F442097

General Info

Members Datasets Scaffolds Average Seq Length
430 234 860 132

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10940408|Ga0068870_109404081
Length 146
Sequence MAGSWSACHADPVDRTQAQDWLDRYVAAWLTYEPDLIGDLFSEDVAYRYHPYDEPVLGREAVVASWLGDDTPGASTRDPLGTYDASYAPVAVDGDAVVATGTSSYRDVPDGPVVRVFHNCFVMRFDADGRCREFTEFYVQAPRQSG

Samples

Sample ID Description Type Environment
1 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
148 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
149 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
150 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
151 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2643221615 Nocardioides sp. Root224 Isolate Unclassified
234 2643221657 Nocardioides sp. Root1257 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.47
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.3
Nodule 0
Rhizoplane 5.58
Rhizosphere 83.72
Stem 0
Stem Tuber 0
Unclassified 13.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068870_10940408 3300005840 Bacteria 613
2 JGI24740J21852_10159039 3300001979 Unclassified 560
3 JGI24738J21930_10013079 3300002075 Bacteria 1801
4 JGI24744J21845_10010377 3300002077 Bacteria 1908
5 JGI25406J46586_10011437 3300003203 Bacteria 3893
6 rootL2_10134162 3300003322 Unclassified 1578
7 Ga0070658_10011722 3300005327 Bacteria 7033
8 Ga0070658_10060732 3300005327 Bacteria 3079
9 Ga0070683_100001066 3300005329 Bacteria 20584
10 Ga0070683_100039569 3300005329 Bacteria 4330
11 Ga0070683_100372139 3300005329 Bacteria 1361
12 Ga0070683_100398351 3300005329 Bacteria 1313
13 Ga0070683_100691199 3300005329 Bacteria 977
14 Ga0070683_101619846 3300005329 Bacteria 622
15 Ga0070670_100438177 3300005331 Unclassified 1157
16 Ga0070670_101297689 3300005331 Unclassified 666
17 Ga0070666_10330529 3300005335 Unclassified 1088
18 Ga0070680_100306955 3300005336 Bacteria 1346
19 Ga0070682_100005460 3300005337 Bacteria 7078
20 Ga0070682_100961423 3300005337 Bacteria 706
21 Ga0070682_101133896 3300005337 Unclassified 656
22 Ga0068868_100475180 3300005338 Bacteria 1091
23 Ga0068868_100779727 3300005338 Bacteria 861
24 Ga0068868_101186209 3300005338 Unclassified 705
25 Ga0070660_100035883 3300005339 Bacteria 3753
26 Ga0070660_100116921 3300005339 Bacteria 2126
27 Ga0070660_100711457 3300005339 Bacteria 842
28 Ga0070691_10096808 3300005341 Bacteria 1462
29 Ga0070692_10002077 3300005345 Bacteria 7631
30 Ga0070692_10009272 3300005345 Bacteria 4433
31 Ga0070692_10662531 3300005345 Bacteria 698
32 Ga0070668_100021145 3300005347 Bacteria 4918
33 Ga0070668_100527081 3300005347 Bacteria 1026
34 Ga0070669_100623630 3300005353 Bacteria 905
35 Ga0070675_100394244 3300005354 Bacteria 1234
36 Ga0070675_100477156 3300005354 Bacteria 1121
37 Ga0070674_100018014 3300005356 Bacteria 4455
38 Ga0070659_100034337 3300005366 Bacteria 3945
39 Ga0070659_100148711 3300005366 Bacteria 1910
40 Ga0070667_100065469 3300005367 Bacteria 3086
41 Ga0070667_100192297 3300005367 Bacteria 1808
42 Ga0070700_100018912 3300005441 Unclassified 3969
43 Ga0070700_100485249 3300005441 Bacteria 947
44 Ga0070694_100360764 3300005444 Bacteria 1128
45 Ga0070663_100142361 3300005455 Bacteria 1832
46 Ga0070678_100028700 3300005456 Bacteria 3799
47 Ga0070662_100002269 3300005457 Bacteria 11800
48 Ga0070662_100102199 3300005457 Bacteria 2171
49 Ga0070662_100773525 3300005457 Bacteria 815
50 Ga0070681_10062739 3300005458 Bacteria 3690
51 Ga0070681_10177378 3300005458 Bacteria 2052
52 Ga0068867_100007292 3300005459 Bacteria 7824
53 Ga0068867_100144284 3300005459 Bacteria 1864
54 Ga0070685_10820275 3300005466 Bacteria 687
55 Ga0070679_100290580 3300005530 Bacteria 1586
56 Ga0070684_100043122 3300005535 Bacteria 3895
57 Ga0070684_100426329 3300005535 Bacteria 1225
58 Ga0070684_100520256 3300005535 Bacteria 1103
59 Ga0070684_101605924 3300005535 Bacteria 613
60 Ga0068853_100123795 3300005539 Bacteria 2309
61 Ga0068853_100453850 3300005539 Bacteria 1206
62 Ga0068853_100517042 3300005539 Bacteria 1128
63 Ga0070686_100026671 3300005544 Bacteria 3489
64 Ga0070696_101367207 3300005546 Bacteria 603
65 Ga0070693_100145024 3300005547 Unclassified 1498
66 Ga0070693_100325796 3300005547 Bacteria 1044
67 Ga0068855_100068596 3300005563 Bacteria 4128
68 Ga0070664_100300529 3300005564 Bacteria 1450
69 Ga0068857_100004663 3300005577 Bacteria 11608
70 Ga0068857_100175912 3300005577 Unclassified 1947
71 Ga0068857_100213718 3300005577 Bacteria 1760
72 Ga0068857_101893893 3300005577 Unclassified 584
73 Ga0068856_100024857 3300005614 Bacteria 5835
