F442533

General Info

Members Datasets Scaffolds Average Seq Length
432 213 864 178

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100218693|Ga0070674_1002186933
Length 213
Sequence MSPARQAASSHKPKHCKQLSIFGFRHGLCSSTVRRIRVTIRKASGFALIDLVFVCGIIGLISTIALPRLVLAKQAAGAXXXIGSLRTVSSAQLAFALTCGNGFYAPDLPSLGISPPGSNVAFIASDLSAAAVIQKSGYTIRLEGVPFAGAPPTCNGLLAGAAAQGYRAGADPLEPDNPRFFGINANSQLYQHNATLYDDMPEVGEPLIGQPIH

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.47
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 24.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100218693 3300005356 Bacteria 1481
2 Ga0065712_10075719 3300005290 Bacteria 3777
3 Ga0070676_10005781 3300005328 Bacteria 6594
4 Ga0070676_10672174 3300005328 Unclassified 754
5 Ga0070683_100158537 3300005329 Bacteria 2147
6 Ga0070683_100717811 3300005329 Unclassified 957
7 Ga0070690_100042018 3300005330 Bacteria 2895
8 Ga0070690_100051125 3300005330 Bacteria 2637
9 Ga0070670_100149806 3300005331 Bacteria 2019
10 Ga0070666_10224622 3300005335 Unclassified 1325
11 Ga0068868_100098842 3300005338 Unclassified 2360
12 Ga0068868_101097240 3300005338 Unclassified 732
13 Ga0070660_100498358 3300005339 Bacteria 1013
14 Ga0070660_101017925 3300005339 Unclassified 700
15 Ga0070689_100115653 3300005340 Bacteria 2138
16 Ga0070689_100474930 3300005340 Bacteria 1067
17 Ga0070691_10004306 3300005341 Bacteria 6466
18 Ga0070691_10301064 3300005341 Bacteria 876
19 Ga0070661_100672553 3300005344 Unclassified 842
20 Ga0070668_100021273 3300005347 Bacteria 4903
21 Ga0070669_100016477 3300005353 Bacteria 5274
22 Ga0070669_100023767 3300005353 Bacteria 4392
23 Ga0070669_100029101 3300005353 Bacteria 3980
24 Ga0070669_100356826 3300005353 Unclassified 1188
25 Ga0070669_101280099 3300005353 Unclassified 635
26 Ga0070675_100040887 3300005354 Bacteria 3787
27 Ga0070675_100083715 3300005354 Bacteria 2663
28 Ga0070671_100109887 3300005355 Bacteria 2315
29 Ga0070671_100654161 3300005355 Unclassified 910
30 Ga0070674_100162841 3300005356 Bacteria 1694
31 Ga0070674_100524414 3300005356 Bacteria 990
32 Ga0070673_100111528 3300005364 Unclassified 2269
33 Ga0070673_100204196 3300005364 Bacteria 1703
34 Ga0070673_100753256 3300005364 Unclassified 897
35 Ga0070673_101112021 3300005364 Bacteria 738
36 Ga0070688_100138785 3300005365 Bacteria 1649
37 Ga0070688_100153557 3300005365 Bacteria 1576
38 Ga0070659_100314573 3300005366 Bacteria 1308
39 Ga0070659_100376455 3300005366 Bacteria 1195
40 Ga0070667_100018837 3300005367 Bacteria 5724
41 Ga0070667_100346596 3300005367 Bacteria 1344
42 Ga0070709_10151551 3300005434 Bacteria 1603
43 Ga0070705_100011365 3300005440 Bacteria 4490
44 Ga0070705_100197043 3300005440 Unclassified 1378
45 Ga0070705_101045587 3300005440 Bacteria 665
46 Ga0070700_100001850 3300005441 Bacteria 10677
47 Ga0070700_100095043 3300005441 Bacteria 1953
48 Ga0070694_100188910 3300005444 Bacteria 1529
49 Ga0070708_100279176 3300005445 Bacteria 1572
50 Ga0070678_100071695 3300005456 Bacteria 2594
51 Ga0070678_100390002 3300005456 Bacteria 1207
52 Ga0070681_10085603 3300005458 Bacteria 3104
53 Ga0068867_100015321 3300005459 Bacteria 5436
54 Ga0068867_100029080 3300005459 Bacteria 3982
55 Ga0068867_100302343 3300005459 Bacteria 1319
56 Ga0068867_100367394 3300005459 Bacteria 1205
57 Ga0070685_10089340 3300005466 Bacteria 1862
58 Ga0070685_10822047 3300005466 Unclassified 686
59 Ga0070706_100554444 3300005467 Bacteria 1069
60 Ga0070706_100691441 3300005467 Unclassified 946
61 Ga0070707_100256796 3300005468 Unclassified 1700
62 Ga0070698_100449032 3300005471 Bacteria 1225
63 Ga0070698_100527613 3300005471 Unclassified 1119
64 Ga0070698_100711562 3300005471 Unclassified 947
65 Ga0070698_100954508 3300005471 Unclassified 804
66 Ga0070699_100162167 3300005518 Bacteria 1979
67 Ga0070679_100082945 3300005530 Bacteria 3195
68 Ga0070684_100123549 3300005535 Bacteria 2330
69 Ga0070697_100016587 3300005536 Bacteria 5795
70 Ga0070697_100430630 3300005536 Unclassified 1147
71 Ga0068853_100400070 3300005539 Bacteria 1285
72 Ga0070672_100224038 3300005543 Bacteria 1578
73 Ga0070672_100280434 3300005543 Bacteria 1409
74 Ga0070672_100430235 3300005543 Bacteria 1135
