3300035170 Unclassified 725
319 Ga0373946_0239555 3300035171 Unclassified 882
320 Ga0373946_0341271 3300035171 Unclassified 747
321 Ga0373955_0032897 3300035172 Bacteria 2727
322 Ga0373955_0036969 3300035172 Unclassified 2595
323 Ga0373955_0562288 3300035172 Unclassified 698
324 Ga0373924_0117089 3300035410 Bacteria 1155
325 Ga0373935_0143931 3300035692 Bacteria 1612
326 Ga0373927_0031750 3300035695 Unclassified 3441
327 Ga0373927_0233069 3300035695 Bacteria 1210
328 Ga0373933_0796231 3300035724 Unclassified 622
329 Ga0373947_0088213 3300035725 Bacteria 1930
330 Ga0373947_0161927 3300035725 Bacteria 1448
331 Ga0373937_0005673 3300036401 Bacteria 10713
332 Ga0373937_0112679 3300036401 Bacteria 2530
333 Ga0373937_0962680 3300036401 Unclassified 802
334 Ga0373937_1299256 3300036401 Bacteria 675
335 Ga0373937_1304504 3300036401 Bacteria 674
336 Ga0265778_026521 3300036457 Unclassified 736
337 Ga0373925_0142969 3300037068 Bacteria 1874
338 Ga0373925_0175088 3300037068 Bacteria 1695
339 Ga0373925_0230226 3300037068 Bacteria 1481
340 Ga0373925_0713150 3300037068 Unclassified 827
341 Ga0373925_0836664 3300037068 Bacteria 759
342 Ga0436364_1099359 3300037853 Bacteria 6594
343 Ga0436365_0177005 3300039437 Bacteria 653
344 Ga0436363_0659200 3300039450 Bacteria 909
345 Ga0436363_1112611 3300039450 Unclassified 570
346 Ga0495592_0159145 3300046454 Unclassified 1555
347 Ga0495603_0250861 3300046455 Bacteria 1019
348 Ga0495603_0422288 3300046455 Bacteria 764
349 Ga0495629_0031024 3300046459 Bacteria 3786
350 Ga0495651_0409151 3300046462 Unclassified 884
351 Ga0495580_0008865 3300046472 Bacteria 7958
352 Ga0495580_0038515 3300046472 Bacteria 3424
353 Ga0495580_0068436 3300046472 Unclassified 2483
354 Ga0495580_0087147 3300046472 Bacteria 2175
355 Ga0495580_0581615 3300046472 Bacteria 741
356 Ga0495582_0490382 3300046473 Bacteria 710
357 Ga0495662_0077502 3300046476 Bacteria 1614
358 Ga0495664_0018282 3300046477 Bacteria 4013
359 Ga0495664_0049449 3300046477 Bacteria 2496
360 Ga0495664_0114934 3300046477 Unclassified 1626
361 Ga0495664_0142671 3300046477 Bacteria 1452
362 Ga0495664_0348421 3300046477 Bacteria 892
363 Ga0495584_0419464 3300046491 Bacteria 680
364 Ga0495594_0009287 3300046499 Bacteria 5079
365 Ga0495594_0129106 3300046499 Bacteria 1431
366 Ga0495608_0051424 3300046511 Bacteria 2731
367 Ga0495618_0585693 3300046514 Unclassified 665
368 Ga0495628_0205215 3300046516 Bacteria 1484
369 Ga0495628_0267914 3300046516 Bacteria 1271
370 Ga0495630_0114150 3300046517 Bacteria 2046
371 Ga0495652_0042411 3300046529 Bacteria 3923
372 Ga0495652_0201551 3300046529 Unclassified 1509
373 Ga0495665_0388195 3300046531 Bacteria 709
374 Ga0495640_0206851 3300046533 Bacteria 1242
375 Ga0495640_0210682 3300046533 Unclassified 1229
376 Ga0495586_0076218 3300046535 Bacteria 1837
377 Ga0495587_0065659 3300046536 Bacteria 2118
378 Ga0495587_0151037 3300046536 Bacteria 1324
