F442138

General Info

Members Datasets Scaffolds Average Seq Length
430 195 860 520

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10062720|Ga0157378_100627202
Length 532
Sequence MSANPIVSQPHTASQTKIKRAILSVTDKTGLVEFARKLAGLGVELISTGGTAKLLRDSGVGVKDISELTGFPEMLDGRVKTLHPKVHGGILHRRENASHRSAVAEHGIQPIDMVVVNLYAFEKTAAKPGVPFEDLIENIDIGGPSMIRSAAKNFKDVAVVTSPSDYDAIASEMAKSGGALSSSTKWRLAQKAFATTAAYDSAIASTLERVSVNGHFEFHPESGFPQNLRLSFQKVMDLRYGENPHQKAAMYTDGSSTGVANGRQIQGKELSYNNIVDLQAAWELAQEFDQTVCAIIKHTNPSGTATGKTLAEAYKKALECDPVSAFGGVIGVNRTVDGDAAEEMAKLFLEVIAAPGFDEAARAKFAAKKNLRLVEISDAPQKWVLKNVSGGILVQDTDARALQEADLKVVTKRQPTPEEKRALLFAWKVAKHVKSNAILYARDGQTVGVGAGQMSRVDSCKIGAMKAVLPLKGTVAASDAFFPFPDGVEEIAKVGATAIIQPGGSVRDQDVIEAADRLGLAMIFTGVRHFRH