75 Ga0070686_100001384 3300005544 Bacteria 13700
76 Ga0070686_100388671 3300005544 Bacteria 1058
77 Ga0070686_100465885 3300005544 Bacteria 974
78 Ga0070695_100029455 3300005545 Unclassified 3411
79 Ga0070695_100270756 3300005545 Bacteria 1244
80 Ga0070695_100404672 3300005545 Bacteria 1035
81 Ga0070696_100013581 3300005546 Bacteria 5466
82 Ga0070696_100076649 3300005546 Unclassified 2361
83 Ga0070696_100125526 3300005546 Bacteria 1861
84 Ga0070696_100672749 3300005546 Unclassified 841
85 Ga0070696_100913671 3300005546 Bacteria 729
86 Ga0070665_100004563 3300005548 Bacteria 14512
87 Ga0070665_100114227 3300005548 Bacteria 2703
88 Ga0070704_100166733 3300005549 Bacteria 1747
89 Ga0068855_100005452 3300005563 Bacteria 15511
90 Ga0070664_100181443 3300005564 Bacteria 1871
91 Ga0070664_100412302 3300005564 Bacteria 1236
92 Ga0070664_100566864 3300005564 Bacteria 1051
93 Ga0070664_100699230 3300005564 Bacteria 944
94 Ga0068854_100019974 3300005578 Bacteria 4522
95 Ga0068854_100027127 3300005578 Bacteria 3945
96 Ga0068854_100369563 3300005578 Bacteria 1179
97 Ga0068856_100092486 3300005614 Bacteria 3010
98 Ga0070702_100006680 3300005615 Bacteria 5479
99 Ga0068852_100215419 3300005616 Bacteria 1824
100 Ga0068852_100488686 3300005616 Bacteria 1224
101 Ga0068852_100546413 3300005616 Bacteria 1158
102 Ga0068852_101247612 3300005616 Unclassified 765
103 Ga0068859_100087306 3300005617 Bacteria 3167
104 Ga0068859_100613030 3300005617 Bacteria 1181
105 Ga0068864_100011321 3300005618 Bacteria 7371
106 Ga0068864_100236199 3300005618 Unclassified 1692
107 Ga0068866_10265939 3300005718 Bacteria 1056
108 Ga0068861_100000576 3300005719 Bacteria 21675
109 Ga0068861_100051881 3300005719 Bacteria 3116
110 Ga0068861_100113426 3300005719 Bacteria 2174
111 Ga0068861_100731344 3300005719 Unclassified 922
112 Ga0068851_10088772 3300005834 Unclassified 1625
113 Ga0068863_100060757 3300005841 Bacteria 3574
114 Ga0068863_101309316 3300005841 Bacteria 731
115 Ga0068858_100031242 3300005842 Bacteria 4945
116 Ga0068858_100091464 3300005842 Bacteria 2832
117 Ga0068858_100856106 3300005842 Unclassified 888
118 Ga0068858_101384889 3300005842 Unclassified 693
119 Ga0068860_100107659 3300005843 Bacteria 2664
120 Ga0068860_100164966 3300005843 Bacteria 2138
121 Ga0068862_100078722 3300005844 Bacteria 2856
122 Ga0068862_100140326 3300005844 Bacteria 2144
123 Ga0068862_100456640 3300005844 Bacteria 1205
124 Ga0068862_100599858 3300005844 Unclassified 1057
125 Ga0081455_10032141 3300005937 Bacteria 4735
126 Ga0081455_10105856 3300005937 Unclassified 2247
127 Ga0081539_10030146 3300005985 Bacteria 3373
128 Ga0070716_100588289 3300006173 Bacteria 835
129 Ga0070712_100283220 3300006175 Bacteria 1336
130 Ga0097621_100002971 3300006237 Bacteria 11640
131 Ga0097621_100062021 3300006237 Bacteria 3068
132 Ga0097621_100080028 3300006237 Unclassified 2717
133 Ga0097621_100185372 3300006237 Bacteria 1800
134 Ga0068871_100002453 3300006358 Bacteria 12663
135 Ga0068871_100050817 3300006358 Unclassified 3354
136 Ga0068871_100058123 3300006358 Bacteria 3148
137 Ga0068871_100061791 3300006358 Bacteria 3060
138 Ga0068871_100131170 3300006358 Bacteria 2125
139 Ga0068871_100134976 3300006358 Bacteria 2095
140 Ga0075428_100332556 3300006844 Bacteria 1632
141 Ga0075431_100125794 3300006847 Bacteria 2645
142 Ga0075433_10033049 3300006852 Bacteria 4434
143 Ga0075433_10169737 3300006852 Bacteria 1941
144 Ga0075433_10506256 3300006852 Bacteria 1063
145 Ga0075433_10549056 3300006852 Bacteria 1016
146 Ga0075434_100914471 3300006871 Unclassified 892
147 Ga0068865_100221738 3300006881 Bacteria 1479
148 Ga0075436_100088219 3300006914 Bacteria 2155
149 Ga0097620_100087303 3300006931 Bacteria 3167
150 Ga0097620_100613147 3300006931 Bacteria 1181
151 Ga0075435_100002185 3300007076 Bacteria 12908
152 Ga0075435_100002960 3300007076 Bacteria 11422
153 Ga0075435_100487466 3300007076 Bacteria 1065
154 Ga0099794_10336054 3300007265 Unclassified 785
155 Ga0105240_10065913 3300009093 Bacteria 4494
156 Ga0105240_10160718 3300009093 Bacteria 2668
157 Ga0105240_11807861 3300009093 Bacteria 637
158 Ga0111539_10005467 3300009094 Bacteria 16437
159 Ga0111539_10052937 3300009094 Bacteria 4831