379 Ga0495645_0032186 3300046543 Bacteria 3825
380 Ga0495645_0252265 3300046543 Unclassified 1172
381 Ga0495667_0014735 3300046559 Bacteria 5283
382 Ga0495667_0284928 3300046559 Bacteria 1048
383 Ga0495634_0024795 3300046642 Bacteria 4204
384 Ga0495634_0084522 3300046642 Unclassified 2069
385 Ga0495634_0104035 3300046642 Bacteria 1832
386 Ga0495635_0015329 3300046663 Bacteria 5361
387 Ga0495635_0081883 3300046663 Unclassified 2209
388 Ga0495635_0194901 3300046663 Bacteria 1375
389 Ga0495635_0482178 3300046663 Bacteria 818
390 Ga0495657_0342512 3300046675 Unclassified 886
391 Ga0495657_0564944 3300046675 Bacteria 660
392 Ga0495599_0015513 3300046678 Bacteria 4729
393 Ga0495623_0086021 3300046679 Bacteria 1938
394 Ga0495623_0113226 3300046679 Bacteria 1641
395 Ga0495646_0056500 3300046680 Bacteria 2353
396 Ga0495646_0060983 3300046680 Unclassified 2248
397 Ga0495646_0295412 3300046680 Bacteria 858
398 Ga0495647_0067777 3300046681 Unclassified 1422
399 Ga0495613_0048500 3300046689 Bacteria 3136
400 Ga0495613_0187063 3300046689 Bacteria 1465
401 Ga0495600_0027991 3300046809 Unclassified 3645
402 Ga0495600_0715711 3300046809 Unclassified 601
403 Ga0495604_0111574 3300047317 Bacteria 1993
404 Ga0495674_0024001 3300047319 Bacteria 5611
405 Ga0495674_0038532 3300047319 Bacteria 4289
406 Ga0495674_0064525 3300047319 Unclassified 3183
407 Ga0495674_0094776 3300047319 Bacteria 2546
408 Ga0495674_0151048 3300047319 Bacteria 1948
409 Ga0495674_0191370 3300047319 Unclassified 1700
410 Ga0495674_0702040 3300047319 Unclassified 794
411 Ga0495676_0268424 3300047321 Bacteria 1159
412 Ga0495676_0798907 3300047321 Unclassified 607
413 Ga0495680_0022387 3300047322 Bacteria 5267
414 Ga0495680_0054015 3300047322 Unclassified 3122
415 Ga0495675_0243028 3300047444 Bacteria 1083
416 Ga0495675_0605473 3300047444 Archaea 621
417 Ga0495684_0007666 3300047471 Bacteria 8352
418 Ga0495684_0010071 3300047471 Bacteria 7307
419 Ga0495684_0018344 3300047471 Bacteria 5394
420 Ga0495684_0052680 3300047471 Unclassified 3105
421 Ga0495684_0189421 3300047471 Bacteria 1521
422 Ga0495684_0256146 3300047471 Unclassified 1271
423 Ga0495602_0179520 3300048088 Bacteria 1634
424 Ga0495614_0120496 3300048089 Bacteria 1157
425 Ga0496102_1278276 3300048905 Unclassified 653
426 Ga0496115_0076423 3300048918 Unclassified 2722
427 Ga0496115_0182583 3300048918 Bacteria 1734
428 nmdc:mga05p37_311044_c1 3300050507 Archaea 1526
429 nmdc:mga0n895_409124_c1 3300050512 Archaea 1372
430 nmdc:mga08x19_616644_c1 3300050514 Unclassified 769
431 Ga0495601_0034358 3300053077 Unclassified 3163
432 Ga0495601_0157967 3300053077 Unclassified 1481
433 Ga0495595_0101073 3300053084 Bacteria 1392
434 Ga0157376_10003295
435 Ga0070683_100003150
436 Ga0070683_100017569
437 Ga0070683_100109697
438 Ga0070683_100761473
439 Ga0070670_100364138
440 Ga0070670_100521500
441 Ga0068869_100046068
442 Ga0068869_100189404
443 Ga0070666_10042991
444 Ga0070666_10113592