74 Ga0068856_100678501 3300005614 Bacteria 1051
75 Ga0070702_100004722 3300005615 Bacteria 6257
76 Ga0070702_100041303 3300005615 Bacteria 2586
77 Ga0068852_100322677 3300005616 Bacteria 1500
78 Ga0068864_100012295 3300005618 Bacteria 7076
79 Ga0068866_10010166 3300005718 Bacteria 4025
80 Ga0068866_10054699 3300005718 Bacteria 2046
81 Ga0068861_100081695 3300005719 Bacteria 2531
82 Ga0068861_100096345 3300005719 Unclassified 2344
83 Ga0068861_100129022 3300005719 Bacteria 2050
84 Ga0068861_101199906 3300005719 Bacteria 734
85 Ga0068861_101209624 3300005719 Unclassified 731
86 Ga0068870_10472730 3300005840 Unclassified 830
87 Ga0068870_11219670 3300005840 Unclassified 545
88 Ga0068858_100064712 3300005842 Bacteria 3384
89 Ga0068860_100000253 3300005843 Bacteria 79802
90 Ga0068860_100196005 3300005843 Bacteria 1956
91 Ga0068860_100300019 3300005843 Bacteria 1574
92 Ga0068860_100433706 3300005843 Bacteria 1304
93 Ga0068862_100868068 3300005844 Bacteria 885
94 Ga0081455_10093466 3300005937 Bacteria 2431
95 Ga0081455_10099016 3300005937 Bacteria 2346
96 Ga0081538_10000056 3300005981 Bacteria 103929
97 Ga0081539_10000202 3300005985 Bacteria 138350
98 Ga0081539_10042592 3300005985 Bacteria 2642
99 Ga0075365_10001362 3300006038 Bacteria 10970
100 Ga0075365_10003828 3300006038 Bacteria 7852
101 Ga0075365_10039124 3300006038 Bacteria 3087
102 Ga0075365_10040538 3300006038 Bacteria 3037
103 Ga0075365_10134180 3300006038 Bacteria 1715
104 Ga0075365_10168195 3300006038 Bacteria 1530
105 Ga0075365_10291948 3300006038 Bacteria 1147
106 Ga0075365_10804959 3300006038 Bacteria 663
107 Ga0075365_11159689 3300006038 Unclassified 544
108 Ga0075363_100022719 3300006048 Bacteria 3173
109 Ga0075363_100107809 3300006048 Bacteria 1546
110 Ga0075363_100244573 3300006048 Bacteria 1032
111 Ga0075364_10007930 3300006051 Bacteria 6323
112 Ga0075364_10013549 3300006051 Bacteria 5017
113 Ga0075364_10337519 3300006051 Bacteria 1027
114 Ga0075364_10590991 3300006051 Bacteria 758
115 Ga0075432_10016858 3300006058 Bacteria 2494
116 Ga0075362_10170175 3300006177 Bacteria 1052
117 Ga0075367_10017126 3300006178 Bacteria 3972
118 Ga0075367_10028851 3300006178 Bacteria 3169
119 Ga0075367_10261896 3300006178 Bacteria 1085
120 Ga0075370_10041032 3300006353 Bacteria 2612
121 Ga0075370_10517441 3300006353 Bacteria 721
122 Ga0068871_100353500 3300006358 Bacteria 1300
123 Ga0075428_100006553 3300006844 Bacteria 12947
124 Ga0075428_100180414 3300006844 Bacteria 2286
125 Ga0075430_100154319 3300006846 Bacteria 1912
126 Ga0075431_100191711 3300006847 Bacteria 2094
127 Ga0075433_10007579 3300006852 Bacteria 8612
128 Ga0075433_10009461 3300006852 Bacteria 7788
129 Ga0075434_100002677 3300006871 Bacteria 15737
130 Ga0068865_100161011 3300006881 Bacteria 1712
131 Ga0068865_100274672 3300006881 Bacteria 1339
132 Ga0075435_100001164 3300007076 Bacteria 16801
133 Ga0111539_10013583 3300009094 Bacteria 10181
134 Ga0111539_10146830 3300009094 Bacteria 2761
135 Ga0105245_10002794 3300009098 Bacteria 15708
136 Ga0105245_10283499 3300009098 Bacteria 1620
137 Ga0105245_10352715 3300009098 Bacteria 1458
138 Ga0114129_10035510 3300009147 Bacteria 7041
139 Ga0114129_10683076 3300009147 Unclassified 1321
140 Ga0114129_10698978 3300009147 Bacteria 1303
141 Ga0105243_10143624 3300009148 Unclassified 2039
142 Ga0105243_10200231 3300009148 Bacteria 1751
143 Ga0105242_10208100 3300009176 Bacteria 1741
144 Ga0105242_10241778 3300009176 Bacteria 1623
145 Ga0105248_10228129 3300009177 Bacteria 2096
146 Ga0105238_10165635 3300009551 Bacteria 2186
147 Ga0105249_10064364 3300009553 Bacteria 3371
148 Ga0105249_10129247 3300009553 Bacteria 2410
149 Ga0105249_10279165 3300009553 Bacteria 1667
150 Ga0105249_10773496 3300009553 Bacteria 1023
151 Ga0105239_10003258 3300010375 Bacteria 20035
152 Ga0105239_10253728 3300010375 Bacteria 1976
153 Ga0105239_10732819 3300010375 Bacteria 1131
154 Ga0105246_10004174 3300011119 Bacteria 8780
155 Ga0157371_10117237 3300013102 Bacteria 1893
156 Ga0157371_10585192 3300013102 Bacteria 829
157 Ga0157370_10301648 3300013104 Unclassified 1479
158 Ga0157370_10336160 3300013104 Bacteria 1392
159 Ga0157370_11123321 3300013104 Bacteria 710
160 Ga0157369_10109586 3300013105 Bacteria 2936
161 Ga0157378_12647423 3300013297 Bacteria 554
162 Ga0163162_10044748 3300013306 Bacteria 4434
163 Ga0163162_10089493 3300013306 Bacteria 3159
164 Ga0157372_10010607 3300013307 Bacteria 9802
165 Ga0157372_10118887 3300013307 Bacteria 3033
166 Ga0157372_10376857 3300013307 Bacteria 1653
167 Ga0157372_10841529 3300013307 Bacteria 1065