160 Ga0111539_10342569 3300009094 Bacteria 1740
161 Ga0111539_10391327 3300009094 Bacteria 1619
162 Ga0111539_10519516 3300009094 Bacteria 1387
163 Ga0111539_10907082 3300009094 Bacteria 1025
164 Ga0105245_10438595 3300009098 Bacteria 1312
165 Ga0105245_10937619 3300009098 Unclassified 908
166 Ga0105245_11203573 3300009098 Bacteria 805
167 Ga0105247_10015312 3300009101 Bacteria 4595
168 Ga0114129_10011485 3300009147 Bacteria 12609
169 Ga0114129_10011838 3300009147 Bacteria 12409
170 Ga0114129_10527622 3300009147 Bacteria 1539
171 Ga0114129_11358923 3300009147 Unclassified 878
172 Ga0114129_12099920 3300009147 Unclassified 681
173 Ga0105243_10004797 3300009148 Bacteria 10628
174 Ga0105243_10013114 3300009148 Bacteria 6264
175 Ga0105243_11986944 3300009148 Unclassified 616
176 Ga0105241_10154569 3300009174 Bacteria 1880
177 Ga0105242_10252140 3300009176 Bacteria 1591
178 Ga0105242_10422834 3300009176 Bacteria 1249
179 Ga0105242_11292707 3300009176 Bacteria 753
180 Ga0105248_10050577 3300009177 Bacteria 4662
181 Ga0105248_10127759 3300009177 Bacteria 2868
182 Ga0105248_10176358 3300009177 Bacteria 2408
183 Ga0105248_10188818 3300009177 Bacteria 2322
184 Ga0105248_10231202 3300009177 Bacteria 2082
185 Ga0105248_10304518 3300009177 Bacteria 1795
186 Ga0105248_10474658 3300009177 Bacteria 1410
187 Ga0105248_10567123 3300009177 Unclassified 1281
188 Ga0105248_10629972 3300009177 Bacteria 1210
189 Ga0105237_10658742 3300009545 Bacteria 1054
190 Ga0105238_10331227 3300009551 Unclassified 1509
191 Ga0105238_10586846 3300009551 Bacteria 1121
192 Ga0105238_11044645 3300009551 Unclassified 839
193 Ga0105238_11451030 3300009551 Unclassified 714
194 Ga0105238_11693782 3300009551 Unclassified 663
195 Ga0105249_10393506 3300009553 Unclassified 1414
196 Ga0105239_10561722 3300010375 Bacteria 1300
197 Ga0105246_10190594 3300011119 Unclassified 1587
198 Ga0157315_1006539 3300012508 Bacteria 915
199 Ga0157374_10413961 3300013296 Unclassified 1346
200 Ga0157374_10693652 3300013296 Bacteria 1031
201 Ga0157378_10152219 3300013297 Bacteria 2156
202 Ga0157378_10454848 3300013297 Bacteria 1271
203 Ga0163162_10064789 3300013306 Bacteria 3700
204 Ga0163162_10107492 3300013306 Bacteria 2885
205 Ga0157375_10057577 3300013308 Bacteria 3842
206 Ga0157375_10210508 3300013308 Bacteria 2101
207 Ga0157375_10261557 3300013308 Bacteria 1892
208 Ga0157375_10752004 3300013308 Bacteria 1126
209 Ga0163163_10004080 3300014325 Bacteria 12453
210 Ga0163163_10123471 3300014325 Bacteria 2625
211 Ga0157380_10106542 3300014326 Bacteria 2346
212 Ga0157380_10157165 3300014326 Bacteria 1972
213 Ga0157380_10260218 3300014326 Bacteria 1576
214 Ga0157377_10367328 3300014745 Unclassified 970
215 Ga0157379_10006662 3300014968 Bacteria 9971
216 Ga0157379_10079400 3300014968 Bacteria 2938
217 Ga0157379_10107242 3300014968 Bacteria 2507
218 Ga0157376_10004492 3300014969 Bacteria 9720
219 Ga0157376_10042822 3300014969 Bacteria 3712
220 Ga0157376_10123386 3300014969 Bacteria 2300
221 Ga0157376_10250587 3300014969 Bacteria 1653
222 Ga0157376_10716681 3300014969 Bacteria 1007
223 Ga0163161_10826239 3300017792 Bacteria 780
224 Ga0207710_10013050 3300025900 Bacteria 3500
225 Ga0207680_10095535 3300025903 Bacteria 1899
226 Ga0207680_10220632 3300025903 Unclassified 1300
227 Ga0207699_10052000 3300025906 Bacteria 2423
228 Ga0207645_10006299 3300025907 Bacteria 8531
229 Ga0207645_10653166 3300025907 Unclassified 715
230 Ga0207684_10131564 3300025910 Bacteria 2147
231 Ga0207684_10484672 3300025910 Unclassified 1060
232 Ga0207684_10561181 3300025910 Unclassified 976
233 Ga0207684_10724963 3300025910 Unclassified 844
234 Ga0207707_10098266 3300025912 Bacteria 2559
235 Ga0207707_10535440 3300025912 Bacteria 996
236 Ga0207695_10050616 3300025913 Bacteria 4368
237 Ga0207693_10273070 3300025915 Bacteria 1325
238 Ga0207660_10665003 3300025917 Unclassified 849
239 Ga0207657_10003193 3300025919 Bacteria 17534
240 Ga0207652_10151558 3300025921 Unclassified 2076
241 Ga0207652_10658559 3300025921 Unclassified 936
242 Ga0207681_10049687 3300025923 Bacteria 2836
243 Ga0207681_10051478 3300025923 Bacteria 2790
244 Ga0207681_10109598 3300025923 Bacteria 2006
245 Ga0207681_10161106 3300025923 Bacteria 1691
