F442538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 432 | 233 | 432 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10003037|Ga0070709_100030376 |
| Length | 186 |
| Sequence | MGRVRPEFRPWPRVPLMASTEWWQRGPVDGVPAMLQPVAHILLQVRESVDELVEGLTESEWNARPAGVASPAFHVRHIAGVIDRLFTYARGEALSDAQFAALRSEGATLVAADIAEALRALHTRVDAAVAELRTIDPTTLSDFRSVGRARLPSTVIGCLVHGAEHSMRHVGQLSVTTRIARAGGAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 144 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 152 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 163 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 164 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 165 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 166 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.85 |
| Rhizosphere | 97.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1013023 | 3300001976 | Bacteria | 1086 |
| 2 | Ga0065712_10097591 | 3300005290 | Unclassified | 2146 |
| 3 | Ga0065712_10150629 | 3300005290 | Bacteria | 1373 |
| 4 | Ga0065712_10269187 | 3300005290 | Unclassified | 919 |
| 5 | Ga0070658_10150502 | 3300005327 | Bacteria | 1948 |
| 6 | Ga0070676_10183012 | 3300005328 | Unclassified | 1364 |
| 7 | Ga0070683_100000684 | 3300005329 | Bacteria | 24570 |
| 8 | Ga0070683_100067312 | 3300005329 | Bacteria | 3336 |
| 9 | Ga0070683_100109199 | 3300005329 | Unclassified | 2609 |
| 10 | Ga0070683_100151521 | 3300005329 | Bacteria | 2198 |
| 11 | Ga0070683_100779158 | 3300005329 | Unclassified | 916 |
| 12 | Ga0070683_100805360 | 3300005329 | Unclassified | 901 |
| 13 | Ga0070690_100206967 | 3300005330 | Unclassified | 1368 |
| 14 | Ga0070670_100478340 | 3300005331 | Unclassified | 1106 |
| 15 | Ga0070670_100485482 | 3300005331 | Unclassified | 1097 |
| 16 | Ga0068869_100248241 | 3300005334 | Bacteria | 1420 |
| 17 | Ga0068869_101094136 | 3300005334 | Unclassified | 697 |
| 18 | Ga0070666_10032334 | 3300005335 | Unclassified | 3455 |
| 19 | Ga0070666_10199057 | 3300005335 | Unclassified | 1409 |
| 20 | Ga0070680_100006449 | 3300005336 | Bacteria | 8918 |
| 21 | Ga0070680_100130750 | 3300005336 | Bacteria | 2100 |
| 22 | Ga0070680_100265117 | 3300005336 | Bacteria | 1454 |
| 23 | Ga0070682_100005921 | 3300005337 | Bacteria | 6837 |
| 24 | Ga0068868_100365695 | 3300005338 | Bacteria | 1238 |
| 25 | Ga0070660_100555339 | 3300005339 | Bacteria | 958 |
| 26 | Ga0070689_100021001 | 3300005340 | Bacteria | 4853 |
| 27 | Ga0070691_10321279 | 3300005341 | Unclassified | 851 |
| 28 | Ga0070661_100023113 | 3300005344 | Bacteria | 4454 |
| 29 | Ga0070661_100042065 | 3300005344 | Unclassified | 3334 |
| 30 | Ga0070661_100105552 | 3300005344 | Bacteria | 2100 |
| 31 | Ga0070661_100435600 | 3300005344 | Unclassified | 1041 |
| 32 | Ga0070692_10024762 | 3300005345 | Unclassified | 2953 |
| 33 | Ga0070669_100198589 | 3300005353 | Bacteria | 1577 |
| 34 | Ga0070675_100130611 | 3300005354 | Unclassified | 2140 |
| 35 | Ga0070675_100354188 | 3300005354 | Bacteria | 1302 |
| 36 | Ga0070671_100390513 | 3300005355 | Unclassified | 1190 |
| 37 | Ga0070671_100853551 | 3300005355 | Unclassified | 794 |
| 38 | Ga0070674_100398269 | 3300005356 | Bacteria | 1124 |
| 39 | Ga0070673_100096466 | 3300005364 | Unclassified | 2426 |
| 40 | Ga0070659_100450759 | 3300005366 | Bacteria | 1091 |
| 41 | Ga0070659_100463378 | 3300005366 | Unclassified | 1076 |
| 42 | Ga0070709_10003037 | 3300005434 | Bacteria | 9010 |
| 43 | Ga0070709_10030953 | 3300005434 | Bacteria | 3215 |
| 44 | Ga0070709_10118811 | 3300005434 | Bacteria | 1788 |
| 45 | Ga0070709_10285101 | 3300005434 | Unclassified | 1202 |
| 46 | Ga0070714_100060116 | 3300005435 | Unclassified | 3260 |
| 47 | Ga0070714_100084912 | 3300005435 | Bacteria | 2764 |
| 48 | Ga0070714_100097402 | 3300005435 | Unclassified | 2586 |
| 49 | Ga0070713_100001273 | 3300005436 | Bacteria | 16117 |
| 50 | Ga0070713_100065441 | 3300005436 | Unclassified | 3053 |
| 51 | Ga0070713_100211078 | 3300005436 | Bacteria | 1757 |
| 52 | Ga0070713_100489729 | 3300005436 | Unclassified | 1159 |
| 53 | Ga0070710_10114908 | 3300005437 | Bacteria | 1622 |
| 54 | Ga0070710_10141824 | 3300005437 | Bacteria | 1474 |
| 55 | Ga0070710_10438186 | 3300005437 | Bacteria | 883 |
| 56 | Ga0070711_100018583 | 3300005439 | Bacteria | 4442 |
| 57 | Ga0070711_100048851 | 3300005439 | Bacteria | 2895 |
| 58 | Ga0070711_100249881 | 3300005439 | Bacteria | 1390 |
| 59 | Ga0070711_100273330 | 3300005439 | Bacteria | 1334 |
| 60 | Ga0070711_100330237 | 3300005439 | Bacteria | 1220 |
| 61 | Ga0070705_100052714 | 3300005440 | Unclassified | 2378 |
| 62 | Ga0070705_100281213 | 3300005440 | Bacteria | 1183 |
| 63 | Ga0070694_101009586 | 3300005444 | Unclassified | 691 |
| 64 | Ga0070708_100010399 | 3300005445 | Bacteria | 7541 |
| 65 | Ga0070662_100087515 | 3300005457 | Bacteria | 2332 |
| 66 | Ga0070662_101082902 | 3300005457 | Unclassified | 687 |
| 67 | Ga0070681_10101254 | 3300005458 | Unclassified | 2826 |
| 68 | Ga0070685_10164701 | 3300005466 | Unclassified | 1416 |
| 69 | Ga0070685_10459202 | 3300005466 | Unclassified | 894 |
| 70 | Ga0070698_100141787 | 3300005471 | Unclassified | 2354 |
| 71 | Ga0070699_100014125 | 3300005518 | Bacteria | 6871 |
| 72 | Ga0070699_100027613 | 3300005518 | Bacteria | 4894 |
| 73 | Ga0070679_100048518 | 3300005530 | Bacteria | 4230 |
| 74 | Ga0070679_100059904 | 3300005530 | Bacteria | 3794 |
| 75 | Ga0070679_100153538 | 3300005530 | Bacteria | 2278 |
| 76 | Ga0070679_100710120 | 3300005530 | Bacteria | 948 |
| 77 | Ga0070679_100769538 | 3300005530 | Unclassified | 906 |
| 78 | Ga0070684_100005806 | 3300005535 | Bacteria | 9492 |
| 79 | Ga0070684_100010282 | 3300005535 | Bacteria | 7407 |
| 80 | Ga0070684_100025087 | 3300005535 | Bacteria | 5006 |
| 81 | Ga0070684_100027076 | 3300005535 | Bacteria | 4835 |
| 82 | Ga0070684_100119155 | 3300005535 | Unclassified | 2373 |
| 83 | Ga0070684_100151012 | 3300005535 | Bacteria | 2104 |
| 84 | Ga0070684_101098965 | 3300005535 | Bacteria | 747 |
| 85 | Ga0070672_100618549 | 3300005543 | Bacteria | 944 |
| 86 | Ga0070672_100809475 | 3300005543 | Unclassified | 825 |
| 87 | Ga0070686_100159527 | 3300005544 | Unclassified | 1587 |
| 88 | Ga0070695_100619908 | 3300005545 | Unclassified | 851 |
| 89 | Ga0070696_100029244 | 3300005546 | Bacteria | 3764 |
| 90 | Ga0070696_100230472 | 3300005546 | Unclassified | 1393 |
| 91 | Ga0070693_100009723 | 3300005547 | Bacteria | 4791 |
| 92 | Ga0070693_100033759 | 3300005547 | Bacteria | 2826 |
| 93 | Ga0068855_100063427 | 3300005563 | Bacteria | 4312 |
| 94 | Ga0068855_100337159 | 3300005563 | Bacteria | 1663 |
| 95 | Ga0068855_100590995 | 3300005563 | Unclassified | 1198 |
| 96 | Ga0068855_100971202 | 3300005563 | Unclassified | 894 |
| 97 | Ga0070664_100049026 | 3300005564 | Bacteria | 3571 |
| 98 | Ga0070664_100374252 | 3300005564 | Bacteria | 1299 |
| 99 | Ga0068857_100803208 | 3300005577 | Unclassified | 898 |
| 100 | Ga0068856_100015981 | 3300005614 | Bacteria | 7255 |
| 101 | Ga0068856_101383714 | 3300005614 | Unclassified | 718 |
| 102 | Ga0070702_100006359 | 3300005615 | Bacteria | 5587 |
| 103 | Ga0068852_100301392 | 3300005616 | Unclassified | 1551 |
| 104 | Ga0068852_100741182 | 3300005616 | Unclassified | 994 |
| 105 | Ga0068859_100055932 | 3300005617 | Unclassified | 3970 |
| 106 | Ga0068864_100168007 | 3300005618 | Bacteria | 1998 |
| 107 | Ga0068864_100532538 | 3300005618 | Bacteria | 1134 |
| 108 | Ga0068864_100758523 | 3300005618 | Bacteria | 951 |
| 109 | Ga0068870_10036966 | 3300005840 | Unclassified | 2514 |