445 Ga0070666_10141443
446 Ga0070680_100315314
447 Ga0070680_101064886
448 Ga0068868_100037704
449 Ga0068868_100174274
450 Ga0068868_100247736
451 Ga0068868_100852347
452 Ga0068868_100949287
453 Ga0070660_100239950
454 Ga0070661_100316872
455 Ga0070661_100880524
456 Ga0070675_100230025
457 Ga0070675_101554443
458 Ga0070671_100141778
459 Ga0070671_100564809
460 Ga0070673_100171127
461 Ga0070667_100085640
462 Ga0070709_10234347
463 Ga0070709_10665780
464 Ga0070709_10846949
465 Ga0070714_100002047
466 Ga0070713_100005193
467 Ga0070713_100039683
468 Ga0070713_100045410
469 Ga0070713_100840738
470 Ga0070710_10634373
471 Ga0070711_100051407
472 Ga0070711_100400382
473 Ga0070708_100230128
474 Ga0070681_10005895
475 Ga0070681_10245571
476 Ga0070706_101078890
477 Ga0070698_100295890
478 Ga0070679_100042822
479 Ga0070684_100042911
480 Ga0070684_100313395
481 Ga0070684_100639760
482 Ga0070697_100195228
483 Ga0070697_100446168
484 Ga0070697_100753330
485 Ga0068853_100603741
486 Ga0070665_100111825
487 Ga0068855_100019988
488 Ga0068855_100028178
489 Ga0068855_100029521
490 Ga0068855_100067452
491 Ga0068855_100514656
492 Ga0070664_100021458
493 Ga0068857_100029975
494 Ga0068857_100033801
495 Ga0068857_100061431
496 Ga0068856_100002189
497 Ga0068856_100003485
498 Ga0068856_100003899
499 Ga0068856_100177744
500 Ga0068856_100832722
501 Ga0068852_100295973
502 Ga0068859_100333421
503 Ga0068859_100530509
504 Ga0068859_100637750
505 Ga0068859_100740260
506 Ga0068864_100005324
507 Ga0068864_100182737
508 Ga0068864_100245618
509 Ga0068861_100609610
510 Ga0068863_100014697
511 Ga0068863_100055883
512 Ga0068863_100109419
513 Ga0068863_100208743
514 Ga0068863_100403369
515 Ga0068858_100007194
516 Ga0068858_100025665
517 Ga0068858_100084438
518 Ga0068858_101058207
519 Ga0068860_100039459
520 Ga0070717_10038570
521 Ga0070717_10131036
522 Ga0070717_10245854
523 Ga0070717_10337469
524 Ga0097621_100003496
525 Ga0097621_100065098
526 Ga0097621_100096768
527 Ga0097621_100150164
528 Ga0097621_101072773
529 Ga0068871_100023914
530 Ga0068871_100085886
531 Ga0068871_100116675
532 Ga0068871_100265216
533 Ga0068871_100550407
534 Ga0068871_100718818
535 Ga0068871_100845207
536 Ga0075434_100367304
537 Ga0075434_100926409
538 Ga0068865_100165924
539 Ga0075436_100407114
540 Ga0097620_100333405
541 Ga0097620_100530439
542 Ga0097620_100637770
543 Ga0097620_100740258
544 Ga0105240_10003070
545 Ga0105240_10006011
546 Ga0105240_10029531
547 Ga0105240_10071416
548 Ga0105240_10077148
549 Ga0105240_10207997
550 Ga0105240_10359853
551 Ga0105240_10528723
552 Ga0105245_10029033
553 Ga0105245_10050807
554 Ga0105245_10170888
555 Ga0105245_10178930
556 Ga0105245_10225678
557 Ga0105245_10349337
558 Ga0105245_10359530
559 Ga0105245_11689291
560 Ga0105247_10142085
561 Ga0105247_10212526
562 Ga0105247_10226109
563 Ga0105247_10323512
564 Ga0114129_10921037
565 Ga0105243_10693698
566 Ga0105241_10005788
567 Ga0105241_10012616