246 Ga0207694_10509984 3300025924 Bacteria 1007
247 Ga0207650_10775820 3300025925 Unclassified 812
248 Ga0207659_10036069 3300025926 Unclassified 3423
249 Ga0207659_10103057 3300025926 Bacteria 2155
250 Ga0207659_10677475 3300025926 Bacteria 882
251 Ga0207687_10405096 3300025927 Bacteria 1123
252 Ga0207687_10797403 3300025927 Bacteria 805
253 Ga0207644_10122353 3300025931 Bacteria 1982
254 Ga0207644_10517121 3300025931 Unclassified 986
255 Ga0207644_10587485 3300025931 Unclassified 924
256 Ga0207690_10069642 3300025932 Bacteria 2421
257 Ga0207706_10213819 3300025933 Unclassified 1689
258 Ga0207706_10420046 3300025933 Bacteria 1158
259 Ga0207686_10034881 3300025934 Unclassified 3015
260 Ga0207686_10258911 3300025934 Bacteria 1275
261 Ga0207686_10786625 3300025934 Bacteria 762
262 Ga0207709_10019577 3300025935 Bacteria 3809
263 Ga0207709_10261769 3300025935 Unclassified 1269
264 Ga0207670_10081700 3300025936 Bacteria 2263
265 Ga0207669_10029334 3300025937 Bacteria 3042
266 Ga0207669_10060974 3300025937 Bacteria 2315
267 Ga0207669_10141676 3300025937 Bacteria 1670
268 Ga0207704_10245625 3300025938 Bacteria 1340
269 Ga0207665_10409354 3300025939 Bacteria 1034
270 Ga0207665_10560529 3300025939 Bacteria 888
271 Ga0207691_10155922 3300025940 Bacteria 2005
272 Ga0207691_10222757 3300025940 Bacteria 1635
273 Ga0207711_10004819 3300025941 Bacteria 11464
274 Ga0207711_10011372 3300025941 Bacteria 7397
275 Ga0207711_10224475 3300025941 Bacteria 1719
276 Ga0207711_10231388 3300025941 Bacteria 1693
277 Ga0207711_10547882 3300025941 Unclassified 1079
278 Ga0207661_10111768 3300025944 Bacteria 2312
279 Ga0207661_10446425 3300025944 Bacteria 1178
280 Ga0207679_10183576 3300025945 Bacteria 1733
281 Ga0207679_10376996 3300025945 Bacteria 1243
282 Ga0207679_10471907 3300025945 Bacteria 1116
283 Ga0207667_10016163 3300025949 Bacteria 8438
284 Ga0207651_10257504 3300025960 Bacteria 1431
285 Ga0207651_10527353 3300025960 Bacteria 1024
286 Ga0207712_10249007 3300025961 Unclassified 1435
287 Ga0207640_10030752 3300025981 Bacteria 3310
288 Ga0207640_10241714 3300025981 Unclassified 1395
289 Ga0207658_10026307 3300025986 Bacteria 4079
290 Ga0207658_10461727 3300025986 Unclassified 1126
291 Ga0207658_10590870 3300025986 Unclassified 997
292 Ga0207677_10196031 3300026023 Unclassified 1601
293 Ga0207677_10330487 3300026023 Unclassified 1270
294 Ga0207677_10545959 3300026023 Bacteria 1009
295 Ga0207703_10022235 3300026035 Bacteria 4972
296 Ga0207703_10048395 3300026035 Bacteria 3432
297 Ga0207703_10371800 3300026035 Unclassified 1320
298 Ga0207703_10632242 3300026035 Bacteria 1014
299 Ga0207639_10433238 3300026041 Bacteria 1191
300 Ga0207639_10546950 3300026041 Unclassified 1063
301 Ga0207639_10805313 3300026041 Bacteria 875
302 Ga0207708_10002214 3300026075 Bacteria 14371
303 Ga0207708_10017746 3300026075 Bacteria 5357
304 Ga0207708_10150934 3300026075 Bacteria 1829
305 Ga0207708_10228694 3300026075 Bacteria 1493
306 Ga0207702_10215035 3300026078 Bacteria 1789
307 Ga0207641_10358703 3300026088 Unclassified 1391
308 Ga0207641_10397980 3300026088 Unclassified 1322
309 Ga0207641_10659997 3300026088 Unclassified 1028
310 Ga0207648_10008611 3300026089 Bacteria 9865
311 Ga0207648_10030716 3300026089 Bacteria 4755
312 Ga0207676_10007084 3300026095 Bacteria 7950
313 Ga0207676_10289831 3300026095 Bacteria 1490
314 Ga0207675_100003296 3300026118 Bacteria 15808
315 Ga0207675_100020361 3300026118 Bacteria 6184
316 Ga0207675_100063073 3300026118 Bacteria 3462
317 Ga0207675_100101748 3300026118 Bacteria 2707
318 Ga0207675_100155775 3300026118 Bacteria 2177
319 Ga0207675_101215416 3300026118 Unclassified 774
320 Ga0207683_10006791 3300026121 Bacteria 9797
321 Ga0207683_10044163 3300026121 Bacteria 3896
322 Ga0207698_10303286 3300026142 Bacteria 1488
323 Ga0207698_10949336 3300026142 Bacteria 869
324 Ga0207698_11135843 3300026142 Unclassified 794
325 Ga0207698_11406153 3300026142 Unclassified 713
326 Ga0207428_10010474 3300027907 Bacteria 8277
327 Ga0207428_10119644 3300027907 Unclassified 2020
328 Ga0207428_10394469 3300027907 Bacteria 1014
329 Ga0268266_10006622 3300028379 Bacteria 10576
330 Ga0268266_10021873 3300028379 Bacteria 5449