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.26
Rhizosphere 96.28
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10062720 3300013297 Bacteria 3320
2 Ga0070676_10022041 3300005328 Bacteria 3571
3 Ga0070683_100037929 3300005329 Bacteria 4414
4 Ga0070690_100102119 3300005330 Bacteria 1902
5 Ga0070670_100037437 3300005331 Bacteria 4175
6 Ga0068869_100011517 3300005334 Bacteria 5803
7 Ga0068869_100051538 3300005334 Bacteria 2986
8 Ga0068868_100001918 3300005338 Bacteria 14284
9 Ga0068868_100007623 3300005338 Bacteria 7719
10 Ga0068868_100050319 3300005338 Bacteria 3272
11 Ga0070661_100018827 3300005344 Bacteria 4915
12 Ga0070668_100116791 3300005347 Bacteria 2128
13 Ga0070669_100005666 3300005353 Bacteria 9012
14 Ga0070667_100020646 3300005367 Bacteria 5469
15 Ga0070703_10004931 3300005406 Bacteria 3724
16 Ga0070709_10030635 3300005434 Bacteria 3230
17 Ga0070709_10034119 3300005434 Bacteria 3083
18 Ga0070709_10035166 3300005434 Bacteria 3043
19 Ga0070709_10054172 3300005434 Bacteria 2528
20 Ga0070714_100000194 3300005435 Bacteria 49287
21 Ga0070714_100029276 3300005435 Bacteria 4578
22 Ga0070713_100000955 3300005436 Bacteria 18494
23 Ga0070713_100059660 3300005436 Bacteria 3187
24 Ga0070713_100066542 3300005436 Bacteria 3031
25 Ga0070713_100127252 3300005436 Bacteria 2242
26 Ga0070710_10003430 3300005437 Bacteria 7508
27 Ga0070710_10011812 3300005437 Bacteria 4326
28 Ga0070711_100000875 3300005439 Bacteria 15843
29 Ga0070711_100006585 3300005439 Bacteria 7013
30 Ga0070711_100006697 3300005439 Bacteria 6968
31 Ga0070711_100023196 3300005439 Bacteria 4032
32 Ga0070705_100008512 3300005440 Bacteria 5081
33 Ga0070694_100001479 3300005444 Bacteria 13778
34 Ga0070708_100001320 3300005445 Bacteria 19032
35 Ga0070708_100004806 3300005445 Bacteria 10656
36 Ga0070708_100005309 3300005445 Bacteria 10213
37 Ga0070708_100007455 3300005445 Bacteria 8758
38 Ga0070708_100023064 3300005445 Bacteria 5287
39 Ga0070708_100026891 3300005445 Unclassified 4930
40 Ga0070708_100038464 3300005445 Bacteria 4179
41 Ga0070708_100097088 3300005445 Bacteria 2693
42 Ga0070663_100034962 3300005455 Bacteria 3483
43 Ga0070662_100046857 3300005457 Bacteria 3107
44 Ga0070681_10001119 3300005458 Bacteria 22976
45 Ga0070681_10023327 3300005458 Bacteria 6221
46 Ga0068867_100005075 3300005459 Bacteria 9298
47 Ga0068867_100075331 3300005459 Bacteria 2531
48 Ga0070706_100000772 3300005467 Bacteria 35812
49 Ga0070706_100003398 3300005467 Bacteria 15700
50 Ga0070706_100005171 3300005467 Bacteria 12455
51 Ga0070707_100000149 3300005468 Bacteria 67234
52 Ga0070707_100006930 3300005468 Bacteria 10503
53 Ga0070707_100013129 3300005468 Bacteria 7743
54 Ga0070707_100046376 3300005468 Bacteria 4159
55 Ga0070707_100051173 3300005468 Bacteria 3960
56 Ga0070707_100107394 3300005468 Bacteria 2707
57 Ga0070698_100000247 3300005471 Bacteria 54164
58 Ga0070698_100054063 3300005471 Bacteria 4079
59 Ga0070699_100023931 3300005518 Bacteria 5265
60 Ga0070699_100027835 3300005518 Bacteria 4875
61 Ga0070699_100078716 3300005518 Bacteria 2871
62 Ga0070699_100123028 3300005518 Bacteria 2282
63 Ga0070679_100020785 3300005530 Bacteria 6403
64 Ga0070684_100019375 3300005535 Bacteria 5627
65 Ga0070684_100048899 3300005535 Bacteria 3669
66 Ga0070697_100000115 3300005536 Bacteria 62670
67 Ga0070697_100000177 3300005536 Bacteria 52281
68 Ga0070697_100001844 3300005536 Bacteria 16190
69 Ga0070697_100002100 3300005536 Bacteria 15254
70 Ga0070697_100003123 3300005536 Bacteria 12729
71 Ga0070697_100006591 3300005536 Bacteria 8999
72 Ga0070697_100014806 3300005536 Bacteria 6122
73 Ga0068853_100085010 3300005539 Bacteria 2773
74 Ga0070695_100004465 3300005545 Bacteria 8220
75 Ga0070696_100007662 3300005546 Bacteria 7216
76 Ga0070696_100035095 3300005546 Bacteria 3451
77 Ga0070693_100000195 3300005547 Bacteria 28358
78 Ga0070693_100028134 3300005547 Bacteria 3054
79 Ga0070665_100000391 3300005548 Bacteria 64820
80 Ga0070665_100019690 3300005548 Bacteria 6774
81 Ga0070704_100019495 3300005549 Bacteria 4358
82 Ga0070704_100085303 3300005549 Bacteria 2337
83 Ga0068855_100000605 3300005563 Bacteria 44009
84 Ga0068855_100014668 3300005563 Bacteria 9439
85 Ga0068855_100061632 3300005563 Bacteria 4382
86 Ga0070664_100000550 3300005564 Bacteria 28663
87 Ga0068857_100000815 3300005577 Bacteria 23344
88 Ga0068857_100010696 3300005577 Bacteria 7984
89 Ga0068854_100004910 3300005578 Bacteria 8436
90 Ga0068854_100059525 3300005578 Bacteria 2760
91 Ga0068856_100001229 3300005614 Bacteria 26872
92 Ga0068856_100003682 3300005614 Bacteria 15370
93 Ga0068856_100022163 3300005614 Bacteria 6176
94 Ga0068852_100147434 3300005616 Bacteria 2184
95 Ga0068859_100003157 3300005617 Bacteria 16757
96 Ga0068859_100013231 3300005617 Bacteria 8279
97 Ga0068859_100086462 3300005617 Bacteria 3182
98 Ga0068864_100013885 3300005618 Bacteria 6677
99 Ga0068864_100013903 3300005618 Bacteria 6672
100 Ga0068864_100021375 3300005618 Bacteria 5421
101 Ga0068863_100002412 3300005841 Bacteria 18565
102 Ga0068863_100042990 3300005841 Bacteria 4291
103 Ga0068858_100007062 3300005842 Bacteria 10901
104 Ga0068858_100045051 3300005842 Bacteria 4088
105 Ga0068860_100093823 3300005843 Bacteria 2861