568 Ga0105241_10121364
569 Ga0105241_10209532
570 Ga0105241_10239444
571 Ga0105241_10480281
572 Ga0105241_10603048
573 Ga0105242_10010642
574 Ga0105242_10015468
575 Ga0105248_10020445
576 Ga0105248_10023542
577 Ga0105248_10142955
578 Ga0105248_10269261
579 Ga0105248_11314348
580 Ga0105237_10006298
581 Ga0105237_10007075
582 Ga0105237_10051992
583 Ga0105238_10002822
584 Ga0105238_10016038
585 Ga0105238_10065775
586 Ga0105238_10119404
587 Ga0105238_10162055
588 Ga0105238_10436190
589 Ga0105239_10001134
590 Ga0105239_10003715
591 Ga0105239_10013336
592 Ga0105239_10171585
593 Ga0105239_10300182
594 Ga0105239_10328955
595 Ga0105239_10505237
596 Ga0105239_10712065
597 Ga0105246_10009373
598 Ga0105246_10643448
599 Ga0157370_10025552
600 Ga0157370_10307803
601 Ga0157369_10002040
602 Ga0157369_10068309
603 Ga0157369_10868325
604 Ga0157374_10088712
605 Ga0157374_10144248
606 Ga0157374_10279905
607 Ga0157374_10797093
608 Ga0157374_11302757
609 Ga0157374_11560244
610 Ga0157378_10002179
611 Ga0157378_10777762
612 Ga0163162_10061997
613 Ga0163162_10490666
614 Ga0163162_10712932
615 Ga0163162_10843208
616 Ga0163162_11048568
617 Ga0157372_10008283
618 Ga0157372_10009581
619 Ga0157372_10780492
620 Ga0157375_10012141
621 Ga0157375_10028063
622 Ga0157375_10281466
623 Ga0157375_10316108
624 Ga0157375_10712847
625 Ga0163163_10008537
626 Ga0163163_10011601
627 Ga0163163_10066753
628 Ga0163163_10105344
629 Ga0163163_10111200
630 Ga0163163_10283685
631 Ga0163163_10344088
632 Ga0163163_10400185
633 Ga0163163_11902491
634 Ga0157377_10322897
635 Ga0157377_10896655
636 Ga0157379_10047684
637 Ga0157379_10671215
638 Ga0157379_10856869
639 Ga0157376_10277948
640 Ga0157376_10316090
641 Ga0157376_10513902
642 Ga0157376_10863477
643 Ga0182007_10100291
644 Ga0207680_10019765
645 Ga0207680_10230095
646 Ga0207699_10425814
647 Ga0207699_10588242
648 Ga0207645_10308453
649 Ga0207654_10003829
650 Ga0207654_10030158
651 Ga0207654_10216997
652 Ga0207654_10642884
653 Ga0207654_10703244
654 Ga0207654_10742967
655 Ga0207707_10014368
656 Ga0207707_10044440
657 Ga0207695_10006818
658 Ga0207695_10013215
659 Ga0207695_10043860
660 Ga0207695_10359329
661 Ga0207695_10659780
662 Ga0207695_10811901
663 Ga0207695_10846533
664 Ga0207671_10060871
665 Ga0207671_10100011
666 Ga0207671_10384435
667 Ga0207663_10018729
668 Ga0207657_10227922
669 Ga0207649_10103995
670 Ga0207652_10039744
671 Ga0207694_10043073
672 Ga0207694_10047899
673 Ga0207694_10601913
674 Ga0207694_11152153
675 Ga0207650_10319247
676 Ga0207687_10036691
677 Ga0207687_10106618
678 Ga0207687_10118233
679 Ga0207687_10321730
680 Ga0207687_10595427
681 Ga0207700_10057644
682 Ga0207700_10059978
683 Ga0207664_10012648
684 Ga0207664_11550836
685 Ga0207644_10215286
686 Ga0207644_10664341
687 Ga0207706_11272428
688 Ga0207686_10009299
689 Ga0207686_10009972
690 Ga0207686_10092950
691 Ga0207711_10057077
692 Ga0207711_10119076
693 Ga0207711_10182337