| 110 | Ga0068870_10208975 | 3300005840 | Bacteria | 1188 |
| 111 | Ga0068863_100305293 | 3300005841 | Bacteria | 1544 |
| 112 | Ga0068863_100917725 | 3300005841 | Bacteria | 876 |
| 113 | Ga0068858_100999705 | 3300005842 | Unclassified | 820 |
| 114 | Ga0068860_100322398 | 3300005843 | Unclassified | 1516 |
| 115 | Ga0068860_100704086 | 3300005843 | Bacteria | 1020 |
| 116 | Ga0068862_100181565 | 3300005844 | Bacteria | 1889 |
| 117 | Ga0070717_10001158 | 3300006028 | Bacteria | 17814 |
| 118 | Ga0070717_10192083 | 3300006028 | Bacteria | 1784 |
| 119 | Ga0070716_100306874 | 3300006173 | Unclassified | 1106 |
| 120 | Ga0070716_100757860 | 3300006173 | Unclassified | 747 |
| 121 | Ga0097621_100379968 | 3300006237 | Bacteria | 1261 |
| 122 | Ga0097621_100709451 | 3300006237 | Unclassified | 927 |
| 123 | Ga0068871_100237698 | 3300006358 | Unclassified | 1583 |
| 124 | Ga0068871_101192787 | 3300006358 | Unclassified | 714 |
| 125 | Ga0075428_100816248 | 3300006844 | Bacteria | 991 |
| 126 | Ga0097620_100055929 | 3300006931 | Unclassified | 3970 |
| 127 | Ga0075435_101009112 | 3300007076 | Bacteria | 727 |
| 128 | Ga0105240_10117581 | 3300009093 | Bacteria | 3205 |
| 129 | Ga0105240_10386694 | 3300009093 | Bacteria | 1579 |
| 130 | Ga0111539_10059083 | 3300009094 | Bacteria | 4549 |
| 131 | Ga0105245_10056726 | 3300009098 | Bacteria | 3521 |
| 132 | Ga0105245_10060695 | 3300009098 | Unclassified | 3406 |
| 133 | Ga0105245_10176729 | 3300009098 | Bacteria | 2037 |
| 134 | Ga0114129_10432515 | 3300009147 | Unclassified | 1729 |
| 135 | Ga0114129_10976684 | 3300009147 | Bacteria | 1068 |
| 136 | Ga0105243_10735986 | 3300009148 | Bacteria | 965 |
| 137 | Ga0105241_10407067 | 3300009174 | Unclassified | 1194 |
| 138 | Ga0105242_10010251 | 3300009176 | Bacteria | 7186 |
| 139 | Ga0105242_10308717 | 3300009176 | Unclassified | 1446 |
| 140 | Ga0105248_10028449 | 3300009177 | Bacteria | 6227 |
| 141 | Ga0105248_10059682 | 3300009177 | Bacteria | 4285 |
| 142 | Ga0105248_10060795 | 3300009177 | Unclassified | 4241 |
| 143 | Ga0105248_10539558 | 3300009177 | Bacteria | 1316 |
| 144 | Ga0105238_10067762 | 3300009551 | Bacteria | 3569 |
| 145 | Ga0105238_10129936 | 3300009551 | Unclassified | 2497 |
| 146 | Ga0105239_12682060 | 3300010375 | Unclassified | 581 |
| 147 | Ga0105246_10004486 | 3300011119 | Bacteria | 8492 |
| 148 | Ga0157373_10007387 | 3300013100 | Bacteria | 8177 |
| 149 | Ga0157371_10045738 | 3300013102 | Unclassified | 3114 |
| 150 | Ga0157370_10057144 | 3300013104 | Bacteria | 3712 |
| 151 | Ga0157369_10017818 | 3300013105 | Bacteria | 7971 |
| 152 | Ga0157369_10699463 | 3300013105 | Bacteria | 1044 |
| 153 | Ga0157369_10731060 | 3300013105 | Unclassified | 1019 |
| 154 | Ga0157369_12138160 | 3300013105 | Unclassified | 568 |
| 155 | Ga0157374_10058225 | 3300013296 | Unclassified | 3610 |
| 156 | Ga0157374_10154428 | 3300013296 | Bacteria | 2233 |
| 157 | Ga0157378_10456693 | 3300013297 | Unclassified | 1269 |
| 158 | Ga0157378_10523261 | 3300013297 | Bacteria | 1188 |
| 159 | Ga0157372_10060298 | 3300013307 | Bacteria | 4246 |
| 160 | Ga0157372_10088039 | 3300013307 | Unclassified | 3525 |
| 161 | Ga0157372_10187483 | 3300013307 | Bacteria | 2395 |
| 162 | Ga0157375_10028181 | 3300013308 | Bacteria | 5260 |
| 163 | Ga0157375_10330517 | 3300013308 | Bacteria | 1689 |
| 164 | Ga0157375_10913256 | 3300013308 | Bacteria | 1021 |
| 165 | Ga0163163_10065674 | 3300014325 | Unclassified | 3603 |
| 166 | Ga0163163_10127629 | 3300014325 | Bacteria | 2582 |
| 167 | Ga0163163_10161841 | 3300014325 | Bacteria | 2284 |
| 168 | Ga0163163_10489921 | 3300014325 | Bacteria | 1291 |
| 169 | Ga0163163_10782741 | 3300014325 | Bacteria | 1017 |
| 170 | Ga0157380_10062277 | 3300014326 | Bacteria | 2988 |
| 171 | Ga0157380_10260129 | 3300014326 | Unclassified | 1576 |
| 172 | Ga0157377_10039390 | 3300014745 | Bacteria | 2614 |
| 173 | Ga0157379_10284841 | 3300014968 | Unclassified | 1504 |
| 174 | Ga0157376_10039738 | 3300014969 | Bacteria | 3839 |
| 175 | Ga0157376_10113390 | 3300014969 | Bacteria | 2390 |
| 176 | Ga0157376_10244714 | 3300014969 | Unclassified | 1672 |
| 177 | Ga0182007_10195161 | 3300015262 | Unclassified | 705 |
| 178 | Ga0213876_10489700 | 3300021384 | Bacteria | 654 |
| 179 | Ga0207692_10047328 | 3300025898 | Unclassified | 2159 |
| 180 | Ga0207692_10223619 | 3300025898 | Bacteria | 1117 |
| 181 | Ga0207680_10115418 | 3300025903 | Unclassified | 1749 |
| 182 | Ga0207680_10281860 | 3300025903 | Bacteria | 1155 |
| 183 | Ga0207699_10001120 | 3300025906 | Bacteria | 12689 |
| 184 | Ga0207645_10120083 | 3300025907 | Unclassified | 1706 |
| 185 | Ga0207643_10028182 | 3300025908 | Bacteria | 3118 |
| 186 | Ga0207705_10039042 | 3300025909 | Bacteria | 3402 |
| 187 | Ga0207654_10348542 | 3300025911 | Bacteria | 1019 |
| 188 | Ga0207654_10404608 | 3300025911 | Unclassified | 950 |
| 189 | Ga0207707_10227486 | 3300025912 | Unclassified | 1623 |
| 190 | Ga0207707_10565189 | 3300025912 | Bacteria | 965 |
| 191 | Ga0207695_10008839 | 3300025913 | Bacteria | 12543 |
| 192 | Ga0207695_10883893 | 3300025913 | Unclassified | 773 |
| 193 | Ga0207693_10014685 | 3300025915 | Bacteria | 6291 |
| 194 | Ga0207663_10032949 | 3300025916 | Bacteria | 3081 |
| 195 | Ga0207663_10084403 | 3300025916 | Bacteria | 2089 |
| 196 | Ga0207663_10172300 | 3300025916 | Unclassified | 1538 |
| 197 | Ga0207663_10526200 | 3300025916 | Unclassified | 921 |
| 198 | Ga0207660_10001186 | 3300025917 | Bacteria | 17493 |
| 199 | Ga0207660_10100041 | 3300025917 | Bacteria | 2164 |
| 200 | Ga0207660_10273250 | 3300025917 | Bacteria | 1339 |
| 201 | Ga0207660_10398879 | 3300025917 | Unclassified | 1108 |
| 202 | Ga0207657_10418744 | 3300025919 | Bacteria | 1053 |
| 203 | Ga0207649_10048214 | 3300025920 | Bacteria | 2626 |
| 204 | Ga0207649_10064616 | 3300025920 | Unclassified | 2314 |
| 205 | Ga0207649_10670836 | 3300025920 | Unclassified | 802 |
| 206 | Ga0207649_11411812 | 3300025920 | Unclassified | 551 |
| 207 | Ga0207652_10005376 | 3300025921 | Bacteria | 10389 |
| 208 | Ga0207652_10071343 | 3300025921 | Bacteria | 3018 |
| 209 | Ga0207652_10298341 | 3300025921 | Bacteria | 1454 |
| 210 | Ga0207681_10188343 | 3300025923 | Bacteria | 1577 |
| 211 | Ga0207650_10253110 | 3300025925 | Unclassified | 1426 |
| 212 | Ga0207650_10290396 | 3300025925 | Bacteria | 1333 |
| 213 | Ga0207659_10089972 | 3300025926 | Bacteria | 2290 |
| 214 | Ga0207659_10170615 | 3300025926 | Unclassified | 1716 |
| 215 | Ga0207687_10292870 | 3300025927 | Bacteria | 1309 |
| 216 | Ga0207700_10001794 | 3300025928 | Bacteria | 12188 |
| 217 | Ga0207700_10063811 | 3300025928 | Bacteria | 2803 |
| 218 | Ga0207700_10176945 | 3300025928 | Bacteria | 1783 |
| 219 | Ga0207700_10641997 | 3300025928 | Bacteria | 946 |
| 220 | Ga0207664_10009295 | 3300025929 | Bacteria | 6893 |
| 221 | Ga0207664_10023369 | 3300025929 | Bacteria | 4630 |
| 222 | Ga0207644_11085994 | 3300025931 | Bacteria | 672 |
| 223 | Ga0207690_10010072 | 3300025932 | Bacteria | 5615 |
| 224 | Ga0207690_10398722 | 3300025932 | Bacteria | 1097 |
| 225 | Ga0207706_10059933 | 3300025933 | Bacteria | 3352 |
| 226 | Ga0207686_10139176 | 3300025934 | Bacteria | 1675 |
| 227 | Ga0207670_10212737 | 3300025936 | Unclassified | 1475 |
| 228 | Ga0207669_10634087 | 3300025937 | Bacteria | 872 |
| 229 | Ga0207704_10313342 | 3300025938 | Unclassified | 1207 |
| 230 | Ga0207665_10040986 | 3300025939 | Bacteria | 3091 |
| 231 | Ga0207691_10830241 | 3300025940 | Bacteria | 776 |
