F442538

General Info

Members Datasets Scaffolds Average Seq Length
432 233 432 169

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10003037|Ga0070709_100030376
Length 186
Sequence MGRVRPEFRPWPRVPLMASTEWWQRGPVDGVPAMLQPVAHILLQVRESVDELVEGLTESEWNARPAGVASPAFHVRHIAGVIDRLFTYARGEALSDAQFAALRSEGATLVAADIAEALRALHTRVDAAVAELRTIDPTTLSDFRSVGRARLPSTVIGCLVHGAEHSMRHVGQLSVTTRIARAGGAQ

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.85
Rhizosphere 97.22
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1013023 3300001976 Bacteria 1086
2 Ga0065712_10097591 3300005290 Unclassified 2146
3 Ga0065712_10150629 3300005290 Bacteria 1373
4 Ga0065712_10269187 3300005290 Unclassified 919
5 Ga0070658_10150502 3300005327 Bacteria 1948
6 Ga0070676_10183012 3300005328 Unclassified 1364
7 Ga0070683_100000684 3300005329 Bacteria 24570
8 Ga0070683_100067312 3300005329 Bacteria 3336
9 Ga0070683_100109199 3300005329 Unclassified 2609
10 Ga0070683_100151521 3300005329 Bacteria 2198
11 Ga0070683_100779158 3300005329 Unclassified 916
12 Ga0070683_100805360 3300005329 Unclassified 901
13 Ga0070690_100206967 3300005330 Unclassified 1368
14 Ga0070670_100478340 3300005331 Unclassified 1106
15 Ga0070670_100485482 3300005331 Unclassified 1097
16 Ga0068869_100248241 3300005334 Bacteria 1420
17 Ga0068869_101094136 3300005334 Unclassified 697
18 Ga0070666_10032334 3300005335 Unclassified 3455
19 Ga0070666_10199057 3300005335 Unclassified 1409
20 Ga0070680_100006449 3300005336 Bacteria 8918
21 Ga0070680_100130750 3300005336 Bacteria 2100
22 Ga0070680_100265117 3300005336 Bacteria 1454
23 Ga0070682_100005921 3300005337 Bacteria 6837
24 Ga0068868_100365695 3300005338 Bacteria 1238
25 Ga0070660_100555339 3300005339 Bacteria 958
26 Ga0070689_100021001 3300005340 Bacteria 4853
27 Ga0070691_10321279 3300005341 Unclassified 851
28 Ga0070661_100023113 3300005344 Bacteria 4454
29 Ga0070661_100042065 3300005344 Unclassified 3334
30 Ga0070661_100105552 3300005344 Bacteria 2100
31 Ga0070661_100435600 3300005344 Unclassified 1041
32 Ga0070692_10024762 3300005345 Unclassified 2953
33 Ga0070669_100198589 3300005353 Bacteria 1577
34 Ga0070675_100130611 3300005354 Unclassified 2140
35 Ga0070675_100354188 3300005354 Bacteria 1302
36 Ga0070671_100390513 3300005355 Unclassified 1190
37 Ga0070671_100853551 3300005355 Unclassified 794
38 Ga0070674_100398269 3300005356 Bacteria 1124
39 Ga0070673_100096466 3300005364 Unclassified 2426
40 Ga0070659_100450759 3300005366 Bacteria 1091
41 Ga0070659_100463378 3300005366 Unclassified 1076
42 Ga0070709_10003037 3300005434 Bacteria 9010
43 Ga0070709_10030953 3300005434 Bacteria 3215
44 Ga0070709_10118811 3300005434 Bacteria 1788
45 Ga0070709_10285101 3300005434 Unclassified 1202
46 Ga0070714_100060116 3300005435 Unclassified 3260
47 Ga0070714_100084912 3300005435 Bacteria 2764
48 Ga0070714_100097402 3300005435 Unclassified 2586
49 Ga0070713_100001273 3300005436 Bacteria 16117
50 Ga0070713_100065441 3300005436 Unclassified 3053
51 Ga0070713_100211078 3300005436 Bacteria 1757
52 Ga0070713_100489729 3300005436 Unclassified 1159
53 Ga0070710_10114908 3300005437 Bacteria 1622
54 Ga0070710_10141824 3300005437 Bacteria 1474
55 Ga0070710_10438186 3300005437 Bacteria 883
56 Ga0070711_100018583 3300005439 Bacteria 4442
57 Ga0070711_100048851 3300005439 Bacteria 2895
58 Ga0070711_100249881 3300005439 Bacteria 1390
59 Ga0070711_100273330 3300005439 Bacteria 1334
60 Ga0070711_100330237 3300005439 Bacteria 1220
61 Ga0070705_100052714 3300005440 Unclassified 2378
62 Ga0070705_100281213 3300005440 Bacteria 1183
63 Ga0070694_101009586 3300005444 Unclassified 691
64 Ga0070708_100010399 3300005445 Bacteria 7541
65 Ga0070662_100087515 3300005457 Bacteria 2332
66 Ga0070662_101082902 3300005457 Unclassified 687
67 Ga0070681_10101254 3300005458 Unclassified 2826
68 Ga0070685_10164701 3300005466 Unclassified 1416
69 Ga0070685_10459202 3300005466 Unclassified 894
70 Ga0070698_100141787 3300005471 Unclassified 2354
71 Ga0070699_100014125 3300005518 Bacteria 6871
72 Ga0070699_100027613 3300005518 Bacteria 4894
73 Ga0070679_100048518 3300005530 Bacteria 4230
74 Ga0070679_100059904 3300005530 Bacteria 3794
75 Ga0070679_100153538 3300005530 Bacteria 2278
76 Ga0070679_100710120 3300005530 Bacteria 948
77 Ga0070679_100769538 3300005530 Unclassified 906
78 Ga0070684_100005806 3300005535 Bacteria 9492
79 Ga0070684_100010282 3300005535 Bacteria 7407
80 Ga0070684_100025087 3300005535 Bacteria 5006
81 Ga0070684_100027076 3300005535 Bacteria 4835
82 Ga0070684_100119155 3300005535 Unclassified 2373
83 Ga0070684_100151012 3300005535 Bacteria 2104
84 Ga0070684_101098965 3300005535 Bacteria 747
85 Ga0070672_100618549 3300005543 Bacteria 944
86 Ga0070672_100809475 3300005543 Unclassified 825
87 Ga0070686_100159527 3300005544 Unclassified 1587
88 Ga0070695_100619908 3300005545 Unclassified 851
89 Ga0070696_100029244 3300005546 Bacteria 3764
90 Ga0070696_100230472 3300005546 Unclassified 1393
91 Ga0070693_100009723 3300005547 Bacteria 4791
92 Ga0070693_100033759 3300005547 Bacteria 2826
93 Ga0068855_100063427 3300005563 Bacteria 4312
94 Ga0068855_100337159 3300005563 Bacteria 1663
95 Ga0068855_100590995 3300005563 Unclassified 1198
96 Ga0068855_100971202 3300005563 Unclassified 894
97 Ga0070664_100049026 3300005564 Bacteria 3571
98 Ga0070664_100374252 3300005564 Bacteria 1299
99 Ga0068857_100803208 3300005577 Unclassified 898
100 Ga0068856_100015981 3300005614 Bacteria 7255
101 Ga0068856_101383714 3300005614 Unclassified 718
102 Ga0070702_100006359 3300005615 Bacteria 5587
103 Ga0068852_100301392 3300005616 Unclassified 1551
104 Ga0068852_100741182 3300005616 Unclassified 994
105 Ga0068859_100055932 3300005617 Unclassified 3970
106 Ga0068864_100168007 3300005618 Bacteria 1998
107 Ga0068864_100532538 3300005618 Bacteria 1134
108 Ga0068864_100758523 3300005618 Bacteria 951
109 Ga0068870_10036966 3300005840 Unclassified 2514
110 Ga0068870_10208975 3300005840 Bacteria 1188
111 Ga0068863_100305293 3300005841 Bacteria 1544
112 Ga0068863_100917725 3300005841 Bacteria 876
113 Ga0068858_100999705 3300005842 Unclassified 820
114 Ga0068860_100322398 3300005843 Unclassified 1516