106 Ga0068862_100019526 3300005844 Bacteria 5658
107 Ga0081540_1049240 3300005983 Bacteria 2103
108 Ga0070717_10000733 3300006028 Bacteria 21329
109 Ga0070717_10001546 3300006028 Bacteria 15955
110 Ga0070717_10006467 3300006028 Bacteria 8621
111 Ga0070717_10025022 3300006028 Bacteria 4742
112 Ga0070717_10169046 3300006028 Bacteria 1901
113 Ga0070716_100000237 3300006173 Bacteria 22073
114 Ga0070716_100000408 3300006173 Bacteria 17658
115 Ga0070716_100002033 3300006173 Bacteria 9248
116 Ga0070716_100002656 3300006173 Bacteria 8270
117 Ga0070716_100005815 3300006173 Bacteria 5990
118 Ga0070716_100026863 3300006173 Bacteria 3086
119 Ga0070716_100033773 3300006173 Bacteria 2800
120 Ga0070716_100044675 3300006173 Bacteria 2483
121 Ga0070712_100000416 3300006175 Bacteria 24364
122 Ga0070712_100010397 3300006175 Bacteria 5871
123 Ga0070712_100011939 3300006175 Bacteria 5520
124 Ga0097621_100000204 3300006237 Bacteria 38704
125 Ga0097621_100000727 3300006237 Bacteria 23037
126 Ga0097621_100004301 3300006237 Bacteria 9893
127 Ga0097621_100007901 3300006237 Bacteria 7629
128 Ga0097621_100022134 3300006237 Bacteria 4930
129 Ga0068871_100000535 3300006358 Bacteria 25899
130 Ga0068871_100002381 3300006358 Bacteria 12820
131 Ga0068871_100008718 3300006358 Bacteria 7294
132 Ga0075433_10004740 3300006852 Bacteria 10611
133 Ga0075433_10113743 3300006852 Bacteria 2401
134 Ga0075434_100000074 3300006871 Bacteria 52984
135 Ga0075434_100001057 3300006871 Bacteria 22474
136 Ga0075434_100004172 3300006871 Bacteria 12949
137 Ga0075434_100008887 3300006871 Bacteria 9352
138 Ga0075434_100035521 3300006871 Bacteria 4928
139 Ga0075434_100103983 3300006871 Bacteria 2849
140 Ga0068865_100005909 3300006881 Bacteria 7447
141 Ga0068865_100059007 3300006881 Bacteria 2682
142 Ga0068865_100089268 3300006881 Bacteria 2232
143 Ga0075436_100001249 3300006914 Bacteria 17271
144 Ga0075436_100001830 3300006914 Bacteria 14578
145 Ga0075436_100049758 3300006914 Bacteria 2892
146 Ga0097620_100003157 3300006931 Bacteria 16757
147 Ga0097620_100013231 3300006931 Bacteria 8279
148 Ga0097620_100086461 3300006931 Bacteria 3182
149 Ga0075435_100000025 3300007076 Bacteria 87314
150 Ga0075435_100013915 3300007076 Bacteria 6001
151 Ga0099794_10003922 3300007265 Bacteria 5765
152 Ga0099794_10008689 3300007265 Bacteria 4231
153 Ga0099794_10010609 3300007265 Bacteria 3918
154 Ga0105240_10020175 3300009093 Bacteria 8897
155 Ga0105240_10116300 3300009093 Bacteria 3227
156 Ga0105240_10147597 3300009093 Bacteria 2804
157 Ga0105245_10000406 3300009098 Bacteria 39988
158 Ga0105245_10199868 3300009098 Bacteria 1919
159 Ga0105245_10251594 3300009098 Bacteria 1717
160 Ga0114129_10019704 3300009147 Bacteria 9602
161 Ga0105243_10041239 3300009148 Bacteria 3610
162 Ga0105241_10023519 3300009174 Bacteria 4570
163 Ga0105241_10078133 3300009174 Bacteria 2586
164 Ga0105248_10005406 3300009177 Bacteria 14042
165 Ga0105248_10253522 3300009177 Bacteria 1980
166 Ga0105248_10257649 3300009177 Bacteria 1964
167 Ga0105237_10016480 3300009545 Bacteria 7677
168 Ga0105237_10049520 3300009545 Bacteria 4222
169 Ga0105237_10071423 3300009545 Bacteria 3466
170 Ga0105238_10001026 3300009551 Bacteria 28422
171 Ga0105238_10151365 3300009551 Bacteria 2295
172 Ga0105249_10184755 3300009553 Bacteria 2031
173 Ga0105239_10009910 3300010375 Bacteria 10701
174 Ga0105239_10253149 3300010375 Bacteria 1978
175 Ga0157371_10021000 3300013102 Bacteria 4801
176 Ga0157369_10000353 3300013105 Bacteria 61209
177 Ga0157369_10001316 3300013105 Bacteria 30861
178 Ga0157369_10043484 3300013105 Bacteria 4896
179 Ga0157369_10060673 3300013105 Bacteria 4078
180 Ga0157369_10112739 3300013105 Bacteria 2889
181 Ga0157374_10000232 3300013296 Bacteria 51675
182 Ga0157374_10000999 3300013296 Bacteria 24519
183 Ga0157374_10001564 3300013296 Bacteria 19260
184 Ga0157374_10001843 3300013296 Bacteria 17843
185 Ga0157374_10001924 3300013296 Bacteria 17416
186 Ga0157378_10000493 3300013297 Bacteria 37407
187 Ga0157378_10000683 3300013297 Bacteria 31888
188 Ga0157378_10003757 3300013297 Bacteria 13459
189 Ga0157378_10009305 3300013297 Bacteria 8557
190 Ga0157378_10015824 3300013297 Bacteria 6605
191 Ga0157378_10039721 3300013297 Bacteria 4174
192 Ga0157378_10104274 3300013297 Bacteria 2592
193 Ga0157378_10221653 3300013297 Bacteria 1798
194 Ga0163162_10023184 3300013306 Bacteria 6124
195 Ga0163162_10036574 3300013306 Bacteria 4895
196 Ga0163162_10052238 3300013306 Bacteria 4104
197 Ga0157372_10002189 3300013307 Bacteria 21255
198 Ga0157372_10004062 3300013307 Bacteria 15689
199 Ga0157372_10004282 3300013307 Bacteria 15259
200 Ga0157372_10020345 3300013307 Bacteria 7159
201 Ga0157372_10032964 3300013307 Bacteria 5686
202 Ga0157372_10169591 3300013307 Bacteria 2525
203 Ga0157372_10267267 3300013307 Bacteria 1986
204 Ga0163163_10042846 3300014325 Bacteria 4435
205 Ga0157379_10013669 3300014968 Bacteria 7114
206 Ga0157379_10027356 3300014968 Bacteria 5078
207 Ga0157379_10042002 3300014968 Bacteria 4081
208 Ga0157379_10114297 3300014968 Bacteria 2426
209 Ga0157376_10000017 3300014969 Bacteria 268501
210 Ga0157376_10002059 3300014969 Bacteria 13496