331 Ga0268265_10386984 3300028380 Bacteria 1288
332 Ga0268264_10035788 3300028381 Bacteria 4088
333 Ga0268264_10140546 3300028381 Bacteria 2153
334 Ga0307413_10479101 3300031824 Bacteria 994
335 Ga0373930_0004848 3300034816 Bacteria 2210
336 Ga0373948_0015600 3300034817 Bacteria 1396
337 Ga0373950_0014895 3300034818 Bacteria 1313
338 Ga0373959_0006805 3300034820 Bacteria 1908
339 Ga0373938_0005396 3300034957 Bacteria 2173
340 Ga0373928_0026467 3300035084 Unclassified 1256
341 Ga0373929_0001553 3300035085 Bacteria 4360
342 Ga0373934_0111554 3300035086 Unclassified 1109
343 Ga0373940_0107061 3300035088 Bacteria 854
344 Ga0373951_0000918 3300035091 Bacteria 7929
345 Ga0373932_0002302 3300035112 Bacteria 4854
346 Ga0373939_0001782 3300035114 Bacteria 5183
347 Ga0373939_0096354 3300035114 Unclassified 1008
348 Ga0373941_0000058 3300035115 Bacteria 17110
349 Ga0373941_0132988 3300035115 Bacteria 898
350 Ga0373953_0091882 3300035117 Bacteria 1270
351 Ga0373956_0060680 3300035119 Bacteria 1713
352 Ga0373960_0015026 3300035121 Bacteria 1970
353 Ga0373943_0017686 3300035170 Bacteria 3264
354 Ga0373942_0001811 3300035207 Bacteria 5403
355 Ga0373961_0001744 3300035241 Bacteria 6051
356 Ga0373962_0002662 3300035242 Bacteria 4245
357 Ga0373931_0024258 3300035691 Bacteria 3070
358 Ga0373935_0728723 3300035692 Unclassified 730
359 Ga0373937_0039782 3300036401 Bacteria 4285
360 Ga0373937_0092839 3300036401 Bacteria 2798
361 Ga0373937_0282073 3300036401 Bacteria 1569
362 Ga0395905_0992248 3300037471 Unclassified 743
363 Ga0451576_0021009 3300045051 Bacteria 7102
364 Ga0451576_0513123 3300045051 Bacteria 1259
365 Ga0495629_0070773 3300046459 Bacteria 2434
366 Ga0495629_0146170 3300046459 Bacteria 1644
367 Ga0495639_0126092 3300046475 Bacteria 1224
368 Ga0495664_0345139 3300046477 Unclassified 897
369 Ga0495628_0415908 3300046516 Unclassified 980
370 Ga0495640_0192464 3300046533 Bacteria 1296
371 Ga0495586_0167120 3300046535 Bacteria 1242
372 Ga0495586_0424490 3300046535 Unclassified 766
373 Ga0495645_0002346 3300046543 Bacteria 12846
374 Ga0495635_0232923 3300046663 Bacteria 1244
375 Ga0495635_0234154 3300046663 Bacteria 1240
376 Ga0495635_0441344 3300046663 Bacteria 861
377 Ga0495658_0032127 3300046683 Bacteria 2865
378 Ga0495658_0193565 3300046683 Bacteria 1265
379 Ga0495658_0208620 3300046683 Bacteria 1220
380 Ga0495669_0017313 3300046684 Bacteria 3092
381 Ga0495674_0226068 3300047319 Bacteria 1546
382 Ga0495676_0639511 3300047321 Unclassified 691
383 Ga0495684_0090627 3300047471 Bacteria 2316
384 Ga0495684_0155398 3300047471 Bacteria 1709
385 Ga0496101_0164715 3300048904 Bacteria 1702
386 Ga0496101_0327691 3300048904 Bacteria 1202
387 Ga0496104_0071842 3300048907 Bacteria 3290
388 Ga0496104_0798916 3300048907 Unclassified 850
389 Ga0496106_0224879 3300048909 Bacteria 1497
390 Ga0496108_0007819 3300048911 Bacteria 8664
391 Ga0496109_0393035 3300048912 Bacteria 1310
392 Ga0496111_0292334 3300048914 Bacteria 1208
393 Ga0496111_0827330 3300048914 Unclassified 669
394 Ga0496111_0958240 3300048914 Unclassified 614
395 Ga0496112_0002605 3300048915 Bacteria 14562
396 Ga0496113_0144859 3300048916 Bacteria 1871
397 Ga0496113_0631711 3300048916 Unclassified 857
398 Ga0496113_0869928 3300048916 Unclassified 714
399 Ga0496114_0195612 3300048917 Unclassified 1770
400 Ga0501033_0606633 3300049570 Unclassified 750
401 Ga0501034_0051446 3300049571 Bacteria 4153
402 Ga0501034_0344646 3300049571 Unclassified 1419
403 Ga0501036_0306535 3300049572 Bacteria 1328
404 Ga0501043_0085532 3300049579 Bacteria 2478
405 Ga0501047_0016450 3300049581 Bacteria 7061
406 Ga0501073_0221168 3300049589 Bacteria 1308
407 Ga0501075_0198124 3300049591 Unclassified 1532
408 Ga0501044_0009674 3300049823 Bacteria 10485
409 nmdc:mga05p37_211474_c1 3300050507 Bacteria 2344
410 nmdc:mga05p37_25807_c1 3300050507 Bacteria 7145
411 nmdc:mga05p37_320941_c1 3300050507 Bacteria 1833
412 nmdc:mga05p37_658432_c1 3300050507 Bacteria 1171
413 nmdc:mga06r32_26677_c1 3300050510 Bacteria 5389
414 nmdc:mga08y16_164820_c1 3300050511 Unclassified 2302
415 nmdc:mga08y16_297568_c1 3300050511 Bacteria 1664
416 nmdc:mga08y16_534138_c1 3300050511 Bacteria 1188
417 nmdc:mga08y16_57582_c1 3300050511 Bacteria 4061