168 Ga0157372_11915993 3300013307 Bacteria 681
169 Ga0157375_10016899 3300013308 Bacteria 6572
170 Ga0157375_10270465 3300013308 Bacteria 1861
171 Ga0157375_10496528 3300013308 Bacteria 1385
172 Ga0163163_10039313 3300014325 Bacteria 4617
173 Ga0163163_10118631 3300014325 Bacteria 2678
174 Ga0163163_10183700 3300014325 Bacteria 2139
175 Ga0157380_10003592 3300014326 Bacteria 10666
176 Ga0157380_10058414 3300014326 Bacteria 3075
177 Ga0157377_10003716 3300014745 Bacteria 6926
178 Ga0157377_10820485 3300014745 Bacteria 688
179 Ga0157377_10938614 3300014745 Unclassified 650
180 Ga0157379_10038134 3300014968 Bacteria 4288
181 Ga0157376_10295310 3300014969 Bacteria 1532
182 Ga0157376_10581640 3300014969 Unclassified 1112
183 Ga0163161_10110060 3300017792 Bacteria 2059
184 Ga0163161_10302813 3300017792 Bacteria 1259
185 Ga0206353_10468409 3300020082 Bacteria 939
186 Ga0206353_11307164 3300020082 Bacteria 2031
187 Ga0207688_10026135 3300025901 Unclassified 3208
188 Ga0207688_10040536 3300025901 Bacteria 2588
189 Ga0207688_10081875 3300025901 Bacteria 1844
190 Ga0207688_10680717 3300025901 Bacteria 650
191 Ga0207647_10012637 3300025904 Bacteria 5869
192 Ga0207647_10078111 3300025904 Bacteria 1989
193 Ga0207647_10150630 3300025904 Bacteria 1360
194 Ga0207643_10007777 3300025908 Bacteria 5756
195 Ga0207643_10139850 3300025908 Bacteria 1445
196 Ga0207643_10345306 3300025908 Bacteria 933
197 Ga0207705_10310021 3300025909 Unclassified 1211
198 Ga0207707_10062572 3300025912 Bacteria 3239
199 Ga0207707_10086946 3300025912 Bacteria 2731
200 Ga0207660_10180532 3300025917 Bacteria 1639
201 Ga0207660_11121824 3300025917 Bacteria 641
202 Ga0207662_10108426 3300025918 Bacteria 1729
203 Ga0207657_10026722 3300025919 Bacteria 5297
204 Ga0207657_10049248 3300025919 Bacteria 3673
205 Ga0207652_10014546 3300025921 Bacteria 6376
206 Ga0207652_10806253 3300025921 Unclassified 833
207 Ga0207681_10176998 3300025923 Bacteria 1622
208 Ga0207681_11145941 3300025923 Bacteria 653
209 Ga0207694_10156422 3300025924 Bacteria 1839
210 Ga0207694_10320316 3300025924 Bacteria 1279
211 Ga0207650_11120346 3300025925 Unclassified 670
212 Ga0207687_10089210 3300025927 Unclassified 2245
213 Ga0207687_10102483 3300025927 Bacteria 2109
214 Ga0207687_10359404 3300025927 Bacteria 1188
215 Ga0207687_10557707 3300025927 Bacteria 962
216 Ga0207690_10006600 3300025932 Bacteria 6871
217 Ga0207690_10679839 3300025932 Bacteria 845
218 Ga0207706_10005090 3300025933 Bacteria 12274
219 Ga0207706_10059210 3300025933 Bacteria 3373
220 Ga0207706_10405844 3300025933 Bacteria 1181
221 Ga0207686_10009010 3300025934 Bacteria 5402
222 Ga0207686_11049719 3300025934 Bacteria 663
223 Ga0207709_10006797 3300025935 Bacteria 6399
224 Ga0207709_10023903 3300025935 Bacteria 3484
225 Ga0207669_10201517 3300025937 Unclassified 1445
226 Ga0207669_10740953 3300025937 Bacteria 811
227 Ga0207691_10051560 3300025940 Bacteria 3761
228 Ga0207711_10162062 3300025941 Bacteria 2025
229 Ga0207689_10272045 3300025942 Bacteria 1403
230 Ga0207661_10443531 3300025944 Unclassified 1181
231 Ga0207661_10524969 3300025944 Bacteria 1083
232 Ga0207661_10591594 3300025944 Bacteria 1018
233 Ga0207661_10714981 3300025944 Bacteria 922
234 Ga0207661_11156477 3300025944 Bacteria 712
235 Ga0207679_10269826 3300025945 Bacteria 1455
236 Ga0207667_10088289 3300025949 Bacteria 3207
237 Ga0207667_10964182 3300025949 Bacteria 842
238 Ga0207667_11180753 3300025949 Bacteria 746
239 Ga0207712_10070052 3300025961 Bacteria 2518
240 Ga0207712_10076958 3300025961 Bacteria 2417
241 Ga0207712_10127443 3300025961 Bacteria 1935
242 Ga0207712_10193277 3300025961 Bacteria 1608
243 Ga0207712_10805519 3300025961 Unclassified 826
244 Ga0207668_10338451 3300025972 Bacteria 1254
245 Ga0207668_10927120 3300025972 Bacteria 776
246 Ga0207658_10039817 3300025986 Bacteria 3393
247 Ga0207677_10842771 3300026023 Unclassified 823
248 Ga0207677_10870594 3300026023 Bacteria 811
249 Ga0207677_10998113 3300026023 Unclassified 759
250 Ga0207677_11171358 3300026023 Bacteria 703
251 Ga0207703_10086875 3300026035 Bacteria 2621
252 Ga0207639_10097785 3300026041 Bacteria 2365
253 Ga0207639_10153297 3300026041 Bacteria 1933
254 Ga0207639_11036761 3300026041 Bacteria 769
255 Ga0207708_10278813 3300026075 Bacteria 1354
256 Ga0207702_10043268 3300026078 Bacteria 3781
257 Ga0207702_10627517 3300026078 Bacteria 1056
258 Ga0207648_10004668 3300026089 Bacteria 14016
259 Ga0207648_10113156 3300026089 Bacteria 2383
260 Ga0207676_10074358 3300026095 Bacteria 2737
261 Ga0207674_10004942 3300026116 Bacteria 15920
262 Ga0207674_10294255 3300026116 Bacteria 1572