115 Ga0068860_100704086 3300005843 Bacteria 1020
116 Ga0068862_100181565 3300005844 Bacteria 1889
117 Ga0070717_10001158 3300006028 Bacteria 17814
118 Ga0070717_10192083 3300006028 Bacteria 1784
119 Ga0070716_100306874 3300006173 Unclassified 1106
120 Ga0070716_100757860 3300006173 Unclassified 747
121 Ga0097621_100379968 3300006237 Bacteria 1261
122 Ga0097621_100709451 3300006237 Unclassified 927
123 Ga0068871_100237698 3300006358 Unclassified 1583
124 Ga0068871_101192787 3300006358 Unclassified 714
125 Ga0075428_100816248 3300006844 Bacteria 991
126 Ga0097620_100055929 3300006931 Unclassified 3970
127 Ga0075435_101009112 3300007076 Bacteria 727
128 Ga0105240_10117581 3300009093 Bacteria 3205
129 Ga0105240_10386694 3300009093 Bacteria 1579
130 Ga0111539_10059083 3300009094 Bacteria 4549
131 Ga0105245_10056726 3300009098 Bacteria 3521
132 Ga0105245_10060695 3300009098 Unclassified 3406
133 Ga0105245_10176729 3300009098 Bacteria 2037
134 Ga0114129_10432515 3300009147 Unclassified 1729
135 Ga0114129_10976684 3300009147 Bacteria 1068
136 Ga0105243_10735986 3300009148 Bacteria 965
137 Ga0105241_10407067 3300009174 Unclassified 1194
138 Ga0105242_10010251 3300009176 Bacteria 7186
139 Ga0105242_10308717 3300009176 Unclassified 1446
140 Ga0105248_10028449 3300009177 Bacteria 6227
141 Ga0105248_10059682 3300009177 Bacteria 4285
142 Ga0105248_10060795 3300009177 Unclassified 4241
143 Ga0105248_10539558 3300009177 Bacteria 1316
144 Ga0105238_10067762 3300009551 Bacteria 3569
145 Ga0105238_10129936 3300009551 Unclassified 2497
146 Ga0105239_12682060 3300010375 Unclassified 581
147 Ga0105246_10004486 3300011119 Bacteria 8492
148 Ga0157373_10007387 3300013100 Bacteria 8177
149 Ga0157371_10045738 3300013102 Unclassified 3114
150 Ga0157370_10057144 3300013104 Bacteria 3712
151 Ga0157369_10017818 3300013105 Bacteria 7971
152 Ga0157369_10699463 3300013105 Bacteria 1044
153 Ga0157369_10731060 3300013105 Unclassified 1019
154 Ga0157369_12138160 3300013105 Unclassified 568
155 Ga0157374_10058225 3300013296 Unclassified 3610
156 Ga0157374_10154428 3300013296 Bacteria 2233
157 Ga0157378_10456693 3300013297 Unclassified 1269
158 Ga0157378_10523261 3300013297 Bacteria 1188
159 Ga0157372_10060298 3300013307 Bacteria 4246
160 Ga0157372_10088039 3300013307 Unclassified 3525
161 Ga0157372_10187483 3300013307 Bacteria 2395
162 Ga0157375_10028181 3300013308 Bacteria 5260
163 Ga0157375_10330517 3300013308 Bacteria 1689
164 Ga0157375_10913256 3300013308 Bacteria 1021
165 Ga0163163_10065674 3300014325 Unclassified 3603
166 Ga0163163_10127629 3300014325 Bacteria 2582
167 Ga0163163_10161841 3300014325 Bacteria 2284
168 Ga0163163_10489921 3300014325 Bacteria 1291
169 Ga0163163_10782741 3300014325 Bacteria 1017
170 Ga0157380_10062277 3300014326 Bacteria 2988
171 Ga0157380_10260129 3300014326 Unclassified 1576
172 Ga0157377_10039390 3300014745 Bacteria 2614
173 Ga0157379_10284841 3300014968 Unclassified 1504
174 Ga0157376_10039738 3300014969 Bacteria 3839
175 Ga0157376_10113390 3300014969 Bacteria 2390
176 Ga0157376_10244714 3300014969 Unclassified 1672
177 Ga0182007_10195161 3300015262 Unclassified 705
178 Ga0213876_10489700 3300021384 Bacteria 654
179 Ga0207692_10047328 3300025898 Unclassified 2159
180 Ga0207692_10223619 3300025898 Bacteria 1117
181 Ga0207680_10115418 3300025903 Unclassified 1749
182 Ga0207680_10281860 3300025903 Bacteria 1155
183 Ga0207699_10001120 3300025906 Bacteria 12689
184 Ga0207645_10120083 3300025907 Unclassified 1706
185 Ga0207643_10028182 3300025908 Bacteria 3118
186 Ga0207705_10039042 3300025909 Bacteria 3402
187 Ga0207654_10348542 3300025911 Bacteria 1019
188 Ga0207654_10404608 3300025911 Unclassified 950
189 Ga0207707_10227486 3300025912 Unclassified 1623
190 Ga0207707_10565189 3300025912 Bacteria 965
191 Ga0207695_10008839 3300025913 Bacteria 12543
192 Ga0207695_10883893 3300025913 Unclassified 773
193 Ga0207693_10014685 3300025915 Bacteria 6291
194 Ga0207663_10032949 3300025916 Bacteria 3081
195 Ga0207663_10084403 3300025916 Bacteria 2089
196 Ga0207663_10172300 3300025916 Unclassified 1538
197 Ga0207663_10526200 3300025916 Unclassified 921
198 Ga0207660_10001186 3300025917 Bacteria 17493
199 Ga0207660_10100041 3300025917 Bacteria 2164
200 Ga0207660_10273250 3300025917 Bacteria 1339
201 Ga0207660_10398879 3300025917 Unclassified 1108
202 Ga0207657_10418744 3300025919 Bacteria 1053
203 Ga0207649_10048214 3300025920 Bacteria 2626
204 Ga0207649_10064616 3300025920 Unclassified 2314
205 Ga0207649_10670836 3300025920 Unclassified 802
206 Ga0207649_11411812 3300025920 Unclassified 551
207 Ga0207652_10005376 3300025921 Bacteria 10389
208 Ga0207652_10071343 3300025921 Bacteria 3018
209 Ga0207652_10298341 3300025921 Bacteria 1454
210 Ga0207681_10188343 3300025923 Bacteria 1577
211 Ga0207650_10253110 3300025925 Unclassified 1426
212 Ga0207650_10290396 3300025925 Bacteria 1333
213 Ga0207659_10089972 3300025926 Bacteria 2290
214 Ga0207659_10170615 3300025926 Unclassified 1716
215 Ga0207687_10292870 3300025927 Bacteria 1309
216 Ga0207700_10001794 3300025928 Bacteria 12188
217 Ga0207700_10063811 3300025928 Bacteria 2803
218 Ga0207700_10176945 3300025928 Bacteria 1783
219 Ga0207700_10641997 3300025928 Bacteria 946
220 Ga0207664_10009295 3300025929 Bacteria 6893
221 Ga0207664_10023369 3300025929 Bacteria 4630
222 Ga0207644_11085994 3300025931 Bacteria 672
223 Ga0207690_10010072 3300025932 Bacteria 5615
224 Ga0207690_10398722 3300025932 Bacteria 1097
225 Ga0207706_10059933 3300025933 Bacteria 3352
226 Ga0207686_10139176 3300025934 Bacteria 1675
227 Ga0207670_10212737 3300025936 Unclassified 1475
228 Ga0207669_10634087 3300025937 Bacteria 872
229 Ga0207704_10313342 3300025938 Unclassified 1207
230 Ga0207665_10040986 3300025939 Bacteria 3091
231 Ga0207691_10830241 3300025940 Bacteria 776
232 Ga0207711_10281223 3300025941 Bacteria 1532
233 Ga0207711_10418984 3300025941 Bacteria 1245
234 Ga0207711_10529617 3300025941 Bacteria 1099
235 Ga0207689_10001543 3300025942 Bacteria 21885
236 Ga0207661_10001254 3300025944 Bacteria 16973
237 Ga0207661_10087617 3300025944 Unclassified 2586
238 Ga0207661_10106191 3300025944 Bacteria 2367
239 Ga0207661_10188301 3300025944 Unclassified 1807