418 nmdc:mga08y16_82473_c1 3300050511 Bacteria 3352
419 nmdc:mga0n895_17946_c1 3300050512 Bacteria 6540
420 nmdc:mga0n895_766846_c1 3300050512 Unclassified 957
421 nmdc:mga0n895_850578_c1 3300050512 Unclassified 900
422 nmdc:mga0rr50_494001_c1 3300050513 Unclassified 1040
423 nmdc:mga0rr50_528_c1 3300050513 Bacteria 20402
424 nmdc:mga0rr50_637647_c1 3300050513 Unclassified 909
425 nmdc:mga0rr50_928494_c1 3300050513 Unclassified 742
426 nmdc:mga08x19_76781_c1 3300050514 Unclassified 2187
427 nmdc:mga08x19_82863_c1 3300050514 Bacteria 2108
428 nmdc:mga0a205_149912_c1 3300050515 Bacteria 2232
429 nmdc:mga0a205_170534_c1 3300050515 Bacteria 2072
430 Ga0495619_0144031 3300053085 Bacteria 1642
431 Ga0501082_0028474 3300060353 Bacteria 4813
432 Ga0530510_0638321 3300061734 Bacteria 811
433 Ga0070674_100218693
434 Ga0065712_10075719
435 Ga0070676_10005781
436 Ga0070676_10672174
437 Ga0070683_100158537
438 Ga0070683_100717811
439 Ga0070690_100042018
440 Ga0070690_100051125
441 Ga0070670_100149806
442 Ga0070666_10224622
443 Ga0068868_100098842
444 Ga0068868_101097240
445 Ga0070660_100498358
446 Ga0070660_101017925
447 Ga0070689_100115653
448 Ga0070689_100474930
449 Ga0070691_10004306
450 Ga0070691_10301064
451 Ga0070661_100672553
452 Ga0070668_100021273
453 Ga0070669_100016477
454 Ga0070669_100023767
455 Ga0070669_100029101
456 Ga0070669_100356826
457 Ga0070669_101280099
458 Ga0070675_100040887
459 Ga0070675_100083715
460 Ga0070671_100109887
461 Ga0070671_100654161
462 Ga0070674_100162841
463 Ga0070674_100524414
464 Ga0070673_100111528
465 Ga0070673_100204196
466 Ga0070673_100753256
467 Ga0070673_101112021
468 Ga0070688_100138785
469 Ga0070688_100153557
470 Ga0070659_100314573
471 Ga0070659_100376455
472 Ga0070667_100018837
473 Ga0070667_100346596
474 Ga0070709_10151551
475 Ga0070705_100011365
476 Ga0070705_100197043
477 Ga0070705_101045587
478 Ga0070700_100001850
479 Ga0070700_100095043
480 Ga0070694_100188910
481 Ga0070708_100279176
482 Ga0070678_100071695
483 Ga0070678_100390002
484 Ga0070681_10085603
485 Ga0068867_100015321
486 Ga0068867_100029080
487 Ga0068867_100302343
488 Ga0068867_100367394
489 Ga0070685_10089340
490 Ga0070685_10822047
491 Ga0070706_100554444
492 Ga0070706_100691441
493 Ga0070707_100256796
494 Ga0070698_100449032
495 Ga0070698_100527613
496 Ga0070698_100711562
497 Ga0070698_100954508
498 Ga0070699_100162167
499 Ga0070679_100082945
500 Ga0070684_100123549
501 Ga0070697_100016587
502 Ga0070697_100430630
503 Ga0068853_100400070
504 Ga0070672_100224038
505 Ga0070672_100280434
506 Ga0070672_100430235
507 Ga0070686_100001384
508 Ga0070686_100388671
509 Ga0070686_100465885
510 Ga0070695_100029455
511 Ga0070695_100270756
512 Ga0070695_100404672
513 Ga0070696_100013581
514 Ga0070696_100076649
515 Ga0070696_100125526
516 Ga0070696_100672749
517 Ga0070696_100913671
518 Ga0070665_100004563
519 Ga0070665_100114227
520 Ga0070704_100166733
521 Ga0068855_100005452
522 Ga0070664_100181443
523 Ga0070664_100412302
524 Ga0070664_100566864
525 Ga0070664_100699230
526 Ga0068854_100019974
527 Ga0068854_100027127
528 Ga0068854_100369563
529 Ga0068856_100092486
530 Ga0070702_100006680
531 Ga0068852_100215419
532 Ga0068852_100488686
533 Ga0068852_100546413
534 Ga0068852_101247612
535 Ga0068859_100087306
536 Ga0068859_100613030
537 Ga0068864_100011321
538 Ga0068864_100236199
539 Ga0068866_10265939
540 Ga0068861_100000576
541 Ga0068861_100051881
542 Ga0068861_100113426
543 Ga0068861_100731344
544 Ga0068851_10088772
545 Ga0068863_100060757
546 Ga0068863_101309316
547 Ga0068858_100031242
548 Ga0068858_100091464
549 Ga0068858_100856106
550 Ga0068858_101384889
551 Ga0068860_100107659
552 Ga0068860_100164966
553 Ga0068862_100078722
554 Ga0068862_100140326
555 Ga0068862_100456640
556 Ga0068862_100599858
557 Ga0081455_10032141
558 Ga0081455_10105856
559 Ga0081539_10030146
560 Ga0070716_100588289
561 Ga0070712_100283220
562 Ga0097621_100002971
563 Ga0097621_100062021
564 Ga0097621_100080028
565 Ga0097621_100185372
566 Ga0068871_100002453
567 Ga0068871_100050817
568 Ga0068871_100058123
569 Ga0068871_100061791
570 Ga0068871_100131170
571 Ga0068871_100134976
572 Ga0075428_100332556
573 Ga0075431_100125794