211 Ga0157376_10003054 3300014969 Bacteria 11467
212 Ga0228598_1000553 3300024227 Bacteria 7809
213 Ga0207653_10001453 3300025885 Bacteria 7689
214 Ga0207692_10001990 3300025898 Bacteria 7802
215 Ga0207692_10047903 3300025898 Bacteria 2149
216 Ga0207680_10077640 3300025903 Bacteria 2078
217 Ga0207647_10006350 3300025904 Bacteria 8594
218 Ga0207685_10000314 3300025905 Bacteria 7760
219 Ga0207699_10004208 3300025906 Bacteria 6885
220 Ga0207699_10008743 3300025906 Bacteria 5011
221 Ga0207699_10021736 3300025906 Bacteria 3465
222 Ga0207699_10026156 3300025906 Bacteria 3213
223 Ga0207699_10045603 3300025906 Bacteria 2560
224 Ga0207645_10029069 3300025907 Bacteria 3564
225 Ga0207684_10000762 3300025910 Bacteria 37545
226 Ga0207684_10003384 3300025910 Bacteria 15622
227 Ga0207684_10036097 3300025910 Bacteria 4196
228 Ga0207707_10001501 3300025912 Bacteria 21531
229 Ga0207707_10003208 3300025912 Bacteria 14521
230 Ga0207707_10081206 3300025912 Bacteria 2830
231 Ga0207695_10004027 3300025913 Bacteria 20231
232 Ga0207695_10007875 3300025913 Bacteria 13451
233 Ga0207695_10061585 3300025913 Bacteria 3877
234 Ga0207695_10070453 3300025913 Bacteria 3574
235 Ga0207671_10036006 3300025914 Bacteria 3670
236 Ga0207693_10000038 3300025915 Bacteria 109225
237 Ga0207693_10000229 3300025915 Bacteria 51411
238 Ga0207693_10002077 3300025915 Bacteria 17504
239 Ga0207693_10003683 3300025915 Bacteria 13078
240 Ga0207693_10008533 3300025915 Bacteria 8386
241 Ga0207693_10009850 3300025915 Bacteria 7773
242 Ga0207693_10023890 3300025915 Bacteria 4852
243 Ga0207693_10056259 3300025915 Bacteria 3084
244 Ga0207693_10060792 3300025915 Bacteria 2959
245 Ga0207693_10064785 3300025915 Bacteria 2862
246 Ga0207663_10002024 3300025916 Bacteria 9637
247 Ga0207663_10007571 3300025916 Bacteria 5636
248 Ga0207663_10016862 3300025916 Bacteria 4062
249 Ga0207663_10073266 3300025916 Bacteria 2216
250 Ga0207657_10001787 3300025919 Bacteria 23204
251 Ga0207649_10019704 3300025920 Bacteria 3860
252 Ga0207649_10082116 3300025920 Bacteria 2089
253 Ga0207646_10000227 3300025922 Bacteria 77131
254 Ga0207646_10000334 3300025922 Bacteria 63767
255 Ga0207646_10005323 3300025922 Bacteria 13566
256 Ga0207646_10011417 3300025922 Bacteria 8612
257 Ga0207646_10035414 3300025922 Bacteria 4509
258 Ga0207646_10042541 3300025922 Bacteria 4081
259 Ga0207694_10005438 3300025924 Bacteria 9798
260 Ga0207650_10025599 3300025925 Bacteria 4204
261 Ga0207687_10002554 3300025927 Bacteria 12364
262 Ga0207687_10013880 3300025927 Bacteria 5263
263 Ga0207687_10022236 3300025927 Bacteria 4218
264 Ga0207687_10119735 3300025927 Bacteria 1967
265 Ga0207700_10081461 3300025928 Bacteria 2527
266 Ga0207700_10132988 3300025928 Bacteria 2034
267 Ga0207664_10000234 3300025929 Bacteria 41968
268 Ga0207664_10008202 3300025929 Bacteria 7272
269 Ga0207690_10107605 3300025932 Bacteria 2003
270 Ga0207706_10000331 3300025933 Bacteria 51309
271 Ga0207704_10010635 3300025938 Bacteria 4496
272 Ga0207665_10000044 3300025939 Bacteria 82505
273 Ga0207665_10001358 3300025939 Bacteria 16495
274 Ga0207665_10002022 3300025939 Bacteria 13646
275 Ga0207665_10004869 3300025939 Bacteria 8942
276 Ga0207665_10009264 3300025939 Bacteria 6465
277 Ga0207665_10041287 3300025939 Bacteria 3080
278 Ga0207711_10000693 3300025941 Bacteria 33226
279 Ga0207711_10024198 3300025941 Bacteria 5084
280 Ga0207689_10003681 3300025942 Bacteria 13973
281 Ga0207689_10031843 3300025942 Bacteria 4386
282 Ga0207661_10116201 3300025944 Bacteria 2271
283 Ga0207679_10177921 3300025945 Bacteria 1757
284 Ga0207667_10000319 3300025949 Bacteria 66938
285 Ga0207667_10013797 3300025949 Bacteria 9231
286 Ga0207667_10015609 3300025949 Bacteria 8615
287 Ga0207667_10030402 3300025949 Bacteria 5844
288 Ga0207668_10002420 3300025972 Bacteria 10916
289 Ga0207640_10127020 3300025981 Bacteria 1837
290 Ga0207658_10035811 3300025986 Bacteria 3556
291 Ga0207677_10002617 3300026023 Bacteria 9471
292 Ga0207677_10025165 3300026023 Bacteria 3709
293 Ga0207677_10050010 3300026023 Bacteria 2825
294 Ga0207677_10056033 3300026023 Bacteria 2698
295 Ga0207703_10008713 3300026035 Bacteria 8007
296 Ga0207703_10026576 3300026035 Bacteria 4557
297 Ga0207703_10039925 3300026035 Bacteria 3753
298 Ga0207639_10047638 3300026041 Bacteria 3241
299 Ga0207639_10088177 3300026041 Bacteria 2475
300 Ga0207678_10003640 3300026067 Bacteria 13854
301 Ga0207702_10000595 3300026078 Bacteria 40019
302 Ga0207702_10009536 3300026078 Bacteria 8149
303 Ga0207702_10022734 3300026078 Bacteria 5201
304 Ga0207641_10003924 3300026088 Bacteria 13006
305 Ga0207641_10011766 3300026088 Bacteria 7185
306 Ga0207648_10015902 3300026089 Bacteria 6897
307 Ga0207648_10033079 3300026089 Bacteria 4561
308 Ga0207676_10055839 3300026095 Bacteria 3102
309 Ga0207676_10066684 3300026095 Bacteria 2872
310 Ga0207676_10214962 3300026095 Bacteria 1708
311 Ga0207674_10002377 3300026116 Bacteria 23787
312 Ga0207674_10033641 3300026116 Bacteria 5365
313 Ga0268266_10002490 3300028379 Bacteria 19662
314 Ga0268266_10162757 3300028379 Bacteria 2020
315 Ga0268264_10067214 3300028381 Bacteria 3025
316 Ga0268264_10217622 3300028381 Bacteria 1757
317 Ga0265338_10005348 3300028800 Bacteria 16789