240 Ga0207661_11066021 3300025944 Unclassified 744
241 Ga0207679_10086511 3300025945 Unclassified 2411
242 Ga0207679_10385546 3300025945 Unclassified 1229
243 Ga0207679_11273537 3300025945 Unclassified 675
244 Ga0207667_10519738 3300025949 Bacteria 1206
245 Ga0207667_10803962 3300025949 Unclassified 937
246 Ga0207668_10354918 3300025972 Unclassified 1227
247 Ga0207640_10010240 3300025981 Bacteria 5275
248 Ga0207658_10097847 3300025986 Unclassified 2292
249 Ga0207658_10818405 3300025986 Bacteria 846
250 Ga0207677_10033526 3300026023 Bacteria 3316
251 Ga0207677_10258088 3300026023 Bacteria 1419
252 Ga0207703_10303501 3300026035 Bacteria 1457
253 Ga0207678_10276530 3300026067 Bacteria 1440
254 Ga0207702_11311439 3300026078 Unclassified 718
255 Ga0207641_10242847 3300026088 Bacteria 1679
256 Ga0207641_11867236 3300026088 Unclassified 602
257 Ga0207648_10204279 3300026089 Bacteria 1753
258 Ga0207676_10001991 3300026095 Bacteria 14870
259 Ga0207676_10699020 3300026095 Bacteria 982
260 Ga0207676_10842978 3300026095 Bacteria 896
261 Ga0207674_10000210 3300026116 Bacteria 72127
262 Ga0207675_101332497 3300026118 Unclassified 738
263 Ga0207683_10289532 3300026121 Bacteria 1497
264 Ga0207698_10198570 3300026142 Unclassified 1794
265 Ga0207698_10782259 3300026142 Unclassified 955
266 Ga0207428_10059021 3300027907 Bacteria 3043
267 Ga0268265_10289078 3300028380 Bacteria 1471
268 Ga0268264_11304018 3300028381 Unclassified 736
269 Ga0307408_101755439 3300031548 Bacteria 592
270 Ga0373926_0005980 3300035083 Bacteria 4027
271 Ga0373934_0008392 3300035086 Bacteria 3849
272 Ga0373934_0009381 3300035086 Bacteria 3663
273 Ga0373934_0019547 3300035086 Bacteria 2601
274 Ga0373944_0010471 3300035089 Bacteria 2530
275 Ga0373923_0000215 3300035111 Bacteria 12018
276 Ga0373945_0012577 3300035116 Bacteria 2813
277 Ga0373953_0004092 3300035117 Bacteria 4619
278 Ga0373953_0189513 3300035117 Bacteria 888
279 Ga0373954_0097694 3300035118 Bacteria 1415
280 Ga0373956_0007916 3300035119 Bacteria 4290
281 Ga0373956_0041711 3300035119 Bacteria 2038
282 Ga0373957_0007957 3300035120 Bacteria 3414
283 Ga0373943_0002341 3300035170 Bacteria 8607
284 Ga0373955_0018796 3300035172 Bacteria 3444
285 Ga0373924_0003297 3300035410 Bacteria 5530
286 Ga0373935_0000421 3300035692 Bacteria 22081
287 Ga0373935_0077331 3300035692 Bacteria 2157
288 Ga0373927_0001209 3300035695 Bacteria 19588
289 Ga0373933_0011984 3300035724 Bacteria 4786
290 Ga0373933_0019489 3300035724 Bacteria 3832
291 Ga0373947_0000021 3300035725 Bacteria 89576
292 Ga0373947_0277680 3300035725 Bacteria 1113
293 Ga0373937_0000709 3300036401 Bacteria 29066
294 Ga0373937_0000944 3300036401 Bacteria 24720
295 Ga0373937_0093661 3300036401 Bacteria 2785
296 Ga0373937_0570652 3300036401 Bacteria 1075
297 Ga0373925_0001701 3300037068 Bacteria 18531
298 Ga0395905_1276809 3300037471 Unclassified 638
299 Ga0436365_0859341 3300039437 Unclassified 657
300 Ga0436365_1608551 3300039437 Bacteria 1703
301 Ga0451807_0845445 3300041486 Unclassified 509
302 Ga0451853_3779001 3300041512 Bacteria 1319
303 Ga0450917_013573 3300042120 Bacteria 672
304 Ga0466972_0390438 3300044658 Unclassified 652
305 Ga0466961_0078848 3300044693 Unclassified 2086
306 Ga0466963_0689209 3300044694 Bacteria 721
307 Ga0466957_0622978 3300044842 Bacteria 757
308 Ga0466967_0171899 3300045976 Unclassified 2039
309 Ga0466967_0205991 3300045976 Unclassified 1864
310 Ga0466967_0807182 3300045976 Bacteria 932
311 Ga0466967_2203533 3300045976 Bacteria 547
312 Ga0495592_0001141 3300046454 Bacteria 18503
313 Ga0495592_0406883 3300046454 Bacteria 861
314 Ga0495603_0001616 3300046455 Bacteria 13238
315 Ga0495629_0101874 3300046459 Bacteria 2003
316 Ga0495629_0237761 3300046459 Bacteria 1254
317 Ga0495641_0082877 3300046461 Bacteria 1436
318 Ga0495651_0005547 3300046462 Bacteria 9621
319 Ga0495651_0010914 3300046462 Bacteria 6989
320 Ga0495651_0045819 3300046462 Bacteria 3387
321 Ga0495651_0195125 3300046462 Bacteria 1421
322 Ga0495653_0000157 3300046463 Bacteria 56338
323 Ga0495653_0227796 3300046463 Bacteria 1249
324 Ga0495580_0001329 3300046472 Bacteria 21797
325 Ga0495582_0001236 3300046473 Bacteria 14390
326 Ga0495582_0611400 3300046473 Unclassified 631
327 Ga0495639_0000027 3300046475 Bacteria 68298
328 Ga0495594_0025164 3300046499 Bacteria 3200
329 Ga0495608_0014474 3300046511 Bacteria 5472
330 Ga0495608_0059302 3300046511 Bacteria 2522
331 Ga0495618_0050540 3300046514 Bacteria 2626
332 Ga0495618_0271517 3300046514 Bacteria 1060
333 Ga0495628_0001862 3300046516 Bacteria 19161
334 Ga0495628_0191902 3300046516 Bacteria 1542
335 Ga0495628_0622103 3300046516 Bacteria 769
336 Ga0495630_0000527 3300046517 Bacteria 28192
337 Ga0495630_0003904 3300046517 Bacteria 10423
338 Ga0495630_0359896 3300046517 Bacteria 1114
339 Ga0495630_1017241 3300046517 Unclassified 629
340 Ga0495666_0103892 3300046526 Bacteria 1338
341 Ga0495652_0010363 3300046529 Bacteria 8445
342 Ga0495652_0024953 3300046529 Bacteria 5290
343 Ga0495652_0086219 3300046529 Bacteria 2579
344 Ga0495665_0000010 3300046531 Bacteria 71277
345 Ga0495665_0008619 3300046531 Bacteria 5534
346 Ga0495665_0288575 3300046531 Unclassified 841
347 Ga0495640_0294228 3300046533 Bacteria 1009
348 Ga0495586_0070055 3300046535 Bacteria 1915
349 Ga0495587_0001198 3300046536 Bacteria 17158
350 Ga0495587_0001926 3300046536 Bacteria 13813
351 Ga0495645_0000075 3300046543 Bacteria 68269
352 Ga0495645_0004875 3300046543 Bacteria 9173
353 Ga0495645_0202488 3300046543 Bacteria 1345
354 Ga0495667_0003826 3300046559 Bacteria 10113
355 Ga0495667_0008678 3300046559 Bacteria 6898
356 Ga0495667_0012295 3300046559 Bacteria 5801
357 Ga0495667_0036878 3300046559 Bacteria 3260
358 Ga0495634_0253712 3300046642 Bacteria 1075
359 Ga0495634_0349260 3300046642 Bacteria 886
360 Ga0495634_0625820 3300046642 Bacteria 623
361 Ga0495635_0006979 3300046663 Bacteria 7891
362 Ga0495635_0161086 3300046663 Bacteria 1527
363 Ga0495588_0000388 3300046674 Bacteria 25129
364 Ga0495588_0336855 3300046674 Unclassified 793
365 Ga0495657_0001113 3300046675 Bacteria 23531
366 Ga0495657_0046007 3300046675 Bacteria 2958
367 Ga0495657_0267295 3300046675 Bacteria 1026