574 Ga0075433_10033049
575 Ga0075433_10169737
576 Ga0075433_10506256
577 Ga0075433_10549056
578 Ga0075434_100914471
579 Ga0068865_100221738
580 Ga0075436_100088219
581 Ga0097620_100087303
582 Ga0097620_100613147
583 Ga0075435_100002185
584 Ga0075435_100002960
585 Ga0075435_100487466
586 Ga0099794_10336054
587 Ga0105240_10065913
588 Ga0105240_10160718
589 Ga0105240_11807861
590 Ga0111539_10005467
591 Ga0111539_10052937
592 Ga0111539_10342569
593 Ga0111539_10391327
594 Ga0111539_10519516
595 Ga0111539_10907082
596 Ga0105245_10438595
597 Ga0105245_10937619
598 Ga0105245_11203573
599 Ga0105247_10015312
600 Ga0114129_10011485
601 Ga0114129_10011838
602 Ga0114129_10527622
603 Ga0114129_11358923
604 Ga0114129_12099920
605 Ga0105243_10004797
606 Ga0105243_10013114
607 Ga0105243_11986944
608 Ga0105241_10154569
609 Ga0105242_10252140
610 Ga0105242_10422834
611 Ga0105242_11292707
612 Ga0105248_10050577
613 Ga0105248_10127759
614 Ga0105248_10176358
615 Ga0105248_10188818
616 Ga0105248_10231202
617 Ga0105248_10304518
618 Ga0105248_10474658
619 Ga0105248_10567123
620 Ga0105248_10629972
621 Ga0105237_10658742
622 Ga0105238_10331227
623 Ga0105238_10586846
624 Ga0105238_11044645
625 Ga0105238_11451030
626 Ga0105238_11693782
627 Ga0105249_10393506
628 Ga0105239_10561722
629 Ga0105246_10190594
630 Ga0157315_1006539
631 Ga0157374_10413961
632 Ga0157374_10693652
633 Ga0157378_10152219
634 Ga0157378_10454848
635 Ga0163162_10064789
636 Ga0163162_10107492
637 Ga0157375_10057577
638 Ga0157375_10210508
639 Ga0157375_10261557
640 Ga0157375_10752004
641 Ga0163163_10004080
642 Ga0163163_10123471
643 Ga0157380_10106542
644 Ga0157380_10157165
645 Ga0157380_10260218
646 Ga0157377_10367328
647 Ga0157379_10006662
648 Ga0157379_10079400
649 Ga0157379_10107242
650 Ga0157376_10004492
651 Ga0157376_10042822
652 Ga0157376_10123386
653 Ga0157376_10250587
654 Ga0157376_10716681
655 Ga0163161_10826239
656 Ga0207710_10013050
657 Ga0207680_10095535
658 Ga0207680_10220632
659 Ga0207699_10052000
660 Ga0207645_10006299
661 Ga0207645_10653166
662 Ga0207684_10131564
663 Ga0207684_10484672
664 Ga0207684_10561181
665 Ga0207684_10724963
666 Ga0207707_10098266
667 Ga0207707_10535440
668 Ga0207695_10050616
669 Ga0207693_10273070
670 Ga0207660_10665003
671 Ga0207657_10003193
672 Ga0207652_10151558
673 Ga0207652_10658559
674 Ga0207681_10049687
675 Ga0207681_10051478
676 Ga0207681_10109598
677 Ga0207681_10161106
678 Ga0207694_10509984
679 Ga0207650_10775820
680 Ga0207659_10036069
681 Ga0207659_10103057
682 Ga0207659_10677475
683 Ga0207687_10405096
684 Ga0207687_10797403
685 Ga0207644_10122353
686 Ga0207644_10517121
687 Ga0207644_10587485
688 Ga0207690_10069642
689 Ga0207706_10213819
690 Ga0207706_10420046
691 Ga0207686_10034881
692 Ga0207686_10258911
693 Ga0207686_10786625
694 Ga0207709_10019577
695 Ga0207709_10261769
696 Ga0207670_10081700
697 Ga0207669_10029334
698 Ga0207669_10060974
699 Ga0207669_10141676
700 Ga0207704_10245625
701 Ga0207665_10409354
702 Ga0207665_10560529
703 Ga0207691_10155922
704 Ga0207691_10222757
705 Ga0207711_10004819
706 Ga0207711_10011372
707 Ga0207711_10224475
708 Ga0207711_10231388
709 Ga0207711_10547882
710 Ga0207661_10111768
711 Ga0207661_10446425
712 Ga0207679_10183576
713 Ga0207679_10376996
714 Ga0207679_10471907
715 Ga0207667_10016163
716 Ga0207651_10257504
717 Ga0207651_10527353
718 Ga0207712_10249007
719 Ga0207640_10030752
720 Ga0207640_10241714
721 Ga0207658_10026307
722 Ga0207658_10461727
723 Ga0207658_10590870
724 Ga0207677_10196031
725 Ga0207677_10330487
726 Ga0207677_10545959
727 Ga0207703_10022235
728 Ga0207703_10048395
729 Ga0207703_10371800
730 Ga0207703_10632242
731 Ga0207639_10433238
732 Ga0207639_10546950
733 Ga0207639_10805313
734 Ga0207708_10002214
735 Ga0207708_10017746
736 Ga0207708_10150934
737 Ga0207708_10228694
738 Ga0207702_10215035
739 Ga0207641_10358703
740 Ga0207641_10397980
741 Ga0207641_10659997
742 Ga0207648_10008611
743 Ga0207648_10030716
744 Ga0207676_10007084
745 Ga0207676_10289831
746 Ga0207675_100003296
747 Ga0207675_100020361
748 Ga0207675_100063073
749 Ga0207675_100101748
750 Ga0207675_100155775
751 Ga0207675_101215416
752 Ga0207683_10006791
753 Ga0207683_10044163
754 Ga0207698_10303286