318 Ga0265338_10094514 3300028800 Bacteria 2459
319 Ga0265338_10156972 3300028800 Bacteria 1761
320 Ga0265760_10002664 3300031090 Bacteria 5223
321 Ga0265325_10006672 3300031241 Bacteria 6984
322 Ga0307408_100015560 3300031548 Bacteria 5066
323 Ga0265314_10030273 3300031711 Bacteria 4008
324 Ga0307410_10000404 3300031852 Bacteria 17071
325 Ga0307410_10019777 3300031852 Bacteria 4104
326 Ga0307409_100029542 3300031995 Bacteria 3924
327 Ga0307416_100007430 3300032002 Bacteria 6970
328 Ga0307411_10003673 3300032005 Bacteria 7182
329 Ga0307411_10028436 3300032005 Bacteria 3399
330 Ga0307415_100002187 3300032126 Bacteria 9690
331 Ga0373926_0004854 3300035083 Bacteria 4422
332 Ga0373934_0001479 3300035086 Bacteria 8617
333 Ga0373934_0038447 3300035086 Bacteria 1885
334 Ga0373923_0023532 3300035111 Bacteria 2424
335 Ga0373945_0019465 3300035116 Bacteria 2318
336 Ga0373954_0000525 3300035118 Bacteria 14371
337 Ga0373956_0008172 3300035119 Bacteria 4234
338 Ga0373943_0000469 3300035170 Bacteria 17149
339 Ga0373955_0000488 3300035172 Bacteria 16767
340 Ga0373955_0041792 3300035172 Bacteria 2459
341 Ga0373955_0087601 3300035172 Bacteria 1770
342 Ga0373931_0037645 3300035691 Bacteria 2526
343 Ga0373931_0042039 3300035691 Bacteria 2402
344 Ga0373931_0080967 3300035691 Bacteria 1792
345 Ga0373935_0000343 3300035692 Bacteria 23600
346 Ga0373935_0020257 3300035692 Bacteria 4062
347 Ga0373927_0000129 3300035695 Bacteria 57926
348 Ga0373927_0004057 3300035695 Bacteria 10345
349 Ga0373933_0000625 3300035724 Bacteria 22074
350 Ga0373933_0013314 3300035724 Bacteria 4558
351 Ga0373947_0000598 3300035725 Bacteria 21263
352 Ga0373947_0004819 3300035725 Bacteria 7895
353 Ga0373937_0139947 3300036401 Bacteria 2264
354 Ga0373925_0003421 3300037068 Bacteria 12286
355 Ga0373925_0004581 3300037068 Bacteria 10446
356 Ga0436364_1493091 3300037853 Bacteria 2638
357 Ga0436363_0103576 3300039450 Bacteria 4565
358 Ga0451577_0008350 3300042876 Bacteria 10079
359 Ga0466963_0011322 3300044694 Bacteria 5428
360 Ga0451576_0039630 3300045051 Bacteria 4986
361 Ga0466967_0055297 3300045976 Bacteria 3496
362 Ga0495629_0060022 3300046459 Bacteria 2658
363 Ga0495580_0001045 3300046472 Bacteria 24324
364 Ga0495580_0001227 3300046472 Bacteria 22632
365 Ga0495580_0001728 3300046472 Bacteria 19205
366 Ga0495580_0002014 3300046472 Bacteria 17889
367 Ga0495580_0002840 3300046472 Bacteria 14898
368 Ga0495580_0003770 3300046472 Bacteria 12832
369 Ga0495580_0003980 3300046472 Bacteria 12473
370 Ga0495580_0015268 3300046472 Bacteria 5801
371 Ga0495580_0018270 3300046472 Bacteria 5223
372 Ga0495580_0032168 3300046472 Bacteria 3787
373 Ga0495582_0000610 3300046473 Bacteria 19722
374 Ga0495639_0019662 3300046475 Bacteria 2947
375 Ga0495594_0034468 3300046499 Bacteria 2753
376 Ga0495630_0134371 3300046517 Bacteria 1879
377 Ga0495666_0006388 3300046526 Bacteria 5937
378 Ga0495665_0000457 3300046531 Bacteria 20486
379 Ga0495665_0004212 3300046531 Bacteria 7766
380 Ga0495586_0001913 3300046535 Bacteria 11339
381 Ga0495587_0001382 3300046536 Bacteria 16140
382 Ga0495634_0060275 3300046642 Bacteria 2525
383 Ga0495635_0074154 3300046663 Bacteria 2331
384 Ga0495623_0005017 3300046679 Bacteria 8680
385 Ga0495658_0008216 3300046683 Bacteria 5169
386 Ga0495624_0042598 3300046690 Bacteria 2901
387 Ga0495581_0018419 3300047315 Bacteria 4056
388 Ga0495581_0043458 3300047315 Bacteria 2599
389 Ga0495604_0101007 3300047317 Bacteria 2119
390 Ga0495604_0137141 3300047317 Bacteria 1752
391 Ga0495674_0022375 3300047319 Bacteria 5830
392 Ga0495674_0028945 3300047319 Bacteria 5046
393 Ga0495674_0095344 3300047319 Bacteria 2537
394 Ga0495676_0024541 3300047321 Bacteria 5217
395 Ga0495680_0048051 3300047322 Bacteria 3353
396 Ga0495684_0008478 3300047471 Bacteria 7959
397 Ga0495684_0091034 3300047471 Bacteria 2310
398 Ga0495593_0044628 3300047673 Bacteria 2370
399 Ga0495602_0046154 3300048088 Bacteria 3938
400 Ga0495614_0050160 3300048089 Bacteria 1788
401 Ga0496100_0123013 3300048903 Bacteria 1818
402 Ga0496102_0001461 3300048905 Bacteria 20885
403 Ga0496102_0002987 3300048905 Bacteria 14318
404 Ga0496103_0009447 3300048906 Bacteria 5774
405 Ga0496104_0128802 3300048907 Bacteria 2431
406 Ga0496104_0149663 3300048907 Bacteria 2241
407 Ga0496104_0174434 3300048907 Bacteria 2060
408 Ga0496107_0090104 3300048910 Bacteria 2240
409 Ga0496112_0000875 3300048915 Bacteria 21599
410 Ga0496112_0009370 3300048915 Bacteria 8817
411 Ga0496112_0028733 3300048915 Bacteria 5371
412 Ga0496112_0090376 3300048915 Bacteria 3031
413 Ga0496114_0001136 3300048917 Bacteria 20130
414 Ga0496115_0001411 3300048918 Bacteria 17189
415 Ga0501298_004488 3300049521 Bacteria 2202
416 nmdc:mga05p37_84865_c1 3300050507 Bacteria 3901
417 nmdc:mga0n895_2355_c1 3300050512 Bacteria 14729
418 nmdc:mga0n895_3265_c1 3300050512 Bacteria 13005
419 nmdc:mga0n895_33353_c1 3300050512 Bacteria 4948
420 nmdc:mga0n895_36388_c1 3300050512 Bacteria 4753
421 nmdc:mga0n895_98626_c1 3300050512 Bacteria 2929
422 nmdc:mga0rr50_303_c1 3300050513 Bacteria 26745
423 nmdc:mga0rr50_5296_c1 3300050513 Bacteria 7671
424 nmdc:mga08x19_12166_c1 3300050514 Bacteria 4748
425 nmdc:mga08x19_1312_c1 3300050514 Bacteria 15434