| 232 | Ga0207711_10281223 | 3300025941 | Bacteria | 1532 |
| 233 | Ga0207711_10418984 | 3300025941 | Bacteria | 1245 |
| 234 | Ga0207711_10529617 | 3300025941 | Bacteria | 1099 |
| 235 | Ga0207689_10001543 | 3300025942 | Bacteria | 21885 |
| 236 | Ga0207661_10001254 | 3300025944 | Bacteria | 16973 |
| 237 | Ga0207661_10087617 | 3300025944 | Unclassified | 2586 |
| 238 | Ga0207661_10106191 | 3300025944 | Bacteria | 2367 |
| 239 | Ga0207661_10188301 | 3300025944 | Unclassified | 1807 |
| 240 | Ga0207661_11066021 | 3300025944 | Unclassified | 744 |
| 241 | Ga0207679_10086511 | 3300025945 | Unclassified | 2411 |
| 242 | Ga0207679_10385546 | 3300025945 | Unclassified | 1229 |
| 243 | Ga0207679_11273537 | 3300025945 | Unclassified | 675 |
| 244 | Ga0207667_10519738 | 3300025949 | Bacteria | 1206 |
| 245 | Ga0207667_10803962 | 3300025949 | Unclassified | 937 |
| 246 | Ga0207668_10354918 | 3300025972 | Unclassified | 1227 |
| 247 | Ga0207640_10010240 | 3300025981 | Bacteria | 5275 |
| 248 | Ga0207658_10097847 | 3300025986 | Unclassified | 2292 |
| 249 | Ga0207658_10818405 | 3300025986 | Bacteria | 846 |
| 250 | Ga0207677_10033526 | 3300026023 | Bacteria | 3316 |
| 251 | Ga0207677_10258088 | 3300026023 | Bacteria | 1419 |
| 252 | Ga0207703_10303501 | 3300026035 | Bacteria | 1457 |
| 253 | Ga0207678_10276530 | 3300026067 | Bacteria | 1440 |
| 254 | Ga0207702_11311439 | 3300026078 | Unclassified | 718 |
| 255 | Ga0207641_10242847 | 3300026088 | Bacteria | 1679 |
| 256 | Ga0207641_11867236 | 3300026088 | Unclassified | 602 |
| 257 | Ga0207648_10204279 | 3300026089 | Bacteria | 1753 |
| 258 | Ga0207676_10001991 | 3300026095 | Bacteria | 14870 |
| 259 | Ga0207676_10699020 | 3300026095 | Bacteria | 982 |
| 260 | Ga0207676_10842978 | 3300026095 | Bacteria | 896 |
| 261 | Ga0207674_10000210 | 3300026116 | Bacteria | 72127 |
| 262 | Ga0207675_101332497 | 3300026118 | Unclassified | 738 |
| 263 | Ga0207683_10289532 | 3300026121 | Bacteria | 1497 |
| 264 | Ga0207698_10198570 | 3300026142 | Unclassified | 1794 |
| 265 | Ga0207698_10782259 | 3300026142 | Unclassified | 955 |
| 266 | Ga0207428_10059021 | 3300027907 | Bacteria | 3043 |
| 267 | Ga0268265_10289078 | 3300028380 | Bacteria | 1471 |
| 268 | Ga0268264_11304018 | 3300028381 | Unclassified | 736 |
| 269 | Ga0307408_101755439 | 3300031548 | Bacteria | 592 |
| 270 | Ga0373926_0005980 | 3300035083 | Bacteria | 4027 |
| 271 | Ga0373934_0008392 | 3300035086 | Bacteria | 3849 |
| 272 | Ga0373934_0009381 | 3300035086 | Bacteria | 3663 |
| 273 | Ga0373934_0019547 | 3300035086 | Bacteria | 2601 |
| 274 | Ga0373944_0010471 | 3300035089 | Bacteria | 2530 |
| 275 | Ga0373923_0000215 | 3300035111 | Bacteria | 12018 |
| 276 | Ga0373945_0012577 | 3300035116 | Bacteria | 2813 |
| 277 | Ga0373953_0004092 | 3300035117 | Bacteria | 4619 |
| 278 | Ga0373953_0189513 | 3300035117 | Bacteria | 888 |
| 279 | Ga0373954_0097694 | 3300035118 | Bacteria | 1415 |
| 280 | Ga0373956_0007916 | 3300035119 | Bacteria | 4290 |
| 281 | Ga0373956_0041711 | 3300035119 | Bacteria | 2038 |
| 282 | Ga0373957_0007957 | 3300035120 | Bacteria | 3414 |
| 283 | Ga0373943_0002341 | 3300035170 | Bacteria | 8607 |
| 284 | Ga0373955_0018796 | 3300035172 | Bacteria | 3444 |
| 285 | Ga0373924_0003297 | 3300035410 | Bacteria | 5530 |
| 286 | Ga0373935_0000421 | 3300035692 | Bacteria | 22081 |
| 287 | Ga0373935_0077331 | 3300035692 | Bacteria | 2157 |
| 288 | Ga0373927_0001209 | 3300035695 | Bacteria | 19588 |
| 289 | Ga0373933_0011984 | 3300035724 | Bacteria | 4786 |
| 290 | Ga0373933_0019489 | 3300035724 | Bacteria | 3832 |
| 291 | Ga0373947_0000021 | 3300035725 | Bacteria | 89576 |
| 292 | Ga0373947_0277680 | 3300035725 | Bacteria | 1113 |
| 293 | Ga0373937_0000709 | 3300036401 | Bacteria | 29066 |
| 294 | Ga0373937_0000944 | 3300036401 | Bacteria | 24720 |
| 295 | Ga0373937_0093661 | 3300036401 | Bacteria | 2785 |
| 296 | Ga0373937_0570652 | 3300036401 | Bacteria | 1075 |
| 297 | Ga0373925_0001701 | 3300037068 | Bacteria | 18531 |
| 298 | Ga0395905_1276809 | 3300037471 | Unclassified | 638 |
| 299 | Ga0436365_0859341 | 3300039437 | Unclassified | 657 |
| 300 | Ga0436365_1608551 | 3300039437 | Bacteria | 1703 |
| 301 | Ga0451807_0845445 | 3300041486 | Unclassified | 509 |
| 302 | Ga0451853_3779001 | 3300041512 | Bacteria | 1319 |
| 303 | Ga0450917_013573 | 3300042120 | Bacteria | 672 |
| 304 | Ga0466972_0390438 | 3300044658 | Unclassified | 652 |
| 305 | Ga0466961_0078848 | 3300044693 | Unclassified | 2086 |
| 306 | Ga0466963_0689209 | 3300044694 | Bacteria | 721 |
| 307 | Ga0466957_0622978 | 3300044842 | Bacteria | 757 |
| 308 | Ga0466967_0171899 | 3300045976 | Unclassified | 2039 |
| 309 | Ga0466967_0205991 | 3300045976 | Unclassified | 1864 |
| 310 | Ga0466967_0807182 | 3300045976 | Bacteria | 932 |
| 311 | Ga0466967_2203533 | 3300045976 | Bacteria | 547 |
| 312 | Ga0495592_0001141 | 3300046454 | Bacteria | 18503 |
| 313 | Ga0495592_0406883 | 3300046454 | Bacteria | 861 |
| 314 | Ga0495603_0001616 | 3300046455 | Bacteria | 13238 |
| 315 | Ga0495629_0101874 | 3300046459 | Bacteria | 2003 |
| 316 | Ga0495629_0237761 | 3300046459 | Bacteria | 1254 |
| 317 | Ga0495641_0082877 | 3300046461 | Bacteria | 1436 |
| 318 | Ga0495651_0005547 | 3300046462 | Bacteria | 9621 |
| 319 | Ga0495651_0010914 | 3300046462 | Bacteria | 6989 |
| 320 | Ga0495651_0045819 | 3300046462 | Bacteria | 3387 |
| 321 | Ga0495651_0195125 | 3300046462 | Bacteria | 1421 |
| 322 | Ga0495653_0000157 | 3300046463 | Bacteria | 56338 |
| 323 | Ga0495653_0227796 | 3300046463 | Bacteria | 1249 |
| 324 | Ga0495580_0001329 | 3300046472 | Bacteria | 21797 |
| 325 | Ga0495582_0001236 | 3300046473 | Bacteria | 14390 |
| 326 | Ga0495582_0611400 | 3300046473 | Unclassified | 631 |
| 327 | Ga0495639_0000027 | 3300046475 | Bacteria | 68298 |
| 328 | Ga0495594_0025164 | 3300046499 | Bacteria | 3200 |
| 329 | Ga0495608_0014474 | 3300046511 | Bacteria | 5472 |
| 330 | Ga0495608_0059302 | 3300046511 | Bacteria | 2522 |
| 331 | Ga0495618_0050540 | 3300046514 | Bacteria | 2626 |
| 332 | Ga0495618_0271517 | 3300046514 | Bacteria | 1060 |
| 333 | Ga0495628_0001862 | 3300046516 | Bacteria | 19161 |
| 334 | Ga0495628_0191902 | 3300046516 | Bacteria | 1542 |
| 335 | Ga0495628_0622103 | 3300046516 | Bacteria | 769 |
| 336 | Ga0495630_0000527 | 3300046517 | Bacteria | 28192 |
| 337 | Ga0495630_0003904 | 3300046517 | Bacteria | 10423 |
| 338 | Ga0495630_0359896 | 3300046517 | Bacteria | 1114 |
| 339 | Ga0495630_1017241 | 3300046517 | Unclassified | 629 |
| 340 | Ga0495666_0103892 | 3300046526 | Bacteria | 1338 |
| 341 | Ga0495652_0010363 | 3300046529 | Bacteria | 8445 |
| 342 | Ga0495652_0024953 | 3300046529 | Bacteria | 5290 |
| 343 | Ga0495652_0086219 | 3300046529 | Bacteria | 2579 |
| 344 | Ga0495665_0000010 | 3300046531 | Bacteria | 71277 |
| 345 | Ga0495665_0008619 | 3300046531 | Bacteria | 5534 |
| 346 | Ga0495665_0288575 | 3300046531 | Unclassified | 841 |
| 347 | Ga0495640_0294228 | 3300046533 | Bacteria | 1009 |
| 348 | Ga0495586_0070055 | 3300046535 | Bacteria | 1915 |
| 349 | Ga0495587_0001198 | 3300046536 | Bacteria | 17158 |
| 350 | Ga0495587_0001926 | 3300046536 | Bacteria | 13813 |
| 351 | Ga0495645_0000075 | 3300046543 | Bacteria | 68269 |
| 352 | Ga0495645_0004875 | 3300046543 | Bacteria | 9173 |
| 353 | Ga0495645_0202488 | 3300046543 | Bacteria | 1345 |
| 354 | Ga0495667_0003826 | 3300046559 | Bacteria | 10113 |
| 355 | Ga0495667_0008678 | 3300046559 | Bacteria | 6898 |
| 356 | Ga0495667_0012295 | 3300046559 | Bacteria | 5801 |