755 Ga0207698_10949336
756 Ga0207698_11135843
757 Ga0207698_11406153
758 Ga0207428_10010474
759 Ga0207428_10119644
760 Ga0207428_10394469
761 Ga0268266_10006622
762 Ga0268266_10021873
763 Ga0268265_10386984
764 Ga0268264_10035788
765 Ga0268264_10140546
766 Ga0307413_10479101
767 Ga0373930_0004848
768 Ga0373948_0015600
769 Ga0373950_0014895
770 Ga0373959_0006805
771 Ga0373938_0005396
772 Ga0373928_0026467
773 Ga0373929_0001553
774 Ga0373934_0111554
775 Ga0373940_0107061
776 Ga0373951_0000918
777 Ga0373932_0002302
778 Ga0373939_0001782
779 Ga0373939_0096354
780 Ga0373941_0000058
781 Ga0373941_0132988
782 Ga0373953_0091882
783 Ga0373956_0060680
784 Ga0373960_0015026
785 Ga0373943_0017686
786 Ga0373942_0001811
787 Ga0373961_0001744
788 Ga0373962_0002662
789 Ga0373931_0024258
790 Ga0373935_0728723
791 Ga0373937_0039782
792 Ga0373937_0092839
793 Ga0373937_0282073
794 Ga0395905_0992248
795 Ga0451576_0021009
796 Ga0451576_0513123
797 Ga0495629_0070773
798 Ga0495629_0146170
799 Ga0495639_0126092
800 Ga0495664_0345139
801 Ga0495628_0415908
802 Ga0495640_0192464
803 Ga0495586_0167120
804 Ga0495586_0424490
805 Ga0495645_0002346
806 Ga0495635_0232923
807 Ga0495635_0234154
808 Ga0495635_0441344
809 Ga0495658_0032127
810 Ga0495658_0193565
811 Ga0495658_0208620
812 Ga0495669_0017313
813 Ga0495674_0226068
814 Ga0495676_0639511
815 Ga0495684_0090627
816 Ga0495684_0155398
817 Ga0496101_0164715
818 Ga0496101_0327691
819 Ga0496104_0071842
820 Ga0496104_0798916
821 Ga0496106_0224879
822 Ga0496108_0007819
823 Ga0496109_0393035
824 Ga0496111_0292334
825 Ga0496111_0827330
826 Ga0496111_0958240
827 Ga0496112_0002605
828 Ga0496113_0144859
829 Ga0496113_0631711
830 Ga0496113_0869928
831 Ga0496114_0195612
832 Ga0501033_0606633
833 Ga0501034_0051446
834 Ga0501034_0344646
835 Ga0501036_0306535
836 Ga0501043_0085532
837 Ga0501047_0016450
838 Ga0501073_0221168
839 Ga0501075_0198124
840 Ga0501044_0009674
841 nmdc:mga05p37_211474_c1
842 nmdc:mga05p37_25807_c1
843 nmdc:mga05p37_320941_c1
844 nmdc:mga05p37_658432_c1
845 nmdc:mga06r32_26677_c1
846 nmdc:mga08y16_164820_c1
847 nmdc:mga08y16_297568_c1
848 nmdc:mga08y16_534138_c1
849 nmdc:mga08y16_57582_c1
850 nmdc:mga08y16_82473_c1
851 nmdc:mga0n895_17946_c1
852 nmdc:mga0n895_766846_c1
853 nmdc:mga0n895_850578_c1
854 nmdc:mga0rr50_494001_c1
855 nmdc:mga0rr50_528_c1
856 nmdc:mga0rr50_637647_c1
857 nmdc:mga0rr50_928494_c1
858 nmdc:mga08x19_76781_c1
859 nmdc:mga08x19_82863_c1
860 nmdc:mga0a205_149912_c1
861 nmdc:mga0a205_170534_c1
862 Ga0495619_0144031
863 Ga0501082_0028474
864 Ga0530510_0638321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g6f-assembly1.cif.gz_S structure of the plasmodium falciparum 20s proteasome beta-6 a117d mutant complexed with inhibitor wlw-vs 0.677 129 156
2ku2-assembly1.cif.gz_E dynamic regulation of archaeal proteasome gate opening as studied by trosy-nmr 0.6739 129 156
2ope-assembly4.cif.gz_D crystal structure of the neisseria meningitidis minor type iv pilin, pilx, in space group p43 0.6658 127 162
6kwy-assembly1.cif.gz_D human pa200-20s complex 0.6458 129 156
5l66-assembly1.cif.gz_K yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97-111; 118-133) in complex with bortezomib 0.6445 126 156
ID Description Score Start End Superfamily
af_B4F9K3_55_305_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.7104 128 154 2.120.10.80
af_O01734_137_254_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6878 95 155 2.60.40.10
af_O59770_1_250_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.6718 129 156 3.60.20.10
af_A0A1D6E9R5_23_214_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6701 95 154 2.40.160.10
6qm7G00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.6604 129 156 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A2V8A3K3-F1-model_v4 Type II secretion system protein 0.9565 4 175 GO:0016020
AF-A0A2V8A3K3-F1-model_v4 Type II secretion system protein 0.9457 4 175 GO:0016020
AF-A0A2V8J199-F1-model_v4 Type II secretion system protein 0.9296 3 175
AF-A0A2V8IMT2-F1-model_v4 Prepilin-type N-terminal cleavage/methylation domain-containing protein 0.9264 1 175 GO:0016020
AF-A0A7W1YRZ9-F1-model_v4 Type II secretion system protein 0.9255 1 175 GO:0016020

Map