426 nmdc:mga08x19_278_c1 3300050514 Bacteria 38752
427 nmdc:mga08x19_7398_c1 3300050514 Bacteria 6520
428 nmdc:mga0a205_1137_c1 3300050515 Bacteria 22087
429 nmdc:mga0a205_9818_c2 3300050515 Bacteria 2428
430 Ga0495619_0035196 3300053085 Bacteria 3257
431 Ga0157378_10062720
432 Ga0070676_10022041
433 Ga0070683_100037929
434 Ga0070690_100102119
435 Ga0070670_100037437
436 Ga0068869_100011517
437 Ga0068869_100051538
438 Ga0068868_100001918
439 Ga0068868_100007623
440 Ga0068868_100050319
441 Ga0070661_100018827
442 Ga0070668_100116791
443 Ga0070669_100005666
444 Ga0070667_100020646
445 Ga0070703_10004931
446 Ga0070709_10030635
447 Ga0070709_10034119
448 Ga0070709_10035166
449 Ga0070709_10054172
450 Ga0070714_100000194
451 Ga0070714_100029276
452 Ga0070713_100000955
453 Ga0070713_100059660
454 Ga0070713_100066542
455 Ga0070713_100127252
456 Ga0070710_10003430
457 Ga0070710_10011812
458 Ga0070711_100000875
459 Ga0070711_100006585
460 Ga0070711_100006697
461 Ga0070711_100023196
462 Ga0070705_100008512
463 Ga0070694_100001479
464 Ga0070708_100001320
465 Ga0070708_100004806
466 Ga0070708_100005309
467 Ga0070708_100007455
468 Ga0070708_100023064
469 Ga0070708_100026891
470 Ga0070708_100038464
471 Ga0070708_100097088
472 Ga0070663_100034962
473 Ga0070662_100046857
474 Ga0070681_10001119
475 Ga0070681_10023327
476 Ga0068867_100005075
477 Ga0068867_100075331
478 Ga0070706_100000772
479 Ga0070706_100003398
480 Ga0070706_100005171
481 Ga0070707_100000149
482 Ga0070707_100006930
483 Ga0070707_100013129
484 Ga0070707_100046376
485 Ga0070707_100051173
486 Ga0070707_100107394
487 Ga0070698_100000247
488 Ga0070698_100054063
489 Ga0070699_100023931
490 Ga0070699_100027835
491 Ga0070699_100078716
492 Ga0070699_100123028
493 Ga0070679_100020785
494 Ga0070684_100019375
495 Ga0070684_100048899
496 Ga0070697_100000115
497 Ga0070697_100000177
498 Ga0070697_100001844
499 Ga0070697_100002100
500 Ga0070697_100003123
501 Ga0070697_100006591
502 Ga0070697_100014806
503 Ga0068853_100085010
504 Ga0070695_100004465
505 Ga0070696_100007662
506 Ga0070696_100035095
507 Ga0070693_100000195
508 Ga0070693_100028134
509 Ga0070665_100000391
510 Ga0070665_100019690
511 Ga0070704_100019495
512 Ga0070704_100085303
513 Ga0068855_100000605
514 Ga0068855_100014668
515 Ga0068855_100061632
516 Ga0070664_100000550
517 Ga0068857_100000815
518 Ga0068857_100010696
519 Ga0068854_100004910
520 Ga0068854_100059525
521 Ga0068856_100001229
522 Ga0068856_100003682
523 Ga0068856_100022163
524 Ga0068852_100147434
525 Ga0068859_100003157
526 Ga0068859_100013231
527 Ga0068859_100086462
528 Ga0068864_100013885
529 Ga0068864_100013903
530 Ga0068864_100021375
531 Ga0068863_100002412
532 Ga0068863_100042990
533 Ga0068858_100007062
534 Ga0068858_100045051
535 Ga0068860_100093823
536 Ga0068862_100019526
537 Ga0081540_1049240
538 Ga0070717_10000733
539 Ga0070717_10001546
540 Ga0070717_10006467
541 Ga0070717_10025022
542 Ga0070717_10169046
543 Ga0070716_100000237
544 Ga0070716_100000408
545 Ga0070716_100002033
546 Ga0070716_100002656
547 Ga0070716_100005815
548 Ga0070716_100026863
549 Ga0070716_100033773
550 Ga0070716_100044675
551 Ga0070712_100000416
552 Ga0070712_100010397
553 Ga0070712_100011939
554 Ga0097621_100000204
555 Ga0097621_100000727
556 Ga0097621_100004301
557 Ga0097621_100007901
558 Ga0097621_100022134
559 Ga0068871_100000535
560 Ga0068871_100002381
561 Ga0068871_100008718
562 Ga0075433_10004740
563 Ga0075433_10113743
564 Ga0075434_100000074
565 Ga0075434_100001057
566 Ga0075434_100004172
567 Ga0075434_100008887
568 Ga0075434_100035521
569 Ga0075434_100103983
570 Ga0068865_100005909
571 Ga0068865_100059007
572 Ga0068865_100089268
573 Ga0075436_100001249
574 Ga0075436_100001830
575 Ga0075436_100049758
576 Ga0097620_100003157
577 Ga0097620_100013231
578 Ga0097620_100086461
579 Ga0075435_100000025
580 Ga0075435_100013915
581 Ga0099794_10003922
582 Ga0099794_10008689
583 Ga0099794_10010609
584 Ga0105240_10020175
585 Ga0105240_10116300
586 Ga0105240_10147597
587 Ga0105245_10000406
588 Ga0105245_10199868
589 Ga0105245_10251594
590 Ga0114129_10019704
591 Ga0105243_10041239
592 Ga0105241_10023519
593 Ga0105241_10078133
594 Ga0105248_10005406
595 Ga0105248_10253522
596 Ga0105248_10257649
597 Ga0105237_10016480
598 Ga0105237_10049520
599 Ga0105237_10071423
600 Ga0105238_10001026
601 Ga0105238_10151365
602 Ga0105249_10184755
603 Ga0105239_10009910
604 Ga0105239_10253149
605 Ga0157371_10021000
606 Ga0157369_10000353
607 Ga0157369_10001316
608 Ga0157369_10043484
609 Ga0157369_10060673
610 Ga0157369_10112739
611 Ga0157374_10000232
612 Ga0157374_10000999
613 Ga0157374_10001564
614 Ga0157374_10001843
615 Ga0157374_10001924
616 Ga0157378_10000493
617 Ga0157378_10000683
618 Ga0157378_10003757
619 Ga0157378_10009305
620 Ga0157378_10015824
621 Ga0157378_10039721
622 Ga0157378_10104274
623 Ga0157378_10221653
624 Ga0163162_10023184
625 Ga0163162_10036574
626 Ga0163162_10052238
627 Ga0157372_10002189
628 Ga0157372_10004062
629 Ga0157372_10004282
630 Ga0157372_10020345
631 Ga0157372_10032964
632 Ga0157372_10169591
633 Ga0157372_10267267
634 Ga0163163_10042846
635 Ga0157379_10013669
636 Ga0157379_10027356
637 Ga0157379_10042002