| 357 | Ga0495667_0036878 | 3300046559 | Bacteria | 3260 |
| 358 | Ga0495634_0253712 | 3300046642 | Bacteria | 1075 |
| 359 | Ga0495634_0349260 | 3300046642 | Bacteria | 886 |
| 360 | Ga0495634_0625820 | 3300046642 | Bacteria | 623 |
| 361 | Ga0495635_0006979 | 3300046663 | Bacteria | 7891 |
| 362 | Ga0495635_0161086 | 3300046663 | Bacteria | 1527 |
| 363 | Ga0495588_0000388 | 3300046674 | Bacteria | 25129 |
| 364 | Ga0495588_0336855 | 3300046674 | Unclassified | 793 |
| 365 | Ga0495657_0001113 | 3300046675 | Bacteria | 23531 |
| 366 | Ga0495657_0046007 | 3300046675 | Bacteria | 2958 |
| 367 | Ga0495657_0267295 | 3300046675 | Bacteria | 1026 |
| 368 | Ga0495599_0000410 | 3300046678 | Bacteria | 24560 |
| 369 | Ga0495599_0013688 | 3300046678 | Bacteria | 5015 |
| 370 | Ga0495623_0000029 | 3300046679 | Bacteria | 85797 |
| 371 | Ga0495623_0020671 | 3300046679 | Bacteria | 4255 |
| 372 | Ga0495623_0037492 | 3300046679 | Bacteria | 3102 |
| 373 | Ga0495623_0171811 | 3300046679 | Bacteria | 1266 |
| 374 | Ga0495646_0000513 | 3300046680 | Bacteria | 20769 |
| 375 | Ga0495658_0000072 | 3300046683 | Bacteria | 52083 |
| 376 | Ga0495613_0022501 | 3300046689 | Bacteria | 4695 |
| 377 | Ga0495613_0113361 | 3300046689 | Bacteria | 1952 |
| 378 | Ga0495613_0178051 | 3300046689 | Bacteria | 1506 |
| 379 | Ga0495600_0000242 | 3300046809 | Bacteria | 30005 |
| 380 | Ga0495600_0046712 | 3300046809 | Bacteria | 2824 |
| 381 | Ga0495600_0286000 | 3300046809 | Bacteria | 1043 |
| 382 | Ga0495600_0532637 | 3300046809 | Unclassified | 719 |
| 383 | Ga0495581_0000458 | 3300047315 | Bacteria | 20890 |
| 384 | Ga0495604_0001545 | 3300047317 | Bacteria | 18962 |
| 385 | Ga0495604_0054272 | 3300047317 | Bacteria | 3093 |
| 386 | Ga0495674_0004815 | 3300047319 | Bacteria | 12979 |
| 387 | Ga0495674_0287570 | 3300047319 | Unclassified | 1345 |
| 388 | Ga0495672_0003327 | 3300047320 | Bacteria | 13866 |
| 389 | Ga0495680_0005714 | 3300047322 | Bacteria | 11647 |
| 390 | Ga0495680_0020509 | 3300047322 | Bacteria | 5559 |
| 391 | Ga0495680_0084887 | 3300047322 | Bacteria | 2385 |
| 392 | Ga0495680_0340689 | 3300047322 | Bacteria | 1046 |
| 393 | Ga0495675_0001136 | 3300047444 | Bacteria | 16174 |
| 394 | Ga0495675_0019810 | 3300047444 | Bacteria | 4274 |
| 395 | Ga0495675_0052296 | 3300047444 | Bacteria | 2593 |
| 396 | Ga0495675_0186773 | 3300047444 | Bacteria | 1267 |
| 397 | Ga0495675_0477656 | 3300047444 | Unclassified | 718 |
| 398 | Ga0495684_0000247 | 3300047471 | Bacteria | 42619 |
| 399 | Ga0495684_0194035 | 3300047471 | Bacteria | 1500 |
| 400 | Ga0495593_0000208 | 3300047673 | Bacteria | 30996 |
| 401 | Ga0495593_0251642 | 3300047673 | Bacteria | 885 |
| 402 | Ga0495602_0001990 | 3300048088 | Bacteria | 20504 |
| 403 | Ga0495602_0127533 | 3300048088 | Bacteria | 2035 |
| 404 | Ga0495602_0159163 | 3300048088 | Bacteria | 1765 |
| 405 | Ga0495602_0223661 | 3300048088 | Bacteria | 1419 |
| 406 | Ga0495614_0000043 | 3300048089 | Bacteria | 38806 |
| 407 | Ga0496104_0897950 | 3300048907 | Bacteria | 791 |
| 408 | Ga0496104_0962036 | 3300048907 | Bacteria | 758 |
| 409 | Ga0496109_0052229 | 3300048912 | Bacteria | 3725 |
| 410 | Ga0496110_0621037 | 3300048913 | Bacteria | 979 |
| 411 | Ga0496111_0302269 | 3300048914 | Bacteria | 1186 |
| 412 | Ga0496112_0003538 | 3300048915 | Bacteria | 12966 |
| 413 | Ga0496113_0099253 | 3300048916 | Bacteria | 2255 |
| 414 | Ga0501033_0171599 | 3300049570 | Bacteria | 1557 |
| 415 | Ga0501033_0270902 | 3300049570 | Unclassified | 1200 |
| 416 | Ga0501034_0090426 | 3300049571 | Bacteria | 3059 |
| 417 | Ga0501034_0576298 | 3300049571 | Bacteria | 1033 |
| 418 | Ga0501038_0079253 | 3300049574 | Bacteria | 2770 |
| 419 | Ga0501070_0037994 | 3300049586 | Bacteria | 4018 |
| 420 | Ga0501073_0356510 | 3300049589 | Bacteria | 1010 |
| 421 | Ga0501077_0330257 | 3300049593 | Unclassified | 972 |
| 422 | Ga0501035_0108318 | 3300049822 | Bacteria | 2436 |
| 423 | Ga0501044_0037849 | 3300049823 | Bacteria | 5041 |
| 424 | nmdc:mga05p37_1465631_c1 | 3300050507 | Bacteria | 682 |
| 425 | nmdc:mga05p37_393821_c1 | 3300050507 | Unclassified | 1619 |
| 426 | nmdc:mga08y16_16097_c1 | 3300050511 | Bacteria | 7865 |
| 427 | nmdc:mga0rr50_916662_c1 | 3300050513 | Bacteria | 747 |
| 428 | Ga0495601_0061339 | 3300053077 | Bacteria | 2387 |
| 429 | Ga0495612_0001787 | 3300053078 | Bacteria | 8811 |
| 430 | Ga0495595_0021665 | 3300053084 | Bacteria | 2810 |
| 431 | Ga0495595_0389063 | 3300053084 | Bacteria | 706 |
| 432 | Ga0495619_0000831 | 3300053085 | Bacteria | 20275 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_101082902 | Ga0070662_1010829021 | 147 |
| 2 | 3300005844 | Ga0068862_100181565 | Ga0068862_1001815652 | 147 |
| 3 | 3300013308 | Ga0157375_10913256 | Ga0157375_109132562 | 147 |
| 4 | 3300014326 | Ga0157380_10062277 | Ga0157380_100622772 | 147 |
| 5 | 3300028380 | Ga0268265_10289078 | Ga0268265_102890782 | 147 |
| 6 | 3300009147 | Ga0114129_10976684 | Ga0114129_109766841 | 150 |
| 7 | 3300041486 | Ga0451807_0845445 | Ga0451807_0845445_46_498 | 150 |
| 8 | 3300050507 | nmdc:mga05p37_1465631_c1 | nmdc:mga05p37_1465631_c1_101_556 | 150 |
| 9 | 3300037471 | Ga0395905_1276809 | Ga0395905_1276809_155_616 | 153 |
| 10 | 3300005546 | Ga0070696_100029244 | Ga0070696_1000292441 | 154 |
| 11 | 3300035086 | Ga0373934_0019547 | Ga0373934_0019547_1655_2122 | 155 |
| 12 | 3300035117 | Ga0373953_0189513 | Ga0373953_0189513_268_735 | 155 |
| 13 | 3300035118 | Ga0373954_0097694 | Ga0373954_0097694_96_563 | 155 |
| 14 | 3300035119 | Ga0373956_0041711 | Ga0373956_0041711_1181_1648 | 155 |
| 15 | 3300036401 | Ga0373937_0093661 | Ga0373937_0093661_1625_2092 | 155 |
| 16 | 3300036401 | Ga0373937_0570652 | Ga0373937_0570652_207_674 | 155 |
| 17 | 3300046462 | Ga0495651_0195125 | Ga0495651_0195125_499_966 | 155 |
| 18 | 3300046516 | Ga0495628_0191902 | Ga0495628_0191902_470_937 | 155 |
| 19 | 3300046559 | Ga0495667_0012295 | Ga0495667_0012295_2035_2502 | 155 |
| 20 | 3300046675 | Ga0495657_0046007 | Ga0495657_0046007_397_864 | 155 |
| 21 | 3300046679 | Ga0495623_0037492 | Ga0495623_0037492_654_1121 | 155 |
| 22 | 3300047317 | Ga0495604_0054272 | Ga0495604_0054272_419_886 | 155 |
| 23 | 3300047322 | Ga0495680_0340689 | Ga0495680_0340689_76_543 | 155 |
| 24 | 3300047444 | Ga0495675_0052296 | Ga0495675_0052296_644_1111 | 155 |
| 25 | 3300048088 | Ga0495602_0127533 | Ga0495602_0127533_674_1141 | 155 |
| 26 | 3300013105 | Ga0157369_10699463 | Ga0157369_106994632 | 157 |
| 27 | 3300025937 | Ga0207669_10634087 | Ga0207669_106340872 | 159 |
| 28 | 3300005341 | Ga0070691_10321279 | Ga0070691_103212791 | 161 |
| 29 | 3300005344 | Ga0070661_100023113 | Ga0070661_1000231132 | 161 |
| 30 | 3300005518 | Ga0070699_100027613 | Ga0070699_1000276139 | 161 |
| 31 | 3300005535 | Ga0070684_100025087 | Ga0070684_1000250871 | 161 |
| 32 | 3300005563 | Ga0068855_100971202 | Ga0068855_1009712021 | 161 |
| 33 | 3300009093 | Ga0105240_10386694 | Ga0105240_103866941 | 161 |
| 34 | 3300013104 | Ga0157370_10057144 | Ga0157370_100571445 | 161 |
| 35 | 3300025913 | Ga0207695_10008839 | Ga0207695_1000883910 | 161 |
| 36 | 3300025913 | Ga0207695_10883893 | Ga0207695_108838931 | 161 |
| 37 | 3300025917 | Ga0207660_10100041 | Ga0207660_101000412 | 161 |
| 38 | 3300025921 | Ga0207652_10005376 | Ga0207652_100053769 | 161 |
| 39 | 3300025949 | Ga0207667_10803962 | Ga0207667_108039621 | 161 |
| 40 | 3300025981 | Ga0207640_10010240 | Ga0207640_100102408 | 161 |
| 41 | 3300026067 | Ga0207678_10276530 | Ga0207678_102765302 | 161 |