694 Ga0207711_10193713
695 Ga0207711_10322391
696 Ga0207711_11239628
697 Ga0207689_10260259
698 Ga0207689_10296308
699 Ga0207661_10031154
700 Ga0207661_10042629
701 Ga0207661_10120974
702 Ga0207661_10335234
703 Ga0207679_10349786
704 Ga0207667_10017068
705 Ga0207667_10140130
706 Ga0207667_10390063
707 Ga0207667_10399233
708 Ga0207667_10642671
709 Ga0207667_10963514
710 Ga0207712_10229701
711 Ga0207640_10028404
712 Ga0207658_10073820
713 Ga0207677_10188850
714 Ga0207677_10191075
715 Ga0207677_10238604
716 Ga0207677_10522729
717 Ga0207703_10009305
718 Ga0207703_10027843
719 Ga0207703_11012697
720 Ga0207702_10005068
721 Ga0207702_10018379
722 Ga0207702_10107968
723 Ga0207702_10156683
724 Ga0207702_10225101
725 Ga0207702_10466857
726 Ga0207702_11671271
727 Ga0207641_10010564
728 Ga0207641_10057779
729 Ga0207641_10275050
730 Ga0207641_10421551
731 Ga0207641_10442076
732 Ga0207676_10043072
733 Ga0207676_10113128
734 Ga0207676_10213314
735 Ga0207674_10001542
736 Ga0207674_10100565
737 Ga0207675_100955722
738 Ga0207675_101236628
739 Ga0207698_10054177
740 Ga0207698_11397086
741 Ga0207698_11491285
742 Ga0207698_11563576
743 Ga0268266_10439101
744 Ga0268264_10010879
745 Ga0373926_0303480
746 Ga0373923_0130806
747 Ga0373953_0281575
748 Ga0373954_0000691
749 Ga0373954_0158226
750 Ga0373956_0402477
751 Ga0373943_0478998
752 Ga0373946_0239555
753 Ga0373946_0341271
754 Ga0373955_0032897
755 Ga0373955_0036969
756 Ga0373955_0562288
757 Ga0373924_0117089
758 Ga0373935_0143931
759 Ga0373927_0031750
760 Ga0373927_0233069
761 Ga0373933_0796231
762 Ga0373947_0088213
763 Ga0373947_0161927
764 Ga0373937_0005673
765 Ga0373937_0112679
766 Ga0373937_0962680
767 Ga0373937_1299256
768 Ga0373937_1304504
769 Ga0265778_026521
770 Ga0373925_0142969
771 Ga0373925_0175088
772 Ga0373925_0230226
773 Ga0373925_0713150
774 Ga0373925_0836664
775 Ga0436364_1099359
776 Ga0436365_0177005
777 Ga0436363_0659200
778 Ga0436363_1112611
779 Ga0495592_0159145
780 Ga0495603_0250861
781 Ga0495603_0422288
782 Ga0495629_0031024
783 Ga0495651_0409151
784 Ga0495580_0008865
785 Ga0495580_0038515
786 Ga0495580_0068436
787 Ga0495580_0087147
788 Ga0495580_0581615
789 Ga0495582_0490382
790 Ga0495662_0077502
791 Ga0495664_0018282
792 Ga0495664_0049449
793 Ga0495664_0114934
794 Ga0495664_0142671
795 Ga0495664_0348421
796 Ga0495584_0419464
797 Ga0495594_0009287
798 Ga0495594_0129106
799 Ga0495608_0051424
800 Ga0495618_0585693
801 Ga0495628_0205215
802 Ga0495628_0267914
803 Ga0495630_0114150
804 Ga0495652_0042411
805 Ga0495652_0201551
806 Ga0495665_0388195
807 Ga0495640_0206851
808 Ga0495640_0210682
809 Ga0495586_0076218
810 Ga0495587_0065659
811 Ga0495587_0151037
812 Ga0495645_0032186
813 Ga0495645_0252265
814 Ga0495667_0014735
815 Ga0495667_0284928
816 Ga0495634_0024795
817 Ga0495634_0084522
818 Ga0495634_0104035
819 Ga0495635_0015329
820 Ga0495635_0081883
821 Ga0495635_0194901
822 Ga0495635_0482178
823 Ga0495657_0342512