368 Ga0495599_0000410 3300046678 Bacteria 24560
369 Ga0495599_0013688 3300046678 Bacteria 5015
370 Ga0495623_0000029 3300046679 Bacteria 85797
371 Ga0495623_0020671 3300046679 Bacteria 4255
372 Ga0495623_0037492 3300046679 Bacteria 3102
373 Ga0495623_0171811 3300046679 Bacteria 1266
374 Ga0495646_0000513 3300046680 Bacteria 20769
375 Ga0495658_0000072 3300046683 Bacteria 52083
376 Ga0495613_0022501 3300046689 Bacteria 4695
377 Ga0495613_0113361 3300046689 Bacteria 1952
378 Ga0495613_0178051 3300046689 Bacteria 1506
379 Ga0495600_0000242 3300046809 Bacteria 30005
380 Ga0495600_0046712 3300046809 Bacteria 2824
381 Ga0495600_0286000 3300046809 Bacteria 1043
382 Ga0495600_0532637 3300046809 Unclassified 719
383 Ga0495581_0000458 3300047315 Bacteria 20890
384 Ga0495604_0001545 3300047317 Bacteria 18962
385 Ga0495604_0054272 3300047317 Bacteria 3093
386 Ga0495674_0004815 3300047319 Bacteria 12979
387 Ga0495674_0287570 3300047319 Unclassified 1345
388 Ga0495672_0003327 3300047320 Bacteria 13866
389 Ga0495680_0005714 3300047322 Bacteria 11647
390 Ga0495680_0020509 3300047322 Bacteria 5559
391 Ga0495680_0084887 3300047322 Bacteria 2385
392 Ga0495680_0340689 3300047322 Bacteria 1046
393 Ga0495675_0001136 3300047444 Bacteria 16174
394 Ga0495675_0019810 3300047444 Bacteria 4274
395 Ga0495675_0052296 3300047444 Bacteria 2593
396 Ga0495675_0186773 3300047444 Bacteria 1267
397 Ga0495675_0477656 3300047444 Unclassified 718
398 Ga0495684_0000247 3300047471 Bacteria 42619
399 Ga0495684_0194035 3300047471 Bacteria 1500
400 Ga0495593_0000208 3300047673 Bacteria 30996
401 Ga0495593_0251642 3300047673 Bacteria 885
402 Ga0495602_0001990 3300048088 Bacteria 20504
403 Ga0495602_0127533 3300048088 Bacteria 2035
404 Ga0495602_0159163 3300048088 Bacteria 1765
405 Ga0495602_0223661 3300048088 Bacteria 1419
406 Ga0495614_0000043 3300048089 Bacteria 38806
407 Ga0496104_0897950 3300048907 Bacteria 791
408 Ga0496104_0962036 3300048907 Bacteria 758
409 Ga0496109_0052229 3300048912 Bacteria 3725
410 Ga0496110_0621037 3300048913 Bacteria 979
411 Ga0496111_0302269 3300048914 Bacteria 1186
412 Ga0496112_0003538 3300048915 Bacteria 12966
413 Ga0496113_0099253 3300048916 Bacteria 2255
414 Ga0501033_0171599 3300049570 Bacteria 1557
415 Ga0501033_0270902 3300049570 Unclassified 1200
416 Ga0501034_0090426 3300049571 Bacteria 3059
417 Ga0501034_0576298 3300049571 Bacteria 1033
418 Ga0501038_0079253 3300049574 Bacteria 2770
419 Ga0501070_0037994 3300049586 Bacteria 4018
420 Ga0501073_0356510 3300049589 Bacteria 1010
421 Ga0501077_0330257 3300049593 Unclassified 972
422 Ga0501035_0108318 3300049822 Bacteria 2436
423 Ga0501044_0037849 3300049823 Bacteria 5041
424 nmdc:mga05p37_1465631_c1 3300050507 Bacteria 682
425 nmdc:mga05p37_393821_c1 3300050507 Unclassified 1619
426 nmdc:mga08y16_16097_c1 3300050511 Bacteria 7865
427 nmdc:mga0rr50_916662_c1 3300050513 Bacteria 747
428 Ga0495601_0061339 3300053077 Bacteria 2387
429 Ga0495612_0001787 3300053078 Bacteria 8811
430 Ga0495595_0021665 3300053084 Bacteria 2810
431 Ga0495595_0389063 3300053084 Bacteria 706
432 Ga0495619_0000831 3300053085 Bacteria 20275

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_101082902 Ga0070662_1010829021 147
2 3300005844 Ga0068862_100181565 Ga0068862_1001815652 147
3 3300013308 Ga0157375_10913256 Ga0157375_109132562 147
4 3300014326 Ga0157380_10062277 Ga0157380_100622772 147
5 3300028380 Ga0268265_10289078 Ga0268265_102890782 147
6 3300009147 Ga0114129_10976684 Ga0114129_109766841 150
7 3300041486 Ga0451807_0845445 Ga0451807_0845445_46_498 150
8 3300050507 nmdc:mga05p37_1465631_c1 nmdc:mga05p37_1465631_c1_101_556 150
9 3300037471 Ga0395905_1276809 Ga0395905_1276809_155_616 153
10 3300005546 Ga0070696_100029244 Ga0070696_1000292441 154
11 3300035086 Ga0373934_0019547 Ga0373934_0019547_1655_2122 155
12 3300035117 Ga0373953_0189513 Ga0373953_0189513_268_735 155
13 3300035118 Ga0373954_0097694 Ga0373954_0097694_96_563 155
14 3300035119 Ga0373956_0041711 Ga0373956_0041711_1181_1648 155
15 3300036401 Ga0373937_0093661 Ga0373937_0093661_1625_2092 155
16 3300036401 Ga0373937_0570652 Ga0373937_0570652_207_674 155
17 3300046462 Ga0495651_0195125 Ga0495651_0195125_499_966 155
18 3300046516 Ga0495628_0191902 Ga0495628_0191902_470_937 155
19 3300046559 Ga0495667_0012295 Ga0495667_0012295_2035_2502 155
20 3300046675 Ga0495657_0046007 Ga0495657_0046007_397_864 155
21 3300046679 Ga0495623_0037492 Ga0495623_0037492_654_1121 155
22 3300047317 Ga0495604_0054272 Ga0495604_0054272_419_886 155
23 3300047322 Ga0495680_0340689 Ga0495680_0340689_76_543 155
24 3300047444 Ga0495675_0052296 Ga0495675_0052296_644_1111 155
25 3300048088 Ga0495602_0127533 Ga0495602_0127533_674_1141 155
26 3300013105 Ga0157369_10699463 Ga0157369_106994632 157
27 3300025937 Ga0207669_10634087 Ga0207669_106340872 159
28 3300005341 Ga0070691_10321279 Ga0070691_103212791 161
29 3300005344 Ga0070661_100023113 Ga0070661_1000231132 161
30 3300005518 Ga0070699_100027613 Ga0070699_1000276139 161
31 3300005535 Ga0070684_100025087 Ga0070684_1000250871 161
32 3300005563 Ga0068855_100971202 Ga0068855_1009712021 161
33 3300009093 Ga0105240_10386694 Ga0105240_103866941 161
34 3300013104 Ga0157370_10057144 Ga0157370_100571445 161
35 3300025913 Ga0207695_10008839 Ga0207695_1000883910 161
36 3300025913 Ga0207695_10883893 Ga0207695_108838931 161
37 3300025917 Ga0207660_10100041 Ga0207660_101000412 161
38 3300025921 Ga0207652_10005376 Ga0207652_100053769 161
39 3300025949 Ga0207667_10803962 Ga0207667_108039621 161
40 3300025981 Ga0207640_10010240 Ga0207640_100102408 161
41 3300026067 Ga0207678_10276530 Ga0207678_102765302 161
42 3300005563 Ga0068855_100063427 Ga0068855_1000634271 163
43 3300005437 Ga0070710_10438186 Ga0070710_104381862 165
44 3300046531 Ga0495665_0288575 Ga0495665_0288575_32_529 165
45 3300046543 Ga0495645_0202488 Ga0495645_0202488_25_522 165
46 3300046674 Ga0495588_0336855 Ga0495588_0336855_71_568 165
47 3300046809 Ga0495600_0532637 Ga0495600_0532637_205_702 165
48 3300047444 Ga0495675_0477656 Ga0495675_0477656_47_544 165
49 3300053077 Ga0495601_0061339 Ga0495601_0061339_1467_1964 165
50 3300005353 Ga0070669_100198589 Ga0070669_1001985892 166