263 Ga0207674_10661336 3300026116 Bacteria 1009
264 Ga0207675_100026161 3300026118 Bacteria 5432
265 Ga0207675_100153817 3300026118 Bacteria 2191
266 Ga0207683_10044760 3300026121 Bacteria 3869
267 Ga0207698_10715778 3300026142 Bacteria 997
268 Ga0207698_11262572 3300026142 Bacteria 753
269 Ga0207428_10009315 3300027907 Bacteria 8809
270 Ga0207428_10245742 3300027907 Bacteria 1336
271 Ga0268265_11991760 3300028380 Unclassified 588
272 Ga0268264_10000220 3300028381 Bacteria 111692
273 Ga0268264_10149714 3300028381 Bacteria 2091
274 Ga0268264_11722307 3300028381 Bacteria 637
275 Ga0307517_10522579 3300028786 Bacteria 599
276 Ga0307408_100894207 3300031548 Bacteria 812
277 Ga0307405_10859795 3300031731 Unclassified 764
278 Ga0307410_10250069 3300031852 Bacteria 1378
279 Ga0307406_10276601 3300031901 Bacteria 1278
280 Ga0307406_11425287 3300031901 Unclassified 608
281 Ga0307409_100263134 3300031995 Bacteria 1584
282 Ga0307409_100981214 3300031995 Bacteria 862
283 Ga0307416_100032520 3300032002 Bacteria 3943
284 Ga0316574_0579770 3300035398 Bacteria 694
285 Ga0316584_0644058 3300036712 Bacteria 731
286 Ga0439461_0004398 3300041410 Bacteria 2353
287 Ga0439466_0143448 3300041411 Unclassified 732
288 Ga0451797_0417653 3300041453 Bacteria 512
289 Ga0451853_0677070 3300041512 Bacteria 537
290 Ga0451853_1239094 3300041512 Bacteria 2048
291 Ga0439448_0025498 3300042005 Bacteria 1855
292 Ga0439432_189196 3300042006 Bacteria 598
293 Ga0439450_041883 3300042008 Unclassified 1066
294 Ga0439456_055170 3300042013 Unclassified 870
295 Ga0439463_018376 3300042016 Bacteria 1740
296 Ga0450902_056426 3300042137 Bacteria 677
297 Ga0450910_100229 3300042147 Bacteria 520
298 Ga0439446_0112989 3300042156 Bacteria 868
299 Ga0439458_0084406 3300042157 Unclassified 813
300 Ga0450908_034464 3300042184 Bacteria 877
301 Ga0439434_0132680 3300042435 Bacteria 818
302 Ga0439435_0191672 3300042436 Unclassified 671
303 Ga0439464_0165049 3300042439 Bacteria 697
304 Ga0439460_0293423 3300042461 Unclassified 568
305 Ga0466963_0524196 3300044694 Unclassified 837
306 Ga0466963_0993906 3300044694 Bacteria 591
307 Ga0466964_0392699 3300044706 Bacteria 723
308 Ga0451576_0487897 3300045051 Bacteria 1294
309 Ga0466967_1040185 3300045976 Bacteria 815
310 Ga0495641_0010503 3300046461 Bacteria 5361
311 Ga0495582_0053646 3300046473 Bacteria 2224
312 Ga0495584_0698711 3300046491 Bacteria 517
313 Ga0495607_0299193 3300046501 Unclassified 758
314 Ga0495620_0171636 3300046515 Bacteria 841
315 Ga0495670_0402144 3300046691 Unclassified 740
316 Ga0495581_0188615 3300047315 Bacteria 1206
317 Ga0495614_0107176 3300048089 Bacteria 1225
318 Ga0495626_0433244 3300048091 Unclassified 506
319 Ga0496101_0304483 3300048904 Bacteria 1249
320 Ga0496102_0049598 3300048905 Bacteria 3819
321 Ga0496102_0344763 3300048905 Bacteria 1403
322 Ga0496102_1062968 3300048905 Bacteria 729
323 Ga0496102_1712385 3300048905 Bacteria 546
324 Ga0496103_0051557 3300048906 Bacteria 2547
325 Ga0496104_0267662 3300048907 Bacteria 1621
326 Ga0496105_0035438 3300048908 Bacteria 4106
327 Ga0496106_0054805 3300048909 Bacteria 3013
328 Ga0496106_0386301 3300048909 Bacteria 1125
329 Ga0496107_0305265 3300048910 Unclassified 1185
330 Ga0496108_0102967 3300048911 Bacteria 2436
331 Ga0496108_0190316 3300048911 Bacteria 1778
332 Ga0496108_0206396 3300048911 Unclassified 1705
333 Ga0496109_0015062 3300048912 Bacteria 6730
334 Ga0496109_0111240 3300048912 Bacteria 2547
335 Ga0496110_0009027 3300048913 Bacteria 8046
336 Ga0496110_0110637 3300048913 Bacteria 2468
337 Ga0496110_1130158 3300048913 Bacteria 692
338 Ga0496111_0148673 3300048914 Unclassified 1737
339 Ga0496114_0035982 3300048917 Bacteria 4091
340 Ga0496114_0581699 3300048917 Unclassified 988
341 Ga0496114_1147660 3300048917 Bacteria 662
342 Ga0501032_0044175 3300049569 Bacteria 3017
343 Ga0501033_0106111 3300049570 Bacteria 2047
344 Ga0501034_0098469 3300049571 Bacteria 2920
345 Ga0501034_0893324 3300049571 Bacteria 777
346 Ga0501036_0010310 3300049572 Bacteria 7710
347 Ga0501037_0183428 3300049573 Bacteria 1484
348 Ga0501038_0791393 3300049574 Unclassified 705
349 Ga0501039_0034801 3300049575 Bacteria 3886
350 Ga0501040_0100847 3300049576 Bacteria 2013
351 Ga0501041_0099581 3300049577 Bacteria 1798
352 Ga0501041_0322075 3300049577 Bacteria 975
353 Ga0501042_0069762 3300049578 Bacteria 2514
354 Ga0501043_0277345 3300049579 Bacteria 1286
355 Ga0501043_0705842 3300049579 Unclassified 736
356 Ga0501046_0498113 3300049580 Unclassified 873
357 Ga0501047_0738606 3300049581 Bacteria 801