824 Ga0495657_0564944
825 Ga0495599_0015513
826 Ga0495623_0086021
827 Ga0495623_0113226
828 Ga0495646_0056500
829 Ga0495646_0060983
830 Ga0495646_0295412
831 Ga0495647_0067777
832 Ga0495613_0048500
833 Ga0495613_0187063
834 Ga0495600_0027991
835 Ga0495600_0715711
836 Ga0495604_0111574
837 Ga0495674_0024001
838 Ga0495674_0038532
839 Ga0495674_0064525
840 Ga0495674_0094776
841 Ga0495674_0151048
842 Ga0495674_0191370
843 Ga0495674_0702040
844 Ga0495676_0268424
845 Ga0495676_0798907
846 Ga0495680_0022387
847 Ga0495680_0054015
848 Ga0495675_0243028
849 Ga0495675_0605473
850 Ga0495684_0007666
851 Ga0495684_0010071
852 Ga0495684_0018344
853 Ga0495684_0052680
854 Ga0495684_0189421
855 Ga0495684_0256146
856 Ga0495602_0179520
857 Ga0495614_0120496
858 Ga0496102_1278276
859 Ga0496115_0076423
860 Ga0496115_0182583
861 nmdc:mga05p37_311044_c1
862 nmdc:mga0n895_409124_c1
863 nmdc:mga08x19_616644_c1
864 Ga0495601_0034358
865 Ga0495601_0157967
866 Ga0495595_0101073

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00719

Pyrophosphatase

Inorganic pyrophosphatase

20

173

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1twl-assembly1.cif.gz_A inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 0.8078 3 178
3r6e-assembly1.cif.gz_B the structure of thermococcus thioreducens' inorganic pyrophosphatase bound to sulfate 0.8048 16 178
1twl-assembly1.cif.gz_A inorganic pyrophosphatase from pyrococcus furiosus pfu-264096-001 0.7993 3 178
6mt2-assembly1.cif.gz_B crystal structure of inorganic pyrophosphatase from medicago truncatula (i23 crystal form) 0.7943 1 178
2bqy-assembly1.cif.gz_A inorganic pyrophosphatase from the pathogenic bacterium helicobacter pylori-kinetic and structural properties 0.7888 8 176
ID Description Score Start End Superfamily
4kx8A03 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8546 95 107 2.60.40.1910
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.8084 17 181 3.90.80.10
af_A0A1D6HHJ7_152_313_3.90.80.10 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.7989 17 181 3.90.80.10
2prdA00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.786 2 176 3.90.80.10
4z71B00 Alpha Beta;Alpha-Beta Complex;Inorganic Pyrophosphatase;Inorganic pyrophosphatase 0.7786 17 176 3.90.80.10
ID Description Score Start End GO Terms
AF-A0A369QQ60-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9866 89 178 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A2V9RL42-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.979 76 169 GO:0000287
GO:0004427
GO:0005737
GO:0006796
GO:0016020
AF-A0A537VRL8-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9708 75 178 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A537JRT9-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9701 70 170 GO:0000287
GO:0004427
GO:0005737
GO:0006796
AF-A0A0E9N3S9-F1-model_v4 inorganic diphosphatase (EC 3.6.1.1) 0.9518 51 171 GO:0000287
GO:0004427
GO:0005737
GO:0006796

Map