638 Ga0157379_10114297
639 Ga0157376_10000017
640 Ga0157376_10002059
641 Ga0157376_10003054
642 Ga0228598_1000553
643 Ga0207653_10001453
644 Ga0207692_10001990
645 Ga0207692_10047903
646 Ga0207680_10077640
647 Ga0207647_10006350
648 Ga0207685_10000314
649 Ga0207699_10004208
650 Ga0207699_10008743
651 Ga0207699_10021736
652 Ga0207699_10026156
653 Ga0207699_10045603
654 Ga0207645_10029069
655 Ga0207684_10000762
656 Ga0207684_10003384
657 Ga0207684_10036097
658 Ga0207707_10001501
659 Ga0207707_10003208
660 Ga0207707_10081206
661 Ga0207695_10004027
662 Ga0207695_10007875
663 Ga0207695_10061585
664 Ga0207695_10070453
665 Ga0207671_10036006
666 Ga0207693_10000038
667 Ga0207693_10000229
668 Ga0207693_10002077
669 Ga0207693_10003683
670 Ga0207693_10008533
671 Ga0207693_10009850
672 Ga0207693_10023890
673 Ga0207693_10056259
674 Ga0207693_10060792
675 Ga0207693_10064785
676 Ga0207663_10002024
677 Ga0207663_10007571
678 Ga0207663_10016862
679 Ga0207663_10073266
680 Ga0207657_10001787
681 Ga0207649_10019704
682 Ga0207649_10082116
683 Ga0207646_10000227
684 Ga0207646_10000334
685 Ga0207646_10005323
686 Ga0207646_10011417
687 Ga0207646_10035414
688 Ga0207646_10042541
689 Ga0207694_10005438
690 Ga0207650_10025599
691 Ga0207687_10002554
692 Ga0207687_10013880
693 Ga0207687_10022236
694 Ga0207687_10119735
695 Ga0207700_10081461
696 Ga0207700_10132988
697 Ga0207664_10000234
698 Ga0207664_10008202
699 Ga0207690_10107605
700 Ga0207706_10000331
701 Ga0207704_10010635
702 Ga0207665_10000044
703 Ga0207665_10001358
704 Ga0207665_10002022
705 Ga0207665_10004869
706 Ga0207665_10009264
707 Ga0207665_10041287
708 Ga0207711_10000693
709 Ga0207711_10024198
710 Ga0207689_10003681
711 Ga0207689_10031843
712 Ga0207661_10116201
713 Ga0207679_10177921
714 Ga0207667_10000319
715 Ga0207667_10013797
716 Ga0207667_10015609
717 Ga0207667_10030402
718 Ga0207668_10002420
719 Ga0207640_10127020
720 Ga0207658_10035811
721 Ga0207677_10002617
722 Ga0207677_10025165
723 Ga0207677_10050010
724 Ga0207677_10056033
725 Ga0207703_10008713
726 Ga0207703_10026576
727 Ga0207703_10039925
728 Ga0207639_10047638
729 Ga0207639_10088177
730 Ga0207678_10003640
731 Ga0207702_10000595
732 Ga0207702_10009536
733 Ga0207702_10022734
734 Ga0207641_10003924
735 Ga0207641_10011766
736 Ga0207648_10015902
737 Ga0207648_10033079
738 Ga0207676_10055839
739 Ga0207676_10066684
740 Ga0207676_10214962
741 Ga0207674_10002377
742 Ga0207674_10033641
743 Ga0268266_10002490
744 Ga0268266_10162757
745 Ga0268264_10067214
746 Ga0268264_10217622
747 Ga0265338_10005348
748 Ga0265338_10094514
749 Ga0265338_10156972
750 Ga0265760_10002664
751 Ga0265325_10006672
752 Ga0307408_100015560
753 Ga0265314_10030273
754 Ga0307410_10000404
755 Ga0307410_10019777
756 Ga0307409_100029542
757 Ga0307416_100007430
758 Ga0307411_10003673
759 Ga0307411_10028436
760 Ga0307415_100002187
761 Ga0373926_0004854
762 Ga0373934_0001479
763 Ga0373934_0038447
764 Ga0373923_0023532
765 Ga0373945_0019465
766 Ga0373954_0000525
767 Ga0373956_0008172
768 Ga0373943_0000469
769 Ga0373955_0000488
770 Ga0373955_0041792
771 Ga0373955_0087601
772 Ga0373931_0037645
773 Ga0373931_0042039
774 Ga0373931_0080967
775 Ga0373935_0000343
776 Ga0373935_0020257
777 Ga0373927_0000129
778 Ga0373927_0004057
779 Ga0373933_0000625
780 Ga0373933_0013314
781 Ga0373947_0000598
782 Ga0373947_0004819
783 Ga0373937_0139947
784 Ga0373925_0003421
785 Ga0373925_0004581
786 Ga0436364_1493091
787 Ga0436363_0103576
788 Ga0451577_0008350
789 Ga0466963_0011322
790 Ga0451576_0039630
791 Ga0466967_0055297
792 Ga0495629_0060022
793 Ga0495580_0001045
794 Ga0495580_0001227
795 Ga0495580_0001728
796 Ga0495580_0002014
797 Ga0495580_0002840
798 Ga0495580_0003770
799 Ga0495580_0003980
800 Ga0495580_0015268
801 Ga0495580_0018270
802 Ga0495580_0032168
803 Ga0495582_0000610
804 Ga0495639_0019662
805 Ga0495594_0034468
806 Ga0495630_0134371
807 Ga0495666_0006388
808 Ga0495665_0000457
809 Ga0495665_0004212
810 Ga0495586_0001913
811 Ga0495587_0001382
812 Ga0495634_0060275
813 Ga0495635_0074154
814 Ga0495623_0005017
815 Ga0495658_0008216
816 Ga0495624_0042598
817 Ga0495581_0018419
818 Ga0495581_0043458
819 Ga0495604_0101007
820 Ga0495604_0137141
821 Ga0495674_0022375
822 Ga0495674_0028945
823 Ga0495674_0095344
824 Ga0495676_0024541
825 Ga0495680_0048051
826 Ga0495684_0008478
827 Ga0495684_0091034
828 Ga0495593_0044628
829 Ga0495602_0046154
830 Ga0495614_0050160
831 Ga0496100_0123013
832 Ga0496102_0001461
833 Ga0496102_0002987
834 Ga0496103_0009447
835 Ga0496104_0128802
836 Ga0496104_0149663
837 Ga0496104_0174434
838 Ga0496107_0090104
839 Ga0496112_0000875
840 Ga0496112_0009370
841 Ga0496112_0028733
842 Ga0496112_0090376
843 Ga0496114_0001136
844 Ga0496115_0001411
845 Ga0501298_004488
846 nmdc:mga05p37_84865_c1
847 nmdc:mga0n895_2355_c1
848 nmdc:mga0n895_3265_c1
849 nmdc:mga0n895_33353_c1
850 nmdc:mga0n895_36388_c1
851 nmdc:mga0n895_98626_c1
852 nmdc:mga0rr50_303_c1
853 nmdc:mga0rr50_5296_c1
854 nmdc:mga08x19_12166_c1
855 nmdc:mga08x19_1312_c1
856 nmdc:mga08x19_278_c1
857 nmdc:mga08x19_7398_c1
858 nmdc:mga0a205_1137_c1
859 nmdc:mga0a205_9818_c2
860 Ga0495619_0035196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02142