| 42 | 3300005563 | Ga0068855_100063427 | Ga0068855_1000634271 | 163 |
| 43 | 3300005437 | Ga0070710_10438186 | Ga0070710_104381862 | 165 |
| 44 | 3300046531 | Ga0495665_0288575 | Ga0495665_0288575_32_529 | 165 |
| 45 | 3300046543 | Ga0495645_0202488 | Ga0495645_0202488_25_522 | 165 |
| 46 | 3300046674 | Ga0495588_0336855 | Ga0495588_0336855_71_568 | 165 |
| 47 | 3300046809 | Ga0495600_0532637 | Ga0495600_0532637_205_702 | 165 |
| 48 | 3300047444 | Ga0495675_0477656 | Ga0495675_0477656_47_544 | 165 |
| 49 | 3300053077 | Ga0495601_0061339 | Ga0495601_0061339_1467_1964 | 165 |
| 50 | 3300005353 | Ga0070669_100198589 | Ga0070669_1001985892 | 166 |
| 51 | 3300005356 | Ga0070674_100398269 | Ga0070674_1003982692 | 166 |
| 52 | 3300005444 | Ga0070694_101009586 | Ga0070694_1010095861 | 166 |
| 53 | 3300005840 | Ga0068870_10208975 | Ga0068870_102089752 | 166 |
| 54 | 3300013308 | Ga0157375_10330517 | Ga0157375_103305172 | 166 |
| 55 | 3300014325 | Ga0163163_10782741 | Ga0163163_107827412 | 166 |
| 56 | 3300025923 | Ga0207681_10188343 | Ga0207681_101883432 | 166 |
| 57 | 3300025925 | Ga0207650_10290396 | Ga0207650_102903962 | 166 |
| 58 | 3300005290 | Ga0065712_10269187 | Ga0065712_102691872 | 167 |
| 59 | 3300005328 | Ga0070676_10183012 | Ga0070676_101830122 | 167 |
| 60 | 3300005335 | Ga0070666_10199057 | Ga0070666_101990572 | 167 |
| 61 | 3300005355 | Ga0070671_100853551 | Ga0070671_1008535512 | 167 |
| 62 | 3300005366 | Ga0070659_100450759 | Ga0070659_1004507592 | 167 |
| 63 | 3300005434 | Ga0070709_10030953 | Ga0070709_100309532 | 167 |
| 64 | 3300005434 | Ga0070709_10285101 | Ga0070709_102851012 | 167 |
| 65 | 3300005435 | Ga0070714_100060116 | Ga0070714_1000601162 | 167 |
| 66 | 3300005436 | Ga0070713_100001273 | Ga0070713_1000012738 | 167 |
| 67 | 3300005439 | Ga0070711_100018583 | Ga0070711_1000185832 | 167 |
| 68 | 3300005466 | Ga0070685_10164701 | Ga0070685_101647012 | 167 |
| 69 | 3300005543 | Ga0070672_100809475 | Ga0070672_1008094752 | 167 |
| 70 | 3300005544 | Ga0070686_100159527 | Ga0070686_1001595272 | 167 |
| 71 | 3300005843 | Ga0068860_100704086 | Ga0068860_1007040862 | 167 |
| 72 | 3300006028 | Ga0070717_10001158 | Ga0070717_1000115813 | 167 |
| 73 | 3300006173 | Ga0070716_100757860 | Ga0070716_1007578601 | 167 |
| 74 | 3300006237 | Ga0097621_100709451 | Ga0097621_1007094512 | 167 |
| 75 | 3300009098 | Ga0105245_10056726 | Ga0105245_100567263 | 167 |
| 76 | 3300009098 | Ga0105245_10060695 | Ga0105245_100606952 | 167 |
| 77 | 3300009176 | Ga0105242_10010251 | Ga0105242_100102512 | 167 |
| 78 | 3300009176 | Ga0105242_10308717 | Ga0105242_103087171 | 167 |
| 79 | 3300009177 | Ga0105248_10059682 | Ga0105248_100596821 | 167 |
| 80 | 3300013297 | Ga0157378_10456693 | Ga0157378_104566931 | 167 |
| 81 | 3300013307 | Ga0157372_10060298 | Ga0157372_100602982 | 167 |
| 82 | 3300013307 | Ga0157372_10187483 | Ga0157372_101874832 | 167 |
| 83 | 3300013308 | Ga0157375_10028181 | Ga0157375_100281813 | 167 |
| 84 | 3300014969 | Ga0157376_10244714 | Ga0157376_102447143 | 167 |
| 85 | 3300025907 | Ga0207645_10120083 | Ga0207645_101200832 | 167 |
| 86 | 3300025911 | Ga0207654_10348542 | Ga0207654_103485422 | 167 |
| 87 | 3300025915 | Ga0207693_10014685 | Ga0207693_100146854 | 167 |
| 88 | 3300025916 | Ga0207663_10084403 | Ga0207663_100844032 | 167 |
| 89 | 3300025916 | Ga0207663_10172300 | Ga0207663_101723002 | 167 |
| 90 | 3300025928 | Ga0207700_10001794 | Ga0207700_1000179412 | 167 |
| 91 | 3300025928 | Ga0207700_10063811 | Ga0207700_100638114 | 167 |
| 92 | 3300025929 | Ga0207664_10009295 | Ga0207664_100092952 | 167 |
| 93 | 3300025932 | Ga0207690_10398722 | Ga0207690_103987222 | 167 |
| 94 | 3300025934 | Ga0207686_10139176 | Ga0207686_101391762 | 167 |
| 95 | 3300025938 | Ga0207704_10313342 | Ga0207704_103133421 | 167 |
| 96 | 3300025940 | Ga0207691_10830241 | Ga0207691_108302411 | 167 |
| 97 | 3300025941 | Ga0207711_10418984 | Ga0207711_104189842 | 167 |
| 98 | 3300025949 | Ga0207667_10519738 | Ga0207667_105197382 | 167 |
| 99 | 3300025972 | Ga0207668_10354918 | Ga0207668_103549181 | 167 |
| 100 | 3300025986 | Ga0207658_10097847 | Ga0207658_100978472 | 167 |
| 101 | 3300026023 | Ga0207677_10033526 | Ga0207677_100335263 | 167 |
| 102 | 3300026089 | Ga0207648_10204279 | Ga0207648_102042792 | 167 |
| 103 | 3300031548 | Ga0307408_101755439 | Ga0307408_1017554391 | 167 |
| 104 | 3300035083 | Ga0373926_0005980 | Ga0373926_0005980_53_556 | 167 |
| 105 | 3300035089 | Ga0373944_0010471 | Ga0373944_0010471_18_521 | 167 |
| 106 | 3300035116 | Ga0373945_0012577 | Ga0373945_0012577_893_1396 | 167 |
| 107 | 3300035170 | Ga0373943_0002341 | Ga0373943_0002341_1322_1825 | 167 |
| 108 | 3300035692 | Ga0373935_0000421 | Ga0373935_0000421_17442_17945 | 167 |
| 109 | 3300035695 | Ga0373927_0001209 | Ga0373927_0001209_4172_4675 | 167 |
| 110 | 3300035725 | Ga0373947_0000021 | Ga0373947_0000021_9534_10037 | 167 |
| 111 | 3300037068 | Ga0373925_0001701 | Ga0373925_0001701_14838_15341 | 167 |
| 112 | 3300041512 | Ga0451853_3779001 | Ga0451853_3779001_208_711 | 167 |
| 113 | 3300044694 | Ga0466963_0689209 | Ga0466963_0689209_188_691 | 167 |
| 114 | 3300044842 | Ga0466957_0622978 | Ga0466957_0622978_163_666 | 167 |
| 115 | 3300045976 | Ga0466967_0807182 | Ga0466967_0807182_346_849 | 167 |
| 116 | 3300046455 | Ga0495603_0001616 | Ga0495603_0001616_1106_1609 | 167 |
| 117 | 3300046459 | Ga0495629_0237761 | Ga0495629_0237761_513_1016 | 167 |
| 118 | 3300046461 | Ga0495641_0082877 | Ga0495641_0082877_272_775 | 167 |
| 119 | 3300046472 | Ga0495580_0001329 | Ga0495580_0001329_2015_2518 | 167 |
| 120 | 3300046473 | Ga0495582_0001236 | Ga0495582_0001236_3594_4097 | 167 |
| 121 | 3300046475 | Ga0495639_0000027 | Ga0495639_0000027_16527_17030 | 167 |
| 122 | 3300046517 | Ga0495630_0000527 | Ga0495630_0000527_26529_27032 | 167 |
| 123 | 3300046526 | Ga0495666_0103892 | Ga0495666_0103892_153_656 | 167 |
| 124 | 3300046531 | Ga0495665_0000010 | Ga0495665_0000010_8825_9328 | 167 |
| 125 | 3300046663 | Ga0495635_0161086 | Ga0495635_0161086_1011_1514 | 167 |
| 126 | 3300046674 | Ga0495588_0000388 | Ga0495588_0000388_2945_3448 | 167 |
| 127 | 3300046683 | Ga0495658_0000072 | Ga0495658_0000072_47038_47541 | 167 |
| 128 | 3300046689 | Ga0495613_0022501 | Ga0495613_0022501_1395_1898 | 167 |
| 129 | 3300047315 | Ga0495581_0000458 | Ga0495581_0000458_13646_14149 | 167 |
| 130 | 3300047320 | Ga0495672_0003327 | Ga0495672_0003327_11962_12465 | 167 |
| 131 | 3300047673 | Ga0495593_0000208 | Ga0495593_0000208_26938_27441 | 167 |
| 132 | 3300048089 | Ga0495614_0000043 | Ga0495614_0000043_18867_19370 | 167 |
| 133 | 3300005290 | Ga0065712_10097591 | Ga0065712_100975913 | 168 |
| 134 | 3300005329 | Ga0070683_100109199 | Ga0070683_1001091992 | 168 |
| 135 | 3300005336 | Ga0070680_100006449 | Ga0070680_1000064495 | 168 |
| 136 | 3300005336 | Ga0070680_100265117 | Ga0070680_1002651172 | 168 |
| 137 | 3300005445 | Ga0070708_100010399 | Ga0070708_1000103993 | 168 |
| 138 | 3300005471 | Ga0070698_100141787 | Ga0070698_1001417872 | 168 |
| 139 | 3300005518 | Ga0070699_100014125 | Ga0070699_10001412511 | 168 |
| 140 | 3300005530 | Ga0070679_100153538 | Ga0070679_1001535381 | 168 |
| 141 | 3300005530 | Ga0070679_100710120 | Ga0070679_1007101202 | 168 |
| 142 | 3300005530 | Ga0070679_100769538 | Ga0070679_1007695382 | 168 |
| 143 | 3300005535 | Ga0070684_100119155 | Ga0070684_1001191552 | 168 |
| 144 | 3300005543 | Ga0070672_100618549 | Ga0070672_1006185492 | 168 |
| 145 | 3300005546 | Ga0070696_100230472 | Ga0070696_1002304722 | 168 |