358 Ga0501048_0282033 3300049582 Bacteria 1181
359 Ga0501067_0001169 3300049583 Bacteria 14235
360 Ga0501067_0004982 3300049583 Bacteria 7379
361 Ga0501068_0007369 3300049584 Bacteria 6091
362 Ga0501068_0161994 3300049584 Bacteria 1410
363 Ga0501068_0271704 3300049584 Unclassified 1082
364 Ga0501070_0006282 3300049586 Bacteria 10111
365 Ga0501070_0517104 3300049586 Bacteria 958
366 Ga0501071_0603959 3300049587 Bacteria 843
367 Ga0501072_0006546 3300049588 Bacteria 8873
368 Ga0501072_0072701 3300049588 Bacteria 2718
369 Ga0501072_0207842 3300049588 Bacteria 1560
370 Ga0501073_0001292 3300049589 Bacteria 18392
371 Ga0501073_0025765 3300049589 Bacteria 4213
372 Ga0501073_0152079 3300049589 Bacteria 1604
373 Ga0501074_0004602 3300049590 Bacteria 9878
374 Ga0501074_0004742 3300049590 Bacteria 9748
375 Ga0501074_0492685 3300049590 Bacteria 868
376 Ga0501075_0007530 3300049591 Bacteria 7551
377 Ga0501075_1242761 3300049591 Unclassified 565
378 Ga0501076_0069900 3300049592 Bacteria 2806
379 Ga0501076_0423357 3300049592 Bacteria 1096
380 Ga0501077_0012761 3300049593 Bacteria 5264
381 Ga0501249_158784 3300049679 Unclassified 573
382 Ga0501079_0030373 3300049741 Bacteria 4151
383 Ga0501079_0046469 3300049741 Bacteria 3350
384 Ga0501080_0059069 3300049742 Bacteria 3569
385 Ga0501080_0309628 3300049742 Bacteria 1431
386 Ga0501080_0799715 3300049742 Bacteria 827
387 Ga0501081_0936955 3300049743 Unclassified 653
388 Ga0501083_0380238 3300049744 Bacteria 918
389 Ga0501035_0133542 3300049822 Bacteria 2162
390 Ga0501044_0547404 3300049823 Bacteria 1055
391 Ga0501045_0324136 3300049824 Bacteria 1146
392 Ga0501045_0896137 3300049824 Unclassified 652
393 nmdc:mga03683_108248_c1 3300050489 Bacteria 1226
394 nmdc:mga03n38_100263_c1 3300050490 Bacteria 1395
395 nmdc:mga03n38_109578_c1 3300050490 Bacteria 1343
396 nmdc:mga03n38_128189_c1 3300050490 Bacteria 1254
397 nmdc:mga03n38_520765_c1 3300050490 Bacteria 669
398 nmdc:mga00v17_141504_c1 3300050491 Bacteria 1543
399 nmdc:mga00v17_301588_c1 3300050491 Bacteria 1040
400 nmdc:mga00v17_8238_c1 3300050491 Bacteria 5606
401 nmdc:mga00v17_94838_c1 3300050491 Bacteria 1878
402 nmdc:mga00v17_986161_c1 3300050491 Bacteria 531
403 nmdc:mga0yw44_152478_c1 3300050492 Bacteria 1508
404 nmdc:mga0yw44_252924_c1 3300050492 Bacteria 1173
405 nmdc:mga0yw44_366671_c1 3300050492 Bacteria 971
406 nmdc:mga0yw44_3705_c1 3300050492 Bacteria 6840
407 nmdc:mga0yw44_502308_c1 3300050492 Unclassified 823
408 nmdc:mga0yw44_74846_c1 3300050492 Bacteria 2110
409 nmdc:mga06z11_319469_c1 3300050494 Unclassified 926
410 nmdc:mga07m45_57865_c1 3300050496 Bacteria 2193
411 nmdc:mga05p37_10833_c1 3300050507 Bacteria 10827
412 nmdc:mga05p37_904447_c1 3300050507 Bacteria 951
413 nmdc:mga0qj67_323950_c1 3300050509 Bacteria 1247
414 nmdc:mga06r32_658977_c1 3300050510 Bacteria 1014
415 nmdc:mga08y16_112690_c1 3300050511 Bacteria 2832
416 nmdc:mga08y16_165969_c1 3300050511 Unclassified 2294
417 nmdc:mga08y16_224550_c1 3300050511 Bacteria 1944
418 nmdc:mga0n895_2839_c1 3300050512 Bacteria 13721
419 nmdc:mga0rr50_132993_c1 3300050513 Bacteria 1994
420 nmdc:mga0rr50_151078_c1 3300050513 Unclassified 1877
421 nmdc:mga0a205_79016_c1 3300050515 Bacteria 3179
422 Ga0495655_0149878 3300053083 Bacteria 733
423 Ga0501084_0005861 3300054114 Bacteria 10114
424 Ga0501084_0153852 3300054114 Bacteria 1939
425 Ga0501082_0033676 3300060353 Bacteria 4419
426 Ga0501082_0034488 3300060353 Bacteria 4362
427 Ga0501082_0256832 3300060353 Bacteria 1520
428 Ga0530510_0016812 3300061734 Bacteria 5180
429 2644091872 2643221615 Bacteria 5487866
430 2644321675 2643221657 Bacteria 5490246
431 Ga0068870_10940408
432 JGI24740J21852_10159039
433 JGI24738J21930_10013079
434 JGI24744J21845_10010377
435 JGI25406J46586_10011437
436 rootL2_10134162
437 Ga0070658_10011722
438 Ga0070658_10060732
439 Ga0070683_100001066
440 Ga0070683_100039569
441 Ga0070683_100372139
442 Ga0070683_100398351
443 Ga0070683_100691199
444 Ga0070683_101619846
445 Ga0070670_100438177
446 Ga0070670_101297689
447 Ga0070666_10330529
448 Ga0070680_100306955
449 Ga0070682_100005460
450 Ga0070682_100961423
451 Ga0070682_101133896
452 Ga0068868_100475180
453 Ga0068868_100779727
454 Ga0068868_101186209
455 Ga0070660_100035883
456 Ga0070660_100116921
457 Ga0070660_100711457
458 Ga0070691_10096808
459 Ga0070692_10002077
460 Ga0070692_10009272
461 Ga0070692_10662531
462 Ga0070668_100021145
463 Ga0070668_100527081
464 Ga0070669_100623630
465 Ga0070675_100394244
466 Ga0070675_100477156
467 Ga0070674_100018014
468 Ga0070659_100034337
469 Ga0070659_100148711