MGS

MGS-like domain

30

145

0.98

PF01808

AICARFT_IMPCHas

AICARFT/IMPCHase bienzyme

150

466

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zzm-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis purh with a novel bound nucleotide cfair, at 2.2 a resolution. 0.9285 2 522
3zzm-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis purh with a novel bound nucleotide cfair, at 2.2 a resolution. 0.9267 2 522
4a1o-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis purh complexed with aicar and a novel nucleotide cfair, at 2.48 a resolution. 0.9248 5 522
4a1o-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis purh complexed with aicar and a novel nucleotide cfair, at 2.48 a resolution. 0.9196 5 522
6nko-assembly5.cif.gz_D crystal structure of forh 0.9126 8 194
ID Description Score Start End Superfamily
4a1oB02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain 0.9763 252 370 3.40.140.20
4a1oA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.9633 5 198 3.40.50.1380
af_Q86L14_1_198_3.40.50.1380 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.9626 9 200 3.40.50.1380
af_O35567_1_197_3.40.50.1380 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.962 4 195 3.40.50.1380
af_P15639_394_529_3.40.140.20 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain 0.9614 390 522 3.40.140.20
ID Description Score Start End GO Terms
AF-A0A2V9SSR3-F1-model_v4 Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosine monophosphate cyclohydrolase (EC 2.1.2.3, EC 3.5.4.10) 0.9902 6 226 GO:0003937
GO:0004643
GO:0005829
GO:0006189
AF-A0A357N7R3-F1-model_v4 IMP cyclohydrolase 0.9883 8 108 GO:0003937
GO:0004643
GO:0005829
GO:0006189
AF-A0A530GWN9-F1-model_v4 Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase (EC 2.1.2.3, EC 3.5.4.10) 0.9872 8 110 GO:0003937
GO:0004643
GO:0005829
GO:0006189
AF-X1EXH9-F1-model_v4 MGS-like domain-containing protein 0.9869 9 107 GO:0003937
GO:0004643
GO:0005829
GO:0006189
AF-G4Q7G0-F1-model_v4 Bifunctional purine biosynthesis protein 0.9867 6 195 GO:0003937
GO:0004643
GO:0005829
GO:0006189

Map