| 146 | 3300005547 | Ga0070693_100033759 | Ga0070693_1000337594 | 168 |
| 147 | 3300005564 | Ga0070664_100374252 | Ga0070664_1003742522 | 168 |
| 148 | 3300005618 | Ga0068864_100532538 | Ga0068864_1005325382 | 168 |
| 149 | 3300006844 | Ga0075428_100816248 | Ga0075428_1008162482 | 168 |
| 150 | 3300007076 | Ga0075435_101009112 | Ga0075435_1010091122 | 168 |
| 151 | 3300009147 | Ga0114129_10432515 | Ga0114129_104325151 | 168 |
| 152 | 3300009177 | Ga0105248_10028449 | Ga0105248_100284493 | 168 |
| 153 | 3300014325 | Ga0163163_10489921 | Ga0163163_104899212 | 168 |
| 154 | 3300015262 | Ga0182007_10195161 | Ga0182007_101951612 | 168 |
| 155 | 3300025912 | Ga0207707_10565189 | Ga0207707_105651892 | 168 |
| 156 | 3300025917 | Ga0207660_10001186 | Ga0207660_100011866 | 168 |
| 157 | 3300025917 | Ga0207660_10398879 | Ga0207660_103988792 | 168 |
| 158 | 3300025920 | Ga0207649_11411812 | Ga0207649_114118121 | 168 |
| 159 | 3300025929 | Ga0207664_10023369 | Ga0207664_100233693 | 168 |
| 160 | 3300025941 | Ga0207711_10529617 | Ga0207711_105296172 | 168 |
| 161 | 3300025944 | Ga0207661_10087617 | Ga0207661_100876172 | 168 |
| 162 | 3300025945 | Ga0207679_11273537 | Ga0207679_112735371 | 168 |
| 163 | 3300026095 | Ga0207676_10842978 | Ga0207676_108429782 | 168 |
| 164 | 3300042120 | Ga0450917_013573 | Ga0450917_013573_92_598 | 168 |
| 165 | 3300046454 | Ga0495592_0406883 | Ga0495592_0406883_60_566 | 168 |
| 166 | 3300046462 | Ga0495651_0045819 | Ga0495651_0045819_1633_2139 | 168 |
| 167 | 3300046463 | Ga0495653_0227796 | Ga0495653_0227796_500_1006 | 168 |
| 168 | 3300046473 | Ga0495582_0611400 | Ga0495582_0611400_52_558 | 168 |
| 169 | 3300046511 | Ga0495608_0059302 | Ga0495608_0059302_164_670 | 168 |
| 170 | 3300046514 | Ga0495618_0271517 | Ga0495618_0271517_222_728 | 168 |
| 171 | 3300046516 | Ga0495628_0622103 | Ga0495628_0622103_185_691 | 168 |
| 172 | 3300046517 | Ga0495630_1017241 | Ga0495630_1017241_79_585 | 168 |
| 173 | 3300046529 | Ga0495652_0086219 | Ga0495652_0086219_1104_1661 | 168 |
| 174 | 3300046535 | Ga0495586_0070055 | Ga0495586_0070055_1284_1790 | 168 |
| 175 | 3300046559 | Ga0495667_0036878 | Ga0495667_0036878_1211_1717 | 168 |
| 176 | 3300046642 | Ga0495634_0253712 | Ga0495634_0253712_236_742 | 168 |
| 177 | 3300046642 | Ga0495634_0625820 | Ga0495634_0625820_58_564 | 168 |
| 178 | 3300046675 | Ga0495657_0267295 | Ga0495657_0267295_107_613 | 168 |
| 179 | 3300046679 | Ga0495623_0171811 | Ga0495623_0171811_203_709 | 168 |
| 180 | 3300046689 | Ga0495613_0178051 | Ga0495613_0178051_63_569 | 168 |
| 181 | 3300047319 | Ga0495674_0287570 | Ga0495674_0287570_580_1086 | 168 |
| 182 | 3300047322 | Ga0495680_0020509 | Ga0495680_0020509_1384_1890 | 168 |
| 183 | 3300047322 | Ga0495680_0084887 | Ga0495680_0084887_1014_1520 | 168 |
| 184 | 3300047444 | Ga0495675_0186773 | Ga0495675_0186773_299_805 | 168 |
| 185 | 3300047673 | Ga0495593_0251642 | Ga0495593_0251642_184_690 | 168 |
| 186 | 3300048088 | Ga0495602_0159163 | Ga0495602_0159163_1024_1530 | 168 |
| 187 | 3300048907 | Ga0496104_0962036 | Ga0496104_0962036_127_633 | 168 |
| 188 | 3300048912 | Ga0496109_0052229 | Ga0496109_0052229_1951_2457 | 168 |
| 189 | 3300048913 | Ga0496110_0621037 | Ga0496110_0621037_217_723 | 168 |
| 190 | 3300048914 | Ga0496111_0302269 | Ga0496111_0302269_109_615 | 168 |
| 191 | 3300048915 | Ga0496112_0003538 | Ga0496112_0003538_3267_3773 | 168 |
| 192 | 3300048916 | Ga0496113_0099253 | Ga0496113_0099253_705_1211 | 168 |
| 193 | 3300050507 | nmdc:mga05p37_393821_c1 | nmdc:mga05p37_393821_c1_49_555 | 168 |
| 194 | 3300050513 | nmdc:mga0rr50_916662_c1 | nmdc:mga0rr50_916662_c1_52_558 | 168 |
| 195 | 3300005329 | Ga0070683_100000684 | Ga0070683_1000006847 | 169 |
| 196 | 3300005329 | Ga0070683_100067312 | Ga0070683_1000673125 | 169 |
| 197 | 3300005329 | Ga0070683_100805360 | Ga0070683_1008053602 | 169 |
| 198 | 3300005331 | Ga0070670_100478340 | Ga0070670_1004783401 | 169 |
| 199 | 3300005334 | Ga0068869_101094136 | Ga0068869_1010941361 | 169 |
| 200 | 3300005344 | Ga0070661_100105552 | Ga0070661_1001055523 | 169 |
| 201 | 3300005344 | Ga0070661_100435600 | Ga0070661_1004356002 | 169 |
| 202 | 3300005354 | Ga0070675_100354188 | Ga0070675_1003541882 | 169 |
| 203 | 3300005436 | Ga0070713_100489729 | Ga0070713_1004897291 | 169 |
| 204 | 3300005439 | Ga0070711_100249881 | Ga0070711_1002498812 | 169 |
| 205 | 3300005440 | Ga0070705_100052714 | Ga0070705_1000527142 | 169 |
| 206 | 3300005440 | Ga0070705_100281213 | Ga0070705_1002812132 | 169 |
| 207 | 3300005530 | Ga0070679_100059904 | Ga0070679_1000599042 | 169 |
| 208 | 3300005535 | Ga0070684_100027076 | Ga0070684_1000270766 | 169 |
| 209 | 3300005535 | Ga0070684_100151012 | Ga0070684_1001510123 | 169 |
| 210 | 3300005535 | Ga0070684_101098965 | Ga0070684_1010989652 | 169 |
| 211 | 3300005564 | Ga0070664_100049026 | Ga0070664_1000490265 | 169 |
| 212 | 3300005614 | Ga0068856_101383714 | Ga0068856_1013837141 | 169 |
| 213 | 3300005616 | Ga0068852_100301392 | Ga0068852_1003013922 | 169 |
| 214 | 3300005618 | Ga0068864_100758523 | Ga0068864_1007585232 | 169 |
| 215 | 3300006358 | Ga0068871_101192787 | Ga0068871_1011927871 | 169 |
| 216 | 3300009551 | Ga0105238_10067762 | Ga0105238_100677623 | 169 |
| 217 | 3300013105 | Ga0157369_12138160 | Ga0157369_121381601 | 169 |
| 218 | 3300014326 | Ga0157380_10260129 | Ga0157380_102601293 | 169 |
| 219 | 3300021384 | Ga0213876_10489700 | Ga0213876_104897001 | 169 |
| 220 | 3300025916 | Ga0207663_10032949 | Ga0207663_100329494 | 169 |
| 221 | 3300025920 | Ga0207649_10048214 | Ga0207649_100482142 | 169 |
| 222 | 3300025920 | Ga0207649_10670836 | Ga0207649_106708361 | 169 |
| 223 | 3300025921 | Ga0207652_10071343 | Ga0207652_100713433 | 169 |
| 224 | 3300025927 | Ga0207687_10292870 | Ga0207687_102928702 | 169 |
| 225 | 3300025944 | Ga0207661_10001254 | Ga0207661_1000125413 | 169 |
| 226 | 3300025944 | Ga0207661_11066021 | Ga0207661_110660211 | 169 |
| 227 | 3300025945 | Ga0207679_10385546 | Ga0207679_103855462 | 169 |
| 228 | 3300026078 | Ga0207702_11311439 | Ga0207702_113114391 | 169 |
| 229 | 3300026095 | Ga0207676_10699020 | Ga0207676_106990202 | 169 |
| 230 | 3300026118 | Ga0207675_101332497 | Ga0207675_1013324971 | 169 |
| 231 | 3300026142 | Ga0207698_10198570 | Ga0207698_101985705 | 169 |
| 232 | 3300035086 | Ga0373934_0009381 | Ga0373934_0009381_211_720 | 169 |
| 233 | 3300035111 | Ga0373923_0000215 | Ga0373923_0000215_986_1495 | 169 |
| 234 | 3300035117 | Ga0373953_0004092 | Ga0373953_0004092_1643_2152 | 169 |
| 235 | 3300035120 | Ga0373957_0007957 | Ga0373957_0007957_710_1219 | 169 |
| 236 | 3300035410 | Ga0373924_0003297 | Ga0373924_0003297_655_1164 | 169 |
| 237 | 3300035692 | Ga0373935_0077331 | Ga0373935_0077331_681_1190 | 169 |
| 238 | 3300035724 | Ga0373933_0019489 | Ga0373933_0019489_2929_3438 | 169 |
| 239 | 3300035725 | Ga0373947_0277680 | Ga0373947_0277680_452_961 | 169 |
| 240 | 3300036401 | Ga0373937_0000709 | Ga0373937_0000709_3994_4503 | 169 |
| 241 | 3300039437 | Ga0436365_0859341 | Ga0436365_0859341_46_555 | 169 |
| 242 | 3300039437 | Ga0436365_1608551 | Ga0436365_1608551_267_776 | 169 |
| 243 | 3300044658 | Ga0466972_0390438 | Ga0466972_0390438_56_565 | 169 |
| 244 | 3300044693 | Ga0466961_0078848 | Ga0466961_0078848_1547_2059 | 169 |
| 245 | 3300045976 | Ga0466967_0171899 | Ga0466967_0171899_275_784 | 169 |
| 246 | 3300045976 | Ga0466967_0205991 | Ga0466967_0205991_1145_1654 | 169 |
| 247 | 3300045976 | Ga0466967_2203533 | Ga0466967_2203533_22_531 | 169 |