51 3300005356 Ga0070674_100398269 Ga0070674_1003982692 166
52 3300005444 Ga0070694_101009586 Ga0070694_1010095861 166
53 3300005840 Ga0068870_10208975 Ga0068870_102089752 166
54 3300013308 Ga0157375_10330517 Ga0157375_103305172 166
55 3300014325 Ga0163163_10782741 Ga0163163_107827412 166
56 3300025923 Ga0207681_10188343 Ga0207681_101883432 166
57 3300025925 Ga0207650_10290396 Ga0207650_102903962 166
58 3300005290 Ga0065712_10269187 Ga0065712_102691872 167
59 3300005328 Ga0070676_10183012 Ga0070676_101830122 167
60 3300005335 Ga0070666_10199057 Ga0070666_101990572 167
61 3300005355 Ga0070671_100853551 Ga0070671_1008535512 167
62 3300005366 Ga0070659_100450759 Ga0070659_1004507592 167
63 3300005434 Ga0070709_10030953 Ga0070709_100309532 167
64 3300005434 Ga0070709_10285101 Ga0070709_102851012 167
65 3300005435 Ga0070714_100060116 Ga0070714_1000601162 167
66 3300005436 Ga0070713_100001273 Ga0070713_1000012738 167
67 3300005439 Ga0070711_100018583 Ga0070711_1000185832 167
68 3300005466 Ga0070685_10164701 Ga0070685_101647012 167
69 3300005543 Ga0070672_100809475 Ga0070672_1008094752 167
70 3300005544 Ga0070686_100159527 Ga0070686_1001595272 167
71 3300005843 Ga0068860_100704086 Ga0068860_1007040862 167
72 3300006028 Ga0070717_10001158 Ga0070717_1000115813 167
73 3300006173 Ga0070716_100757860 Ga0070716_1007578601 167
74 3300006237 Ga0097621_100709451 Ga0097621_1007094512 167
75 3300009098 Ga0105245_10056726 Ga0105245_100567263 167
76 3300009098 Ga0105245_10060695 Ga0105245_100606952 167
77 3300009176 Ga0105242_10010251 Ga0105242_100102512 167
78 3300009176 Ga0105242_10308717 Ga0105242_103087171 167
79 3300009177 Ga0105248_10059682 Ga0105248_100596821 167
80 3300013297 Ga0157378_10456693 Ga0157378_104566931 167
81 3300013307 Ga0157372_10060298 Ga0157372_100602982 167
82 3300013307 Ga0157372_10187483 Ga0157372_101874832 167
83 3300013308 Ga0157375_10028181 Ga0157375_100281813 167
84 3300014969 Ga0157376_10244714 Ga0157376_102447143 167
85 3300025907 Ga0207645_10120083 Ga0207645_101200832 167
86 3300025911 Ga0207654_10348542 Ga0207654_103485422 167
87 3300025915 Ga0207693_10014685 Ga0207693_100146854 167
88 3300025916 Ga0207663_10084403 Ga0207663_100844032 167
89 3300025916 Ga0207663_10172300 Ga0207663_101723002 167
90 3300025928 Ga0207700_10001794 Ga0207700_1000179412 167
91 3300025928 Ga0207700_10063811 Ga0207700_100638114 167
92 3300025929 Ga0207664_10009295 Ga0207664_100092952 167
93 3300025932 Ga0207690_10398722 Ga0207690_103987222 167
94 3300025934 Ga0207686_10139176 Ga0207686_101391762 167
95 3300025938 Ga0207704_10313342 Ga0207704_103133421 167
96 3300025940 Ga0207691_10830241 Ga0207691_108302411 167
97 3300025941 Ga0207711_10418984 Ga0207711_104189842 167
98 3300025949 Ga0207667_10519738 Ga0207667_105197382 167
99 3300025972 Ga0207668_10354918 Ga0207668_103549181 167
100 3300025986 Ga0207658_10097847 Ga0207658_100978472 167
101 3300026023 Ga0207677_10033526 Ga0207677_100335263 167
102 3300026089 Ga0207648_10204279 Ga0207648_102042792 167
103 3300031548 Ga0307408_101755439 Ga0307408_1017554391 167
104 3300035083 Ga0373926_0005980 Ga0373926_0005980_53_556 167
105 3300035089 Ga0373944_0010471 Ga0373944_0010471_18_521 167
106 3300035116 Ga0373945_0012577 Ga0373945_0012577_893_1396 167
107 3300035170 Ga0373943_0002341 Ga0373943_0002341_1322_1825 167
108 3300035692 Ga0373935_0000421 Ga0373935_0000421_17442_17945 167
109 3300035695 Ga0373927_0001209 Ga0373927_0001209_4172_4675 167
110 3300035725 Ga0373947_0000021 Ga0373947_0000021_9534_10037 167
111 3300037068 Ga0373925_0001701 Ga0373925_0001701_14838_15341 167
112 3300041512 Ga0451853_3779001 Ga0451853_3779001_208_711 167
113 3300044694 Ga0466963_0689209 Ga0466963_0689209_188_691 167
114 3300044842 Ga0466957_0622978 Ga0466957_0622978_163_666 167
115 3300045976 Ga0466967_0807182 Ga0466967_0807182_346_849 167
116 3300046455 Ga0495603_0001616 Ga0495603_0001616_1106_1609 167
117 3300046459 Ga0495629_0237761 Ga0495629_0237761_513_1016 167
118 3300046461 Ga0495641_0082877 Ga0495641_0082877_272_775 167
119 3300046472 Ga0495580_0001329 Ga0495580_0001329_2015_2518 167
120 3300046473 Ga0495582_0001236 Ga0495582_0001236_3594_4097 167
121 3300046475 Ga0495639_0000027 Ga0495639_0000027_16527_17030 167
122 3300046517 Ga0495630_0000527 Ga0495630_0000527_26529_27032 167
123 3300046526 Ga0495666_0103892 Ga0495666_0103892_153_656 167
124 3300046531 Ga0495665_0000010 Ga0495665_0000010_8825_9328 167
125 3300046663 Ga0495635_0161086 Ga0495635_0161086_1011_1514 167
126 3300046674 Ga0495588_0000388 Ga0495588_0000388_2945_3448 167
127 3300046683 Ga0495658_0000072 Ga0495658_0000072_47038_47541 167
128 3300046689 Ga0495613_0022501 Ga0495613_0022501_1395_1898 167
129 3300047315 Ga0495581_0000458 Ga0495581_0000458_13646_14149 167
130 3300047320 Ga0495672_0003327 Ga0495672_0003327_11962_12465 167
131 3300047673 Ga0495593_0000208 Ga0495593_0000208_26938_27441 167
132 3300048089 Ga0495614_0000043 Ga0495614_0000043_18867_19370 167
133 3300005290 Ga0065712_10097591 Ga0065712_100975913 168
134 3300005329 Ga0070683_100109199 Ga0070683_1001091992 168
135 3300005336 Ga0070680_100006449 Ga0070680_1000064495 168
136 3300005336 Ga0070680_100265117 Ga0070680_1002651172 168
137 3300005445 Ga0070708_100010399 Ga0070708_1000103993 168
138 3300005471 Ga0070698_100141787 Ga0070698_1001417872 168
139 3300005518 Ga0070699_100014125 Ga0070699_10001412511 168
140 3300005530 Ga0070679_100153538 Ga0070679_1001535381 168
141 3300005530 Ga0070679_100710120 Ga0070679_1007101202 168
142 3300005530 Ga0070679_100769538 Ga0070679_1007695382 168
143 3300005535 Ga0070684_100119155 Ga0070684_1001191552 168
144 3300005543 Ga0070672_100618549 Ga0070672_1006185492 168
145 3300005546 Ga0070696_100230472 Ga0070696_1002304722 168
146 3300005547 Ga0070693_100033759 Ga0070693_1000337594 168
147 3300005564 Ga0070664_100374252 Ga0070664_1003742522 168
148 3300005618 Ga0068864_100532538 Ga0068864_1005325382 168
149 3300006844 Ga0075428_100816248 Ga0075428_1008162482 168
150 3300007076 Ga0075435_101009112 Ga0075435_1010091122 168
151 3300009147 Ga0114129_10432515 Ga0114129_104325151 168
152 3300009177 Ga0105248_10028449 Ga0105248_100284493 168