470 Ga0070667_100065469
471 Ga0070667_100192297
472 Ga0070700_100018912
473 Ga0070700_100485249
474 Ga0070694_100360764
475 Ga0070663_100142361
476 Ga0070678_100028700
477 Ga0070662_100002269
478 Ga0070662_100102199
479 Ga0070662_100773525
480 Ga0070681_10062739
481 Ga0070681_10177378
482 Ga0068867_100007292
483 Ga0068867_100144284
484 Ga0070685_10820275
485 Ga0070679_100290580
486 Ga0070684_100043122
487 Ga0070684_100426329
488 Ga0070684_100520256
489 Ga0070684_101605924
490 Ga0068853_100123795
491 Ga0068853_100453850
492 Ga0068853_100517042
493 Ga0070686_100026671
494 Ga0070696_101367207
495 Ga0070693_100145024
496 Ga0070693_100325796
497 Ga0068855_100068596
498 Ga0070664_100300529
499 Ga0068857_100004663
500 Ga0068857_100175912
501 Ga0068857_100213718
502 Ga0068857_101893893
503 Ga0068856_100024857
504 Ga0068856_100678501
505 Ga0070702_100004722
506 Ga0070702_100041303
507 Ga0068852_100322677
508 Ga0068864_100012295
509 Ga0068866_10010166
510 Ga0068866_10054699
511 Ga0068861_100081695
512 Ga0068861_100096345
513 Ga0068861_100129022
514 Ga0068861_101199906
515 Ga0068861_101209624
516 Ga0068870_10472730
517 Ga0068870_11219670
518 Ga0068858_100064712
519 Ga0068860_100000253
520 Ga0068860_100196005
521 Ga0068860_100300019
522 Ga0068860_100433706
523 Ga0068862_100868068
524 Ga0081455_10093466
525 Ga0081455_10099016
526 Ga0081538_10000056
527 Ga0081539_10000202
528 Ga0081539_10042592
529 Ga0075365_10001362
530 Ga0075365_10003828
531 Ga0075365_10039124
532 Ga0075365_10040538
533 Ga0075365_10134180
534 Ga0075365_10168195
535 Ga0075365_10291948
536 Ga0075365_10804959
537 Ga0075365_11159689
538 Ga0075363_100022719
539 Ga0075363_100107809
540 Ga0075363_100244573
541 Ga0075364_10007930
542 Ga0075364_10013549
543 Ga0075364_10337519
544 Ga0075364_10590991
545 Ga0075432_10016858
546 Ga0075362_10170175
547 Ga0075367_10017126
548 Ga0075367_10028851
549 Ga0075367_10261896
550 Ga0075370_10041032
551 Ga0075370_10517441
552 Ga0068871_100353500
553 Ga0075428_100006553
554 Ga0075428_100180414
555 Ga0075430_100154319
556 Ga0075431_100191711
557 Ga0075433_10007579
558 Ga0075433_10009461
559 Ga0075434_100002677
560 Ga0068865_100161011
561 Ga0068865_100274672
562 Ga0075435_100001164
563 Ga0111539_10013583
564 Ga0111539_10146830
565 Ga0105245_10002794
566 Ga0105245_10283499
567 Ga0105245_10352715
568 Ga0114129_10035510
569 Ga0114129_10683076
570 Ga0114129_10698978
571 Ga0105243_10143624
572 Ga0105243_10200231
573 Ga0105242_10208100
574 Ga0105242_10241778
575 Ga0105248_10228129
576 Ga0105238_10165635
577 Ga0105249_10064364
578 Ga0105249_10129247
579 Ga0105249_10279165
580 Ga0105249_10773496
581 Ga0105239_10003258
582 Ga0105239_10253728
583 Ga0105239_10732819
584 Ga0105246_10004174
585 Ga0157371_10117237
586 Ga0157371_10585192
587 Ga0157370_10301648
588 Ga0157370_10336160
589 Ga0157370_11123321
590 Ga0157369_10109586
591 Ga0157378_12647423
592 Ga0163162_10044748
593 Ga0163162_10089493
594 Ga0157372_10010607
595 Ga0157372_10118887
596 Ga0157372_10376857
597 Ga0157372_10841529
598 Ga0157372_11915993
599 Ga0157375_10016899
600 Ga0157375_10270465
601 Ga0157375_10496528
602 Ga0163163_10039313
603 Ga0163163_10118631
604 Ga0163163_10183700
605 Ga0157380_10003592
606 Ga0157380_10058414
607 Ga0157377_10003716
608 Ga0157377_10820485
609 Ga0157377_10938614
610 Ga0157379_10038134
611 Ga0157376_10295310
612 Ga0157376_10581640
613 Ga0163161_10110060
614 Ga0163161_10302813
615 Ga0206353_10468409
616 Ga0206353_11307164
617 Ga0207688_10026135
618 Ga0207688_10040536
619 Ga0207688_10081875
620 Ga0207688_10680717
621 Ga0207647_10012637
622 Ga0207647_10078111
623 Ga0207647_10150630
624 Ga0207643_10007777
625 Ga0207643_10139850
626 Ga0207643_10345306
627 Ga0207705_10310021
628 Ga0207707_10062572
629 Ga0207707_10086946
630 Ga0207660_10180532
631 Ga0207660_11121824
632 Ga0207662_10108426
633 Ga0207657_10026722
634 Ga0207657_10049248
635 Ga0207652_10014546
636 Ga0207652_10806253
637 Ga0207681_10176998
638 Ga0207681_11145941
639 Ga0207694_10156422
640 Ga0207694_10320316
641 Ga0207650_11120346
642 Ga0207687_10089210
643 Ga0207687_10102483
644 Ga0207687_10359404
645 Ga0207687_10557707
646 Ga0207690_10006600
647 Ga0207690_10679839
648 Ga0207706_10005090
649 Ga0207706_10059210
650 Ga0207706_10405844
651 Ga0207686_10009010
652 Ga0207686_11049719
653 Ga0207709_10006797
654 Ga0207709_10023903
655 Ga0207669_10201517
656 Ga0207669_10740953
657 Ga0207691_10051560
658 Ga0207711_10162062
659 Ga0207689_10272045
660 Ga0207661_10443531
661 Ga0207661_10524969
662 Ga0207661_10591594
663 Ga0207661_10714981
664 Ga0207661_11156477
665 Ga0207679_10269826