| 248 | 3300046454 | Ga0495592_0001141 | Ga0495592_0001141_13368_13877 | 169 |
| 249 | 3300046459 | Ga0495629_0101874 | Ga0495629_0101874_1224_1733 | 169 |
| 250 | 3300046462 | Ga0495651_0005547 | Ga0495651_0005547_4019_4528 | 169 |
| 251 | 3300046463 | Ga0495653_0000157 | Ga0495653_0000157_12157_12666 | 169 |
| 252 | 3300046511 | Ga0495608_0014474 | Ga0495608_0014474_4696_5205 | 169 |
| 253 | 3300046514 | Ga0495618_0050540 | Ga0495618_0050540_704_1213 | 169 |
| 254 | 3300046516 | Ga0495628_0001862 | Ga0495628_0001862_15706_16215 | 169 |
| 255 | 3300046517 | Ga0495630_0003904 | Ga0495630_0003904_883_1392 | 169 |
| 256 | 3300046529 | Ga0495652_0010363 | Ga0495652_0010363_4443_4952 | 169 |
| 257 | 3300046531 | Ga0495665_0008619 | Ga0495665_0008619_1758_2267 | 169 |
| 258 | 3300046533 | Ga0495640_0294228 | Ga0495640_0294228_397_906 | 169 |
| 259 | 3300046536 | Ga0495587_0001926 | Ga0495587_0001926_8899_9408 | 169 |
| 260 | 3300046543 | Ga0495645_0004875 | Ga0495645_0004875_3889_4398 | 169 |
| 261 | 3300046559 | Ga0495667_0008678 | Ga0495667_0008678_3536_4045 | 169 |
| 262 | 3300046642 | Ga0495634_0349260 | Ga0495634_0349260_55_564 | 169 |
| 263 | 3300046663 | Ga0495635_0006979 | Ga0495635_0006979_4563_5072 | 169 |
| 264 | 3300046675 | Ga0495657_0001113 | Ga0495657_0001113_6959_7468 | 169 |
| 265 | 3300046678 | Ga0495599_0000410 | Ga0495599_0000410_2847_3356 | 169 |
| 266 | 3300046679 | Ga0495623_0000029 | Ga0495623_0000029_30541_31050 | 169 |
| 267 | 3300046680 | Ga0495646_0000513 | Ga0495646_0000513_16630_17139 | 169 |
| 268 | 3300046689 | Ga0495613_0113361 | Ga0495613_0113361_1101_1610 | 169 |
| 269 | 3300046809 | Ga0495600_0000242 | Ga0495600_0000242_13313_13822 | 169 |
| 270 | 3300047317 | Ga0495604_0001545 | Ga0495604_0001545_14562_15071 | 169 |
| 271 | 3300047319 | Ga0495674_0004815 | Ga0495674_0004815_701_1210 | 169 |
| 272 | 3300047322 | Ga0495680_0005714 | Ga0495680_0005714_5635_6144 | 169 |
| 273 | 3300047444 | Ga0495675_0001136 | Ga0495675_0001136_2933_3442 | 169 |
| 274 | 3300047471 | Ga0495684_0000247 | Ga0495684_0000247_6959_7468 | 169 |
| 275 | 3300048088 | Ga0495602_0001990 | Ga0495602_0001990_3890_4399 | 169 |
| 276 | 3300049570 | Ga0501033_0270902 | Ga0501033_0270902_118_627 | 169 |
| 277 | 3300049571 | Ga0501034_0576298 | Ga0501034_0576298_510_1019 | 169 |
| 278 | 3300049586 | Ga0501070_0037994 | Ga0501070_0037994_935_1444 | 169 |
| 279 | 3300049589 | Ga0501073_0356510 | Ga0501073_0356510_17_526 | 169 |
| 280 | 3300049593 | Ga0501077_0330257 | Ga0501077_0330257_435_944 | 169 |
| 281 | 3300053078 | Ga0495612_0001787 | Ga0495612_0001787_4995_5504 | 169 |
| 282 | 3300053084 | Ga0495595_0021665 | Ga0495595_0021665_2282_2791 | 169 |
| 283 | 3300053085 | Ga0495619_0000831 | Ga0495619_0000831_16892_17401 | 169 |
| 284 | 3300005434 | Ga0070709_10003037 | Ga0070709_100030376 | 170 |
| 285 | 3300005434 | Ga0070709_10118811 | Ga0070709_101188112 | 170 |
| 286 | 3300005435 | Ga0070714_100084912 | Ga0070714_1000849123 | 170 |
| 287 | 3300005436 | Ga0070713_100065441 | Ga0070713_1000654413 | 170 |
| 288 | 3300005436 | Ga0070713_100211078 | Ga0070713_1002110782 | 170 |
| 289 | 3300005437 | Ga0070710_10141824 | Ga0070710_101418242 | 170 |
| 290 | 3300005439 | Ga0070711_100273330 | Ga0070711_1002733301 | 170 |
| 291 | 3300006028 | Ga0070717_10192083 | Ga0070717_101920831 | 170 |
| 292 | 3300006173 | Ga0070716_100306874 | Ga0070716_1003068742 | 170 |
| 293 | 3300009094 | Ga0111539_10059083 | Ga0111539_100590833 | 170 |
| 294 | 3300013296 | Ga0157374_10154428 | Ga0157374_101544283 | 170 |
| 295 | 3300014969 | Ga0157376_10113390 | Ga0157376_101133903 | 170 |
| 296 | 3300025898 | Ga0207692_10223619 | Ga0207692_102236192 | 170 |
| 297 | 3300025906 | Ga0207699_10001120 | Ga0207699_1000112010 | 170 |
| 298 | 3300025916 | Ga0207663_10526200 | Ga0207663_105262001 | 170 |
| 299 | 3300025926 | Ga0207659_10089972 | Ga0207659_100899722 | 170 |
| 300 | 3300025928 | Ga0207700_10176945 | Ga0207700_101769452 | 170 |
| 301 | 3300025928 | Ga0207700_10641997 | Ga0207700_106419972 | 170 |
| 302 | 3300025939 | Ga0207665_10040986 | Ga0207665_100409862 | 170 |
| 303 | 3300027907 | Ga0207428_10059021 | Ga0207428_100590213 | 170 |
| 304 | 3300035086 | Ga0373934_0008392 | Ga0373934_0008392_577_1089 | 170 |
| 305 | 3300035119 | Ga0373956_0007916 | Ga0373956_0007916_1546_2058 | 170 |
| 306 | 3300035172 | Ga0373955_0018796 | Ga0373955_0018796_1248_1760 | 170 |
| 307 | 3300035724 | Ga0373933_0011984 | Ga0373933_0011984_147_659 | 170 |
| 308 | 3300036401 | Ga0373937_0000944 | Ga0373937_0000944_8877_9389 | 170 |
| 309 | 3300046462 | Ga0495651_0010914 | Ga0495651_0010914_3680_4192 | 170 |
| 310 | 3300046517 | Ga0495630_0359896 | Ga0495630_0359896_166_678 | 170 |
| 311 | 3300046529 | Ga0495652_0024953 | Ga0495652_0024953_675_1187 | 170 |
| 312 | 3300046536 | Ga0495587_0001198 | Ga0495587_0001198_6743_7255 | 170 |
| 313 | 3300046543 | Ga0495645_0000075 | Ga0495645_0000075_63863_64375 | 170 |
| 314 | 3300046559 | Ga0495667_0003826 | Ga0495667_0003826_5446_5958 | 170 |
| 315 | 3300046678 | Ga0495599_0013688 | Ga0495599_0013688_2142_2654 | 170 |
| 316 | 3300046679 | Ga0495623_0020671 | Ga0495623_0020671_1692_2204 | 170 |
| 317 | 3300046809 | Ga0495600_0046712 | Ga0495600_0046712_1381_1893 | 170 |
| 318 | 3300047444 | Ga0495675_0019810 | Ga0495675_0019810_1235_1747 | 170 |
| 319 | 3300047471 | Ga0495684_0194035 | Ga0495684_0194035_574_1086 | 170 |
| 320 | 3300048088 | Ga0495602_0223661 | Ga0495602_0223661_766_1278 | 170 |
| 321 | 3300048907 | Ga0496104_0897950 | Ga0496104_0897950_199_711 | 170 |
| 322 | 3300050511 | nmdc:mga08y16_16097_c1 | nmdc:mga08y16_16097_c1_4015_4527 | 170 |
| 323 | 3300053084 | Ga0495595_0389063 | Ga0495595_0389063_41_553 | 170 |
| 324 | 3300005841 | Ga0068863_100305293 | Ga0068863_1003052932 | 171 |
| 325 | 3300009177 | Ga0105248_10539558 | Ga0105248_105395582 | 171 |
| 326 | 3300014325 | Ga0163163_10065674 | Ga0163163_100656746 | 171 |
| 327 | 3300014325 | Ga0163163_10127629 | Ga0163163_101276291 | 171 |
| 328 | 3300026088 | Ga0207641_10242847 | Ga0207641_102428472 | 171 |
| 329 | 3300046499 | Ga0495594_0025164 | Ga0495594_0025164_1038_1553 | 171 |
| 330 | 3300046809 | Ga0495600_0286000 | Ga0495600_0286000_299_814 | 171 |
| 331 | 3300001976 | JGI24752J21851_1013023 | JGI24752J21851_10130232 | 172 |
| 332 | 3300005290 | Ga0065712_10150629 | Ga0065712_101506292 | 172 |
| 333 | 3300005327 | Ga0070658_10150502 | Ga0070658_101505023 | 172 |
| 334 | 3300005329 | Ga0070683_100151521 | Ga0070683_1001515213 | 172 |
| 335 | 3300005329 | Ga0070683_100779158 | Ga0070683_1007791582 | 172 |
| 336 | 3300005330 | Ga0070690_100206967 | Ga0070690_1002069671 | 172 |
| 337 | 3300005331 | Ga0070670_100485482 | Ga0070670_1004854822 | 172 |
| 338 | 3300005334 | Ga0068869_100248241 | Ga0068869_1002482412 | 172 |
| 339 | 3300005335 | Ga0070666_10032334 | Ga0070666_100323343 | 172 |
| 340 | 3300005336 | Ga0070680_100130750 | Ga0070680_1001307501 | 172 |
| 341 | 3300005337 | Ga0070682_100005921 | Ga0070682_1000059219 | 172 |
| 342 | 3300005338 | Ga0068868_100365695 | Ga0068868_1003656952 | 172 |
| 343 | 3300005339 | Ga0070660_100555339 | Ga0070660_1005553392 | 172 |
| 344 | 3300005340 | Ga0070689_100021001 | Ga0070689_1000210015 | 172 |
| 345 | 3300005344 | Ga0070661_100042065 | Ga0070661_1000420654 | 172 |
| 346 | 3300005345 | Ga0070692_10024762 | Ga0070692_100247623 | 172 |
| 347 | 3300005354 | Ga0070675_100130611 | Ga0070675_1001306112 | 172 |
| 348 | 3300005355 | Ga0070671_100390513 | Ga0070671_1003905132 | 172 |