153 3300014325 Ga0163163_10489921 Ga0163163_104899212 168
154 3300015262 Ga0182007_10195161 Ga0182007_101951612 168
155 3300025912 Ga0207707_10565189 Ga0207707_105651892 168
156 3300025917 Ga0207660_10001186 Ga0207660_100011866 168
157 3300025917 Ga0207660_10398879 Ga0207660_103988792 168
158 3300025920 Ga0207649_11411812 Ga0207649_114118121 168
159 3300025929 Ga0207664_10023369 Ga0207664_100233693 168
160 3300025941 Ga0207711_10529617 Ga0207711_105296172 168
161 3300025944 Ga0207661_10087617 Ga0207661_100876172 168
162 3300025945 Ga0207679_11273537 Ga0207679_112735371 168
163 3300026095 Ga0207676_10842978 Ga0207676_108429782 168
164 3300042120 Ga0450917_013573 Ga0450917_013573_92_598 168
165 3300046454 Ga0495592_0406883 Ga0495592_0406883_60_566 168
166 3300046462 Ga0495651_0045819 Ga0495651_0045819_1633_2139 168
167 3300046463 Ga0495653_0227796 Ga0495653_0227796_500_1006 168
168 3300046473 Ga0495582_0611400 Ga0495582_0611400_52_558 168
169 3300046511 Ga0495608_0059302 Ga0495608_0059302_164_670 168
170 3300046514 Ga0495618_0271517 Ga0495618_0271517_222_728 168
171 3300046516 Ga0495628_0622103 Ga0495628_0622103_185_691 168
172 3300046517 Ga0495630_1017241 Ga0495630_1017241_79_585 168
173 3300046529 Ga0495652_0086219 Ga0495652_0086219_1104_1661 168
174 3300046535 Ga0495586_0070055 Ga0495586_0070055_1284_1790 168
175 3300046559 Ga0495667_0036878 Ga0495667_0036878_1211_1717 168
176 3300046642 Ga0495634_0253712 Ga0495634_0253712_236_742 168
177 3300046642 Ga0495634_0625820 Ga0495634_0625820_58_564 168
178 3300046675 Ga0495657_0267295 Ga0495657_0267295_107_613 168
179 3300046679 Ga0495623_0171811 Ga0495623_0171811_203_709 168
180 3300046689 Ga0495613_0178051 Ga0495613_0178051_63_569 168
181 3300047319 Ga0495674_0287570 Ga0495674_0287570_580_1086 168
182 3300047322 Ga0495680_0020509 Ga0495680_0020509_1384_1890 168
183 3300047322 Ga0495680_0084887 Ga0495680_0084887_1014_1520 168
184 3300047444 Ga0495675_0186773 Ga0495675_0186773_299_805 168
185 3300047673 Ga0495593_0251642 Ga0495593_0251642_184_690 168
186 3300048088 Ga0495602_0159163 Ga0495602_0159163_1024_1530 168
187 3300048907 Ga0496104_0962036 Ga0496104_0962036_127_633 168
188 3300048912 Ga0496109_0052229 Ga0496109_0052229_1951_2457 168
189 3300048913 Ga0496110_0621037 Ga0496110_0621037_217_723 168
190 3300048914 Ga0496111_0302269 Ga0496111_0302269_109_615 168
191 3300048915 Ga0496112_0003538 Ga0496112_0003538_3267_3773 168
192 3300048916 Ga0496113_0099253 Ga0496113_0099253_705_1211 168
193 3300050507 nmdc:mga05p37_393821_c1 nmdc:mga05p37_393821_c1_49_555 168
194 3300050513 nmdc:mga0rr50_916662_c1 nmdc:mga0rr50_916662_c1_52_558 168
195 3300005329 Ga0070683_100000684 Ga0070683_1000006847 169
196 3300005329 Ga0070683_100067312 Ga0070683_1000673125 169
197 3300005329 Ga0070683_100805360 Ga0070683_1008053602 169
198 3300005331 Ga0070670_100478340 Ga0070670_1004783401 169
199 3300005334 Ga0068869_101094136 Ga0068869_1010941361 169
200 3300005344 Ga0070661_100105552 Ga0070661_1001055523 169
201 3300005344 Ga0070661_100435600 Ga0070661_1004356002 169
202 3300005354 Ga0070675_100354188 Ga0070675_1003541882 169
203 3300005436 Ga0070713_100489729 Ga0070713_1004897291 169
204 3300005439 Ga0070711_100249881 Ga0070711_1002498812 169
205 3300005440 Ga0070705_100052714 Ga0070705_1000527142 169
206 3300005440 Ga0070705_100281213 Ga0070705_1002812132 169
207 3300005530 Ga0070679_100059904 Ga0070679_1000599042 169
208 3300005535 Ga0070684_100027076 Ga0070684_1000270766 169
209 3300005535 Ga0070684_100151012 Ga0070684_1001510123 169
210 3300005535 Ga0070684_101098965 Ga0070684_1010989652 169
211 3300005564 Ga0070664_100049026 Ga0070664_1000490265 169
212 3300005614 Ga0068856_101383714 Ga0068856_1013837141 169
213 3300005616 Ga0068852_100301392 Ga0068852_1003013922 169
214 3300005618 Ga0068864_100758523 Ga0068864_1007585232 169
215 3300006358 Ga0068871_101192787 Ga0068871_1011927871 169
216 3300009551 Ga0105238_10067762 Ga0105238_100677623 169
217 3300013105 Ga0157369_12138160 Ga0157369_121381601 169
218 3300014326 Ga0157380_10260129 Ga0157380_102601293 169
219 3300021384 Ga0213876_10489700 Ga0213876_104897001 169
220 3300025916 Ga0207663_10032949 Ga0207663_100329494 169
221 3300025920 Ga0207649_10048214 Ga0207649_100482142 169
222 3300025920 Ga0207649_10670836 Ga0207649_106708361 169
223 3300025921 Ga0207652_10071343 Ga0207652_100713433 169
224 3300025927 Ga0207687_10292870 Ga0207687_102928702 169
225 3300025944 Ga0207661_10001254 Ga0207661_1000125413 169
226 3300025944 Ga0207661_11066021 Ga0207661_110660211 169
227 3300025945 Ga0207679_10385546 Ga0207679_103855462 169
228 3300026078 Ga0207702_11311439 Ga0207702_113114391 169
229 3300026095 Ga0207676_10699020 Ga0207676_106990202 169
230 3300026118 Ga0207675_101332497 Ga0207675_1013324971 169
231 3300026142 Ga0207698_10198570 Ga0207698_101985705 169
232 3300035086 Ga0373934_0009381 Ga0373934_0009381_211_720 169
233 3300035111 Ga0373923_0000215 Ga0373923_0000215_986_1495 169
234 3300035117 Ga0373953_0004092 Ga0373953_0004092_1643_2152 169
235 3300035120 Ga0373957_0007957 Ga0373957_0007957_710_1219 169
236 3300035410 Ga0373924_0003297 Ga0373924_0003297_655_1164 169
237 3300035692 Ga0373935_0077331 Ga0373935_0077331_681_1190 169
238 3300035724 Ga0373933_0019489 Ga0373933_0019489_2929_3438 169
239 3300035725 Ga0373947_0277680 Ga0373947_0277680_452_961 169
240 3300036401 Ga0373937_0000709 Ga0373937_0000709_3994_4503 169
241 3300039437 Ga0436365_0859341 Ga0436365_0859341_46_555 169
242 3300039437 Ga0436365_1608551 Ga0436365_1608551_267_776 169
243 3300044658 Ga0466972_0390438 Ga0466972_0390438_56_565 169
244 3300044693 Ga0466961_0078848 Ga0466961_0078848_1547_2059 169
245 3300045976 Ga0466967_0171899 Ga0466967_0171899_275_784 169
246 3300045976 Ga0466967_0205991 Ga0466967_0205991_1145_1654 169
247 3300045976 Ga0466967_2203533 Ga0466967_2203533_22_531 169
248 3300046454 Ga0495592_0001141 Ga0495592_0001141_13368_13877 169
249 3300046459 Ga0495629_0101874 Ga0495629_0101874_1224_1733 169
250 3300046462 Ga0495651_0005547 Ga0495651_0005547_4019_4528 169
251 3300046463 Ga0495653_0000157 Ga0495653_0000157_12157_12666 169
252 3300046511 Ga0495608_0014474 Ga0495608_0014474_4696_5205 169
253 3300046514 Ga0495618_0050540 Ga0495618_0050540_704_1213 169
254 3300046516 Ga0495628_0001862 Ga0495628_0001862_15706_16215 169
255 3300046517 Ga0495630_0003904 Ga0495630_0003904_883_1392 169
256 3300046529 Ga0495652_0010363 Ga0495652_0010363_4443_4952 169
257 3300046531 Ga0495665_0008619 Ga0495665_0008619_1758_2267 169
258 3300046533 Ga0495640_0294228 Ga0495640_0294228_397_906 169
259 3300046536 Ga0495587_0001926 Ga0495587_0001926_8899_9408 169
260 3300046543 Ga0495645_0004875 Ga0495645_0004875_3889_4398 169
261 3300046559 Ga0495667_0008678 Ga0495667_0008678_3536_4045 169
262 3300046642 Ga0495634_0349260 Ga0495634_0349260_55_564 169
263 3300046663 Ga0495635_0006979 Ga0495635_0006979_4563_5072 169
264 3300046675 Ga0495657_0001113 Ga0495657_0001113_6959_7468 169
265 3300046678 Ga0495599_0000410 Ga0495599_0000410_2847_3356 169
266 3300046679 Ga0495623_0000029 Ga0495623_0000029_30541_31050 169
267 3300046680 Ga0495646_0000513 Ga0495646_0000513_16630_17139 169
268 3300046689 Ga0495613_0113361 Ga0495613_0113361_1101_1610 169
269 3300046809 Ga0495600_0000242 Ga0495600_0000242_13313_13822 169
270 3300047317 Ga0495604_0001545 Ga0495604_0001545_14562_15071 169
271 3300047319 Ga0495674_0004815 Ga0495674_0004815_701_1210 169
272 3300047322 Ga0495680_0005714 Ga0495680_0005714_5635_6144 169
273 3300047444 Ga0495675_0001136 Ga0495675_0001136_2933_3442 169
274 3300047471 Ga0495684_0000247 Ga0495684_0000247_6959_7468 169
275 3300048088 Ga0495602_0001990 Ga0495602_0001990_3890_4399 169
276 3300049570 Ga0501033_0270902 Ga0501033_0270902_118_627 169
277 3300049571 Ga0501034_0576298 Ga0501034_0576298_510_1019 169
278 3300049586 Ga0501070_0037994 Ga0501070_0037994_935_1444 169
279 3300049589 Ga0501073_0356510 Ga0501073_0356510_17_526 169
280 3300049593 Ga0501077_0330257 Ga0501077_0330257_435_944 169
281 3300053078 Ga0495612_0001787 Ga0495612_0001787_4995_5504 169
282 3300053084 Ga0495595_0021665 Ga0495595_0021665_2282_2791 169
283 3300053085 Ga0495619_0000831 Ga0495619_0000831_16892_17401 169
284 3300005434 Ga0070709_10003037 Ga0070709_100030376 170
285 3300005434 Ga0070709_10118811 Ga0070709_101188112 170
286 3300005435 Ga0070714_100084912 Ga0070714_1000849123 170
287 3300005436 Ga0070713_100065441 Ga0070713_1000654413 170
288 3300005436 Ga0070713_100211078 Ga0070713_1002110782 170
289 3300005437 Ga0070710_10141824 Ga0070710_101418242 170
290 3300005439 Ga0070711_100273330 Ga0070711_1002733301 170
291 3300006028 Ga0070717_10192083 Ga0070717_101920831 170
292 3300006173 Ga0070716_100306874 Ga0070716_1003068742 170
293 3300009094 Ga0111539_10059083 Ga0111539_100590833 170
294 3300013296 Ga0157374_10154428 Ga0157374_101544283 170
295 3300014969 Ga0157376_10113390 Ga0157376_101133903 170
296 3300025898 Ga0207692_10223619 Ga0207692_102236192 170
297 3300025906 Ga0207699_10001120 Ga0207699_1000112010 170
298 3300025916 Ga0207663_10526200 Ga0207663_105262001 170
299 3300025926 Ga0207659_10089972 Ga0207659_100899722 170
300 3300025928 Ga0207700_10176945 Ga0207700_101769452 170
301 3300025928 Ga0207700_10641997 Ga0207700_106419972 170
302 3300025939 Ga0207665_10040986 Ga0207665_100409862 170
303 3300027907 Ga0207428_10059021 Ga0207428_100590213 170
304 3300035086 Ga0373934_0008392 Ga0373934_0008392_577_1089 170
305 3300035119 Ga0373956_0007916 Ga0373956_0007916_1546_2058 170
306 3300035172 Ga0373955_0018796 Ga0373955_0018796_1248_1760 170
307 3300035724 Ga0373933_0011984 Ga0373933_0011984_147_659 170
308 3300036401 Ga0373937_0000944 Ga0373937_0000944_8877_9389 170
309 3300046462 Ga0495651_0010914 Ga0495651_0010914_3680_4192 170
310 3300046517 Ga0495630_0359896 Ga0495630_0359896_166_678 170
311 3300046529 Ga0495652_0024953 Ga0495652_0024953_675_1187 170
312 3300046536 Ga0495587_0001198 Ga0495587_0001198_6743_7255 170
313 3300046543 Ga0495645_0000075 Ga0495645_0000075_63863_64375 170
314 3300046559 Ga0495667_0003826 Ga0495667_0003826_5446_5958 170
315 3300046678 Ga0495599_0013688 Ga0495599_0013688_2142_2654 170
316 3300046679 Ga0495623_0020671 Ga0495623_0020671_1692_2204 170
317 3300046809 Ga0495600_0046712 Ga0495600_0046712_1381_1893 170
318 3300047444 Ga0495675_0019810 Ga0495675_0019810_1235_1747 170
319 3300047471 Ga0495684_0194035 Ga0495684_0194035_574_1086 170
320 3300048088 Ga0495602_0223661 Ga0495602_0223661_766_1278 170
321 3300048907 Ga0496104_0897950 Ga0496104_0897950_199_711 170
322 3300050511 nmdc:mga08y16_16097_c1 nmdc:mga08y16_16097_c1_4015_4527 170
323 3300053084 Ga0495595_0389063 Ga0495595_0389063_41_553 170
324 3300005841 Ga0068863_100305293 Ga0068863_1003052932 171
325 3300009177 Ga0105248_10539558 Ga0105248_105395582 171
326 3300014325 Ga0163163_10065674 Ga0163163_100656746 171
327 3300014325 Ga0163163_10127629 Ga0163163_101276291 171
328 3300026088 Ga0207641_10242847 Ga0207641_102428472 171
329 3300046499 Ga0495594_0025164 Ga0495594_0025164_1038_1553 171
330 3300046809 Ga0495600_0286000 Ga0495600_0286000_299_814 171
331 3300001976 JGI24752J21851_1013023 JGI24752J21851_10130232 172
332 3300005290 Ga0065712_10150629 Ga0065712_101506292 172
333 3300005327 Ga0070658_10150502 Ga0070658_101505023 172
334 3300005329 Ga0070683_100151521 Ga0070683_1001515213 172
335 3300005329 Ga0070683_100779158 Ga0070683_1007791582 172
336 3300005330 Ga0070690_100206967 Ga0070690_1002069671 172
337 3300005331 Ga0070670_100485482 Ga0070670_1004854822 172
338 3300005334 Ga0068869_100248241 Ga0068869_1002482412 172
339 3300005335 Ga0070666_10032334 Ga0070666_100323343 172
340 3300005336 Ga0070680_100130750 Ga0070680_1001307501 172
341 3300005337 Ga0070682_100005921 Ga0070682_1000059219 172
342 3300005338 Ga0068868_100365695 Ga0068868_1003656952 172
343 3300005339 Ga0070660_100555339 Ga0070660_1005553392 172
344 3300005340 Ga0070689_100021001 Ga0070689_1000210015 172
345 3300005344 Ga0070661_100042065 Ga0070661_1000420654 172
346 3300005345 Ga0070692_10024762 Ga0070692_100247623 172
347 3300005354 Ga0070675_100130611 Ga0070675_1001306112 172
348 3300005355 Ga0070671_100390513 Ga0070671_1003905132 172
349 3300005364 Ga0070673_100096466 Ga0070673_1000964662 172
350 3300005366 Ga0070659_100463378 Ga0070659_1004633781 172
351 3300005435 Ga0070714_100097402 Ga0070714_1000974023 172
352 3300005437 Ga0070710_10114908 Ga0070710_101149083 172
353 3300005439 Ga0070711_100048851 Ga0070711_1000488514 172
354 3300005439 Ga0070711_100330237 Ga0070711_1003302372 172
355 3300005457 Ga0070662_100087515 Ga0070662_1000875152 172
356 3300005458 Ga0070681_10101254 Ga0070681_101012542 172
357 3300005466 Ga0070685_10459202 Ga0070685_104592021 172
358 3300005530 Ga0070679_100048518 Ga0070679_1000485182 172
359 3300005535 Ga0070684_100005806 Ga0070684_10000580610 172
360 3300005535 Ga0070684_100010282 Ga0070684_1000102822 172
361 3300005545 Ga0070695_100619908 Ga0070695_1006199082 172
362 3300005547 Ga0070693_100009723 Ga0070693_1000097233 172
363 3300005563 Ga0068855_100337159 Ga0068855_1003371591 172
364 3300005563 Ga0068855_100590995 Ga0068855_1005909952 172
365 3300005577 Ga0068857_100803208 Ga0068857_1008032082 172
366 3300005614 Ga0068856_100015981 Ga0068856_1000159819 172
367 3300005615 Ga0070702_100006359 Ga0070702_1000063595 172
368 3300005616 Ga0068852_100741182 Ga0068852_1007411822 172
369 3300005617 Ga0068859_100055932 Ga0068859_1000559322 172
370 3300005618 Ga0068864_100168007 Ga0068864_1001680072 172
371 3300005840 Ga0068870_10036966 Ga0068870_100369663 172
372 3300005841 Ga0068863_100917725 Ga0068863_1009177251 172
373 3300005842 Ga0068858_100999705 Ga0068858_1009997051 172
374 3300005843 Ga0068860_100322398 Ga0068860_1003223982 172
375 3300006237 Ga0097621_100379968 Ga0097621_1003799682 172
376 3300006358 Ga0068871_100237698 Ga0068871_1002376982 172
377 3300006931 Ga0097620_100055929 Ga0097620_1000559293 172
378 3300009093 Ga0105240_10117581 Ga0105240_101175813 172
379 3300009098 Ga0105245_10176729 Ga0105245_101767292 172
380 3300009148 Ga0105243_10735986 Ga0105243_107359861 172
381 3300009174 Ga0105241_10407067 Ga0105241_104070671 172
382 3300009177 Ga0105248_10060795 Ga0105248_100607951 172
383 3300009551 Ga0105238_10129936 Ga0105238_101299362 172
384 3300010375 Ga0105239_12682060 Ga0105239_126820601 172
385 3300011119 Ga0105246_10004486 Ga0105246_100044863 172
386 3300013100 Ga0157373_10007387 Ga0157373_100073872 172
387 3300013102 Ga0157371_10045738 Ga0157371_100457381 172
388 3300013105 Ga0157369_10017818 Ga0157369_100178184 172
389 3300013105 Ga0157369_10731060 Ga0157369_107310602 172
390 3300013296 Ga0157374_10058225 Ga0157374_100582254 172
391 3300013297 Ga0157378_10523261 Ga0157378_105232612 172
392 3300013307 Ga0157372_10088039 Ga0157372_100880393 172
393 3300014325 Ga0163163_10161841 Ga0163163_101618412 172
394 3300014745 Ga0157377_10039390 Ga0157377_100393902 172
395 3300014968 Ga0157379_10284841 Ga0157379_102848411 172
396 3300014969 Ga0157376_10039738 Ga0157376_100397384 172
397 3300025898 Ga0207692_10047328 Ga0207692_100473283 172
398 3300025903 Ga0207680_10115418 Ga0207680_101154182 172
399 3300025903 Ga0207680_10281860 Ga0207680_102818602 172
400 3300025908 Ga0207643_10028182 Ga0207643_100281823 172
401 3300025909 Ga0207705_10039042 Ga0207705_100390422 172
402 3300025911 Ga0207654_10404608 Ga0207654_104046081 172
403 3300025912 Ga0207707_10227486 Ga0207707_102274861 172
404 3300025917 Ga0207660_10273250 Ga0207660_102732502 172
405 3300025919 Ga0207657_10418744 Ga0207657_104187442 172
406 3300025920 Ga0207649_10064616 Ga0207649_100646162 172
407 3300025921 Ga0207652_10298341 Ga0207652_102983412 172
408 3300025925 Ga0207650_10253110 Ga0207650_102531102 172
409 3300025926 Ga0207659_10170615 Ga0207659_101706152 172
410 3300025931 Ga0207644_11085994 Ga0207644_110859941 172
411 3300025932 Ga0207690_10010072 Ga0207690_100100724 172
412 3300025933 Ga0207706_10059933 Ga0207706_100599332 172
413 3300025936 Ga0207670_10212737 Ga0207670_102127372 172
414 3300025941 Ga0207711_10281223 Ga0207711_102812232 172
415 3300025942 Ga0207689_10001543 Ga0207689_1000154317 172
416 3300025944 Ga0207661_10106191 Ga0207661_101061912 172
417 3300025944 Ga0207661_10188301 Ga0207661_101883012 172
418 3300025945 Ga0207679_10086511 Ga0207679_100865112 172
419 3300025986 Ga0207658_10818405 Ga0207658_108184052 172
420 3300026023 Ga0207677_10258088 Ga0207677_102580881 172
421 3300026035 Ga0207703_10303501 Ga0207703_103035012 172
422 3300026088 Ga0207641_11867236 Ga0207641_118672361 172
423 3300026095 Ga0207676_10001991 Ga0207676_100019919 172
424 3300026116 Ga0207674_10000210 Ga0207674_100002105 172
425 3300026121 Ga0207683_10289532 Ga0207683_102895322 172
426 3300026142 Ga0207698_10782259 Ga0207698_107822592 172
427 3300028381 Ga0268264_11304018 Ga0268264_113040181 172
428 3300049570 Ga0501033_0171599 Ga0501033_0171599_1004_1525 172
429 3300049571 Ga0501034_0090426 Ga0501034_0090426_1003_1524 172
430 3300049574 Ga0501038_0079253 Ga0501038_0079253_2046_2567 172
431 3300049822 Ga0501035_0108318 Ga0501035_0108318_1482_2003 172
432 3300049823 Ga0501044_0037849 Ga0501044_0037849_1991_2512 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

41

173

0.79

PF04978

DUF664

Protein of unknown function (DUF664)

38

179

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.8165 14 165
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8049 18 166
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8004 18 159
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.7994 1 163
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.7978 9 163
ID Description Score Start End Superfamily
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8048 15 163 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7925 17 164 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7893 20 156 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7843 15 163 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7785 15 165 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A6M4IVF4-F1-model_v4 DinB family protein 0.989 1 166
AF-A0A4Q5RHQ0-F1-model_v4 DinB family protein 0.976 16 165
AF-A0A559NV87-F1-model_v4 DinB family protein 0.9716 2 166
AF-A0A1I5XWE7-F1-model_v4 DinB superfamily protein 0.9693 3 165
AF-A0A1Q4G926-F1-model_v4 Metal-dependent hydrolase 0.9674 1 161 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.92 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map