666 Ga0207667_10088289
667 Ga0207667_10964182
668 Ga0207667_11180753
669 Ga0207712_10070052
670 Ga0207712_10076958
671 Ga0207712_10127443
672 Ga0207712_10193277
673 Ga0207712_10805519
674 Ga0207668_10338451
675 Ga0207668_10927120
676 Ga0207658_10039817
677 Ga0207677_10842771
678 Ga0207677_10870594
679 Ga0207677_10998113
680 Ga0207677_11171358
681 Ga0207703_10086875
682 Ga0207639_10097785
683 Ga0207639_10153297
684 Ga0207639_11036761
685 Ga0207708_10278813
686 Ga0207702_10043268
687 Ga0207702_10627517
688 Ga0207648_10004668
689 Ga0207648_10113156
690 Ga0207676_10074358
691 Ga0207674_10004942
692 Ga0207674_10294255
693 Ga0207674_10661336
694 Ga0207675_100026161
695 Ga0207675_100153817
696 Ga0207683_10044760
697 Ga0207698_10715778
698 Ga0207698_11262572
699 Ga0207428_10009315
700 Ga0207428_10245742
701 Ga0268265_11991760
702 Ga0268264_10000220
703 Ga0268264_10149714
704 Ga0268264_11722307
705 Ga0307517_10522579
706 Ga0307408_100894207
707 Ga0307405_10859795
708 Ga0307410_10250069
709 Ga0307406_10276601
710 Ga0307406_11425287
711 Ga0307409_100263134
712 Ga0307409_100981214
713 Ga0307416_100032520
714 Ga0316574_0579770
715 Ga0316584_0644058
716 Ga0439461_0004398
717 Ga0439466_0143448
718 Ga0451797_0417653
719 Ga0451853_0677070
720 Ga0451853_1239094
721 Ga0439448_0025498
722 Ga0439432_189196
723 Ga0439450_041883
724 Ga0439456_055170
725 Ga0439463_018376
726 Ga0450902_056426
727 Ga0450910_100229
728 Ga0439446_0112989
729 Ga0439458_0084406
730 Ga0450908_034464
731 Ga0439434_0132680
732 Ga0439435_0191672
733 Ga0439464_0165049
734 Ga0439460_0293423
735 Ga0466963_0524196
736 Ga0466963_0993906
737 Ga0466964_0392699
738 Ga0451576_0487897
739 Ga0466967_1040185
740 Ga0495641_0010503
741 Ga0495582_0053646
742 Ga0495584_0698711
743 Ga0495607_0299193
744 Ga0495620_0171636
745 Ga0495670_0402144
746 Ga0495581_0188615
747 Ga0495614_0107176
748 Ga0495626_0433244
749 Ga0496101_0304483
750 Ga0496102_0049598
751 Ga0496102_0344763
752 Ga0496102_1062968
753 Ga0496102_1712385
754 Ga0496103_0051557
755 Ga0496104_0267662
756 Ga0496105_0035438
757 Ga0496106_0054805
758 Ga0496106_0386301
759 Ga0496107_0305265
760 Ga0496108_0102967
761 Ga0496108_0190316
762 Ga0496108_0206396
763 Ga0496109_0015062
764 Ga0496109_0111240
765 Ga0496110_0009027
766 Ga0496110_0110637
767 Ga0496110_1130158
768 Ga0496111_0148673
769 Ga0496114_0035982
770 Ga0496114_0581699
771 Ga0496114_1147660
772 Ga0501032_0044175
773 Ga0501033_0106111
774 Ga0501034_0098469
775 Ga0501034_0893324
776 Ga0501036_0010310
777 Ga0501037_0183428
778 Ga0501038_0791393
779 Ga0501039_0034801
780 Ga0501040_0100847
781 Ga0501041_0099581
782 Ga0501041_0322075
783 Ga0501042_0069762
784 Ga0501043_0277345
785 Ga0501043_0705842
786 Ga0501046_0498113
787 Ga0501047_0738606
788 Ga0501048_0282033
789 Ga0501067_0001169
790 Ga0501067_0004982
791 Ga0501068_0007369
792 Ga0501068_0161994
793 Ga0501068_0271704
794 Ga0501070_0006282
795 Ga0501070_0517104
796 Ga0501071_0603959
797 Ga0501072_0006546
798 Ga0501072_0072701
799 Ga0501072_0207842
800 Ga0501073_0001292
801 Ga0501073_0025765
802 Ga0501073_0152079
803 Ga0501074_0004602
804 Ga0501074_0004742
805 Ga0501074_0492685
806 Ga0501075_0007530
807 Ga0501075_1242761
808 Ga0501076_0069900
809 Ga0501076_0423357
810 Ga0501077_0012761
811 Ga0501249_158784
812 Ga0501079_0030373
813 Ga0501079_0046469
814 Ga0501080_0059069
815 Ga0501080_0309628
816 Ga0501080_0799715
817 Ga0501081_0936955
818 Ga0501083_0380238
819 Ga0501035_0133542
820 Ga0501044_0547404
821 Ga0501045_0324136
822 Ga0501045_0896137
823 nmdc:mga03683_108248_c1
824 nmdc:mga03n38_100263_c1
825 nmdc:mga03n38_109578_c1
826 nmdc:mga03n38_128189_c1
827 nmdc:mga03n38_520765_c1
828 nmdc:mga00v17_141504_c1
829 nmdc:mga00v17_301588_c1
830 nmdc:mga00v17_8238_c1
831 nmdc:mga00v17_94838_c1
832 nmdc:mga00v17_986161_c1
833 nmdc:mga0yw44_152478_c1
834 nmdc:mga0yw44_252924_c1
835 nmdc:mga0yw44_366671_c1
836 nmdc:mga0yw44_3705_c1
837 nmdc:mga0yw44_502308_c1
838 nmdc:mga0yw44_74846_c1
839 nmdc:mga06z11_319469_c1
840 nmdc:mga07m45_57865_c1
841 nmdc:mga05p37_10833_c1
842 nmdc:mga05p37_904447_c1
843 nmdc:mga0qj67_323950_c1
844 nmdc:mga06r32_658977_c1
845 nmdc:mga08y16_112690_c1
846 nmdc:mga08y16_165969_c1
847 nmdc:mga08y16_224550_c1
848 nmdc:mga0n895_2839_c1
849 nmdc:mga0rr50_132993_c1
850 nmdc:mga0rr50_151078_c1
851 nmdc:mga0a205_79016_c1
852 Ga0495655_0149878
853 Ga0501084_0005861
854 Ga0501084_0153852
855 Ga0501082_0033676
856 Ga0501082_0034488
857 Ga0501082_0256832
858 Ga0530510_0016812
859 2644091872
860 2644321675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

22

134

0.84

PF13577

SnoaL_4

SnoaL-like domain

13

132

0.79

PF14534

DUF4440

Domain of unknown function (DUF4440)

20

132

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p44-assembly1.cif.gz_B crystal structure of ketosteroid isomerase d38n mutant from mycobacterium hassiacum (mhksi) bound to 3,4-dinitrophenol 0.8487 7 134
5ai1-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase containing y32f, d40n, y57f and y119f mutations in the equilenin-bound form 0.821 5 134
4rzm-assembly1.cif.gz_A crystal structure of the lsd19-lasalocid a complex 0.8141 6 131
1w02-assembly1.cif.gz_A-2 crystal structure of mutant enzyme y16f/d103l of ketosteroid isomerase from pseudomonas putida biotype b 0.8127 13 134
4pej-assembly1.cif.gz_A crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.8124 9 134
ID Description Score Start End Superfamily
4rzmA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8163 6 134 3.10.450.50
4lmiA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7913 8 137 3.10.450.50
4k1uB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.788 9 134 3.10.450.50
5tgnA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7863 14 134 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7789 8 134 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1F2WCK6-F1-model_v4 SnoaL-like domain-containing protein 0.9826 7 130
AF-A0A7V9BQU4-F1-model_v4 Nuclear transport factor 2 family protein 0.9812 7 136
AF-A0A521RWN5-F1-model_v4 SnoaL-like domain-containing protein 0.9708 26 137
AF-A0A3N0GWF2-F1-model_v4 Nuclear transport factor 2 family protein 0.9701 1 137
AF-A0A538A6Z5-F1-model_v4 Nuclear transport factor 2 family protein 0.9687 1 136

Map