| 349 | 3300005364 | Ga0070673_100096466 | Ga0070673_1000964662 | 172 |
| 350 | 3300005366 | Ga0070659_100463378 | Ga0070659_1004633781 | 172 |
| 351 | 3300005435 | Ga0070714_100097402 | Ga0070714_1000974023 | 172 |
| 352 | 3300005437 | Ga0070710_10114908 | Ga0070710_101149083 | 172 |
| 353 | 3300005439 | Ga0070711_100048851 | Ga0070711_1000488514 | 172 |
| 354 | 3300005439 | Ga0070711_100330237 | Ga0070711_1003302372 | 172 |
| 355 | 3300005457 | Ga0070662_100087515 | Ga0070662_1000875152 | 172 |
| 356 | 3300005458 | Ga0070681_10101254 | Ga0070681_101012542 | 172 |
| 357 | 3300005466 | Ga0070685_10459202 | Ga0070685_104592021 | 172 |
| 358 | 3300005530 | Ga0070679_100048518 | Ga0070679_1000485182 | 172 |
| 359 | 3300005535 | Ga0070684_100005806 | Ga0070684_10000580610 | 172 |
| 360 | 3300005535 | Ga0070684_100010282 | Ga0070684_1000102822 | 172 |
| 361 | 3300005545 | Ga0070695_100619908 | Ga0070695_1006199082 | 172 |
| 362 | 3300005547 | Ga0070693_100009723 | Ga0070693_1000097233 | 172 |
| 363 | 3300005563 | Ga0068855_100337159 | Ga0068855_1003371591 | 172 |
| 364 | 3300005563 | Ga0068855_100590995 | Ga0068855_1005909952 | 172 |
| 365 | 3300005577 | Ga0068857_100803208 | Ga0068857_1008032082 | 172 |
| 366 | 3300005614 | Ga0068856_100015981 | Ga0068856_1000159819 | 172 |
| 367 | 3300005615 | Ga0070702_100006359 | Ga0070702_1000063595 | 172 |
| 368 | 3300005616 | Ga0068852_100741182 | Ga0068852_1007411822 | 172 |
| 369 | 3300005617 | Ga0068859_100055932 | Ga0068859_1000559322 | 172 |
| 370 | 3300005618 | Ga0068864_100168007 | Ga0068864_1001680072 | 172 |
| 371 | 3300005840 | Ga0068870_10036966 | Ga0068870_100369663 | 172 |
| 372 | 3300005841 | Ga0068863_100917725 | Ga0068863_1009177251 | 172 |
| 373 | 3300005842 | Ga0068858_100999705 | Ga0068858_1009997051 | 172 |
| 374 | 3300005843 | Ga0068860_100322398 | Ga0068860_1003223982 | 172 |
| 375 | 3300006237 | Ga0097621_100379968 | Ga0097621_1003799682 | 172 |
| 376 | 3300006358 | Ga0068871_100237698 | Ga0068871_1002376982 | 172 |
| 377 | 3300006931 | Ga0097620_100055929 | Ga0097620_1000559293 | 172 |
| 378 | 3300009093 | Ga0105240_10117581 | Ga0105240_101175813 | 172 |
| 379 | 3300009098 | Ga0105245_10176729 | Ga0105245_101767292 | 172 |
| 380 | 3300009148 | Ga0105243_10735986 | Ga0105243_107359861 | 172 |
| 381 | 3300009174 | Ga0105241_10407067 | Ga0105241_104070671 | 172 |
| 382 | 3300009177 | Ga0105248_10060795 | Ga0105248_100607951 | 172 |
| 383 | 3300009551 | Ga0105238_10129936 | Ga0105238_101299362 | 172 |
| 384 | 3300010375 | Ga0105239_12682060 | Ga0105239_126820601 | 172 |
| 385 | 3300011119 | Ga0105246_10004486 | Ga0105246_100044863 | 172 |
| 386 | 3300013100 | Ga0157373_10007387 | Ga0157373_100073872 | 172 |
| 387 | 3300013102 | Ga0157371_10045738 | Ga0157371_100457381 | 172 |
| 388 | 3300013105 | Ga0157369_10017818 | Ga0157369_100178184 | 172 |
| 389 | 3300013105 | Ga0157369_10731060 | Ga0157369_107310602 | 172 |
| 390 | 3300013296 | Ga0157374_10058225 | Ga0157374_100582254 | 172 |
| 391 | 3300013297 | Ga0157378_10523261 | Ga0157378_105232612 | 172 |
| 392 | 3300013307 | Ga0157372_10088039 | Ga0157372_100880393 | 172 |
| 393 | 3300014325 | Ga0163163_10161841 | Ga0163163_101618412 | 172 |
| 394 | 3300014745 | Ga0157377_10039390 | Ga0157377_100393902 | 172 |
| 395 | 3300014968 | Ga0157379_10284841 | Ga0157379_102848411 | 172 |
| 396 | 3300014969 | Ga0157376_10039738 | Ga0157376_100397384 | 172 |
| 397 | 3300025898 | Ga0207692_10047328 | Ga0207692_100473283 | 172 |
| 398 | 3300025903 | Ga0207680_10115418 | Ga0207680_101154182 | 172 |
| 399 | 3300025903 | Ga0207680_10281860 | Ga0207680_102818602 | 172 |
| 400 | 3300025908 | Ga0207643_10028182 | Ga0207643_100281823 | 172 |
| 401 | 3300025909 | Ga0207705_10039042 | Ga0207705_100390422 | 172 |
| 402 | 3300025911 | Ga0207654_10404608 | Ga0207654_104046081 | 172 |
| 403 | 3300025912 | Ga0207707_10227486 | Ga0207707_102274861 | 172 |
| 404 | 3300025917 | Ga0207660_10273250 | Ga0207660_102732502 | 172 |
| 405 | 3300025919 | Ga0207657_10418744 | Ga0207657_104187442 | 172 |
| 406 | 3300025920 | Ga0207649_10064616 | Ga0207649_100646162 | 172 |
| 407 | 3300025921 | Ga0207652_10298341 | Ga0207652_102983412 | 172 |
| 408 | 3300025925 | Ga0207650_10253110 | Ga0207650_102531102 | 172 |
| 409 | 3300025926 | Ga0207659_10170615 | Ga0207659_101706152 | 172 |
| 410 | 3300025931 | Ga0207644_11085994 | Ga0207644_110859941 | 172 |
| 411 | 3300025932 | Ga0207690_10010072 | Ga0207690_100100724 | 172 |
| 412 | 3300025933 | Ga0207706_10059933 | Ga0207706_100599332 | 172 |
| 413 | 3300025936 | Ga0207670_10212737 | Ga0207670_102127372 | 172 |
| 414 | 3300025941 | Ga0207711_10281223 | Ga0207711_102812232 | 172 |
| 415 | 3300025942 | Ga0207689_10001543 | Ga0207689_1000154317 | 172 |
| 416 | 3300025944 | Ga0207661_10106191 | Ga0207661_101061912 | 172 |
| 417 | 3300025944 | Ga0207661_10188301 | Ga0207661_101883012 | 172 |
| 418 | 3300025945 | Ga0207679_10086511 | Ga0207679_100865112 | 172 |
| 419 | 3300025986 | Ga0207658_10818405 | Ga0207658_108184052 | 172 |
| 420 | 3300026023 | Ga0207677_10258088 | Ga0207677_102580881 | 172 |
| 421 | 3300026035 | Ga0207703_10303501 | Ga0207703_103035012 | 172 |
| 422 | 3300026088 | Ga0207641_11867236 | Ga0207641_118672361 | 172 |
| 423 | 3300026095 | Ga0207676_10001991 | Ga0207676_100019919 | 172 |
| 424 | 3300026116 | Ga0207674_10000210 | Ga0207674_100002105 | 172 |
| 425 | 3300026121 | Ga0207683_10289532 | Ga0207683_102895322 | 172 |
| 426 | 3300026142 | Ga0207698_10782259 | Ga0207698_107822592 | 172 |
| 427 | 3300028381 | Ga0268264_11304018 | Ga0268264_113040181 | 172 |
| 428 | 3300049570 | Ga0501033_0171599 | Ga0501033_0171599_1004_1525 | 172 |
| 429 | 3300049571 | Ga0501034_0090426 | Ga0501034_0090426_1003_1524 | 172 |
| 430 | 3300049574 | Ga0501038_0079253 | Ga0501038_0079253_2046_2567 | 172 |
| 431 | 3300049822 | Ga0501035_0108318 | Ga0501035_0108318_1482_2003 | 172 |
| 432 | 3300049823 | Ga0501044_0037849 | Ga0501044_0037849_1991_2512 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cex-assembly1.cif.gz_A | crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis | 0.8165 | 14 | 165 |
| 2p1a-assembly1.cif.gz_B | crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution | 0.8049 | 18 | 166 |
| 2p1a-assembly1.cif.gz_A | crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution | 0.8004 | 18 | 159 |
| 2ou6-assembly1.cif.gz_A-2 | crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution | 0.7994 | 1 | 163 |
| 2hkv-assembly1.cif.gz_A-2 | crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution | 0.7978 | 9 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hkvA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8048 | 15 | 163 | 1.20.120.450 |
| af_O53728_4_171_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7925 | 17 | 164 | 1.20.120.450 |
| 2yqyB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7893 | 20 | 156 | 1.20.120.450 |
| 2hkvA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7843 | 15 | 163 | 1.20.120.450 |
| 3cexB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7785 | 15 | 165 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M4IVF4-F1-model_v4 | DinB family protein | 0.989 | 1 | 166 |
|
| AF-A0A4Q5RHQ0-F1-model_v4 | DinB family protein | 0.976 | 16 | 165 |
|
| AF-A0A559NV87-F1-model_v4 | DinB family protein | 0.9716 | 2 | 166 |
|
| AF-A0A1I5XWE7-F1-model_v4 | DinB superfamily protein | 0.9693 | 3 | 165 |
|
| AF-A0A1Q4G926-F1-model_v4 | Metal-dependent hydrolase | 0.9674 | 1 | 161 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar