F441932

General Info

Members Datasets Scaffolds Average Seq Length
429 216 858 336

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10009954|Ga0207702_100099542
Length 407
Sequence MLLTCPLIDLAIALKFRLLSIAFTSERLLPEISAESFIGATLDLWMCLLTELYSGITIGEQTTKHMSALPFLPLNDKPRLVGIARLAAEGESVREGHNVEYFTLPSKSLLNRCVSKRAMPFNWTINPYRGCEFGCRYCYARYTHEFMEMRDGMEFEEKIYIKQHAADLLRYELKRVKLDESIALGTATDPYQPAERRYQVTQGILEEFARHRGFELGIVTKSNLIVRDVELLQQIARSNKLSVHVTVTTLDTGLARILEPRAPRPDLRMEAVRMLAQAGIQVGISCSPVIPGITDAPKDLEDIVRTAAEAGADYVFANPLFLKPCSAAVFLPFLQQNFPHLAENYRQRYQDRAFLPPSYGKRLTELIARLRDKYKLTRAHRRDSSAFATKWPVQAFDEQLNLFGGIE

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
96 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
97 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
98 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
99 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.36
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 20.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10009954 3300026078 Bacteria 7973
2 JGI24751J29686_10006630 3300002459 Bacteria 2360
3 Ga0065715_10092480 3300005293 Bacteria 5103
4 Ga0070676_10004962 3300005328 Bacteria 7046
5 Ga0070683_100027059 3300005329 Bacteria 5169
6 Ga0070690_100018190 3300005330 Bacteria 4240
7 Ga0070670_100036996 3300005331 Bacteria 4199
8 Ga0068869_100018132 3300005334 Bacteria 4786
9 Ga0068869_100030621 3300005334 Unclassified 3779
10 Ga0070666_10009972 3300005335 Bacteria 5928
11 Ga0070666_10057130 3300005335 Unclassified 2636
12 Ga0070680_100068094 3300005336 Bacteria 2921
13 Ga0070682_100026200 3300005337 Bacteria 3487
14 Ga0070682_100104600 3300005337 Bacteria 1875
15 Ga0068868_100064877 3300005338 Bacteria 2900
16 Ga0068868_100126664 3300005338 Bacteria 2087
17 Ga0068868_100138981 3300005338 Unclassified 1993
18 Ga0070660_100029695 3300005339 Unclassified 4099
19 Ga0070689_100013854 3300005340 Bacteria 5844
20 Ga0070689_100186789 3300005340 Bacteria 1686
21 Ga0070687_100064292 3300005343 Unclassified 1949
22 Ga0070661_100016349 3300005344 Bacteria 5244
23 Ga0070661_100017890 3300005344 Bacteria 5032
24 Ga0070669_100018478 3300005353 Bacteria 4981
25 Ga0070669_100066483 3300005353 Bacteria 2657
26 Ga0070673_100087732 3300005364 Unclassified 2536
27 Ga0070673_100398433 3300005364 Unclassified 1230
28 Ga0070659_100025017 3300005366 Bacteria 4582
29 Ga0070709_10021439 3300005434 Unclassified 3763
30 Ga0070709_10022328 3300005434 Bacteria 3700
31 Ga0070709_10028918 3300005434 Unclassified 3309
32 Ga0070709_10207412 3300005434 Bacteria 1391
33 Ga0070714_100000536 3300005435 Bacteria 27458
34 Ga0070714_100041539 3300005435 Bacteria 3881
35 Ga0070714_100065814 3300005435 Bacteria 3122
36 Ga0070714_100297131 3300005435 Bacteria 1504
37 Ga0070714_100322861 3300005435 Bacteria 1444
38 Ga0070713_100001327 3300005436 Bacteria 15812
39 Ga0070713_100004472 3300005436 Bacteria 9393
40 Ga0070713_100010860 3300005436 Bacteria 6602
41 Ga0070713_100017360 3300005436 Bacteria 5441
42 Ga0070713_100078040 3300005436 Unclassified 2818
43 Ga0070713_100092584 3300005436 Bacteria 2603
44 Ga0070713_100305064 3300005436 Unclassified 1467
45 Ga0070710_10007418 3300005437 Bacteria 5310
46 Ga0070710_10036035 3300005437 Bacteria 2702
47 Ga0070710_10069529 3300005437 Bacteria 2026
48 Ga0070711_100004864 3300005439 Bacteria 7976
49 Ga0070711_100005596 3300005439 Bacteria 7520
50 Ga0070711_100008072 3300005439 Bacteria 6429
51 Ga0070711_100009558 3300005439 Bacteria 5980
52 Ga0070711_100131121 3300005439 Unclassified 1867
53 Ga0070711_100248587 3300005439 Bacteria 1394
54 Ga0070694_100116413 3300005444 Bacteria 1912
55 Ga0070694_100287827 3300005444 Bacteria 1255
56 Ga0070708_100000659 3300005445 Bacteria 26153
57 Ga0070708_100020682 3300005445 Bacteria 5555
58 Ga0070708_100024681 3300005445 Bacteria 5134
59 Ga0070708_100025049 3300005445 Bacteria 5098
60 Ga0070708_100025323 3300005445 Bacteria 5071
61 Ga0070708_100029390 3300005445 Bacteria 4739
62 Ga0070708_100082734 3300005445 Bacteria 2908
63 Ga0070708_100196775 3300005445 Bacteria 1886
64 Ga0070708_100326711 3300005445 Bacteria 1445
65 Ga0070663_100038833 3300005455 Bacteria 3323
66 Ga0070678_100005729 3300005456 Bacteria 7217
67 Ga0070678_100256136 3300005456 Bacteria 1469
68 Ga0070662_100225055 3300005457 Bacteria 1498
69 Ga0070681_10012236 3300005458 Bacteria 8506
70 Ga0070681_10046368 3300005458 Unclassified 4345
71 Ga0068867_100011344 3300005459 Bacteria 6287
72 Ga0070685_10010689 3300005466 Unclassified 4777
73 Ga0070706_100000501 3300005467 Bacteria 45922
74 Ga0070706_100132338 3300005467 Bacteria 2328
75 Ga0070707_100012023 3300005468 Bacteria 8080
76 Ga0070707_100042192 3300005468 Bacteria 4367
77 Ga0070707_100083146 3300005468 Bacteria 3093
78 Ga0070698_100001838 3300005471 Bacteria 23641
79 Ga0070698_100021582 3300005471 Bacteria 6743
80 Ga0070699_100001042 3300005518 Bacteria 25804
81 Ga0070699_100083543 3300005518 Bacteria 2785
82 Ga0070699_100149301 3300005518 Bacteria 2066
83 Ga0070679_100095512 3300005530 Archaea 2960
84 Ga0070679_100232317 3300005530 Bacteria 1803
85 Ga0070684_100020077 3300005535 Bacteria 5541
86 Ga0070684_100067178 3300005535 Bacteria 3148
87 Ga0070697_100000617 3300005536 Bacteria 27050
88 Ga0070697_100004883 3300005536 Bacteria 10287
89 Ga0070697_100008473 3300005536 Bacteria 8024
90 Ga0070697_100019760 3300005536 Bacteria 5321
91 Ga0070697_100025659 3300005536 Unclassified 4701
92 Ga0070697_100075291 3300005536 Bacteria 2774
93 Ga0070697_100228876 3300005536 Bacteria 1585
94 Ga0068853_100250011 3300005539 Bacteria 1626
95 Ga0068853_100303412 3300005539 Bacteria 1476
96 Ga0070696_100098245 3300005546 Bacteria 2094
97 Ga0070693_100199519 3300005547 Bacteria 1298
98 Ga0070665_100290613 3300005548 Unclassified 1637
99 Ga0068855_100064938 3300005563 Unclassified 4256
100 Ga0068855_100100718 3300005563 Unclassified 3326
101 Ga0068855_100162278 3300005563 Bacteria 2535
102 Ga0070664_100004025 3300005564 Bacteria 11805
103 Ga0070664_100025907 3300005564 Bacteria 4862
104 Ga0068857_100013737 3300005577 Bacteria 7055
105 Ga0068857_100056683 3300005577 Bacteria 3477
106 Ga0068854_100044780 3300005578 Bacteria 3143
107 Ga0068854_100066274 3300005578 Unclassified 2628
108 Ga0068854_100196214 3300005578 Unclassified 1584
109 Ga0068856_100025236 3300005614 Bacteria 5791
110 Ga0068852_100031695 3300005616 Unclassified 4367
111 Ga0068852_100234262 3300005616 Bacteria 1752
112 Ga0068859_100036160 3300005617 Bacteria 4957
113 Ga0068859_100091286 3300005617 Unclassified 3096
114 Ga0068859_100290696 3300005617 Bacteria 1727
115 Ga0068864_100349962 3300005618 Bacteria 1394
116 Ga0068866_10001080 3300005718 Bacteria 12019
117 Ga0068851_10001498 3300005834 Bacteria 10240
118 Ga0068870_10001286 3300005840 Bacteria 10094
119 Ga0068863_100037045 3300005841 Bacteria 4644
120 Ga0068858_100033065 3300005842 Unclassified 4803
121 Ga0068858_100076697 3300005842 Unclassified 3104
122 Ga0068860_100041738 3300005843 Bacteria 4382
123 Ga0068862_100036843 3300005844 Bacteria 4146
124 Ga0070717_10003108 3300006028 Bacteria 11844
125 Ga0070717_10012454 3300006028 Bacteria 6486
126 Ga0070717_10036837 3300006028 Bacteria 3970
127 Ga0070717_10082823 3300006028 Bacteria 2697
128 Ga0070717_10261644 3300006028 Unclassified 1531
129 Ga0070716_100001343 3300006173 Bacteria 10884
130 Ga0070716_100011153 3300006173 Bacteria 4523
131 Ga0070716_100030550 3300006173 Bacteria 2924
132 Ga0070712_100007038 3300006175 Bacteria 7013
133 Ga0070712_100012947 3300006175 Bacteria 5316
134 Ga0070712_100017812 3300006175 Unclassified 4601
135 Ga0070712_100025444 3300006175 Bacteria 3934
136 Ga0097621_100109367 3300006237 Bacteria 2335
137 Ga0097621_100153771 3300006237 Bacteria 1974
138 Ga0097621_100285941 3300006237 Bacteria 1453
139 Ga0068871_100002621 3300006358 Bacteria 12279
140 Ga0068871_100036861 3300006358 Bacteria 3896
141 Ga0068871_100045291 3300006358 Unclassified 3540
142 Ga0075434_100002099 3300006871 Bacteria 17338
143 Ga0068865_100029822 3300006881 Unclassified 3623
144 Ga0075436_100049835 3300006914 Bacteria 2890
145 Ga0097620_100036159 3300006931 Bacteria 4957
146 Ga0097620_100091286 3300006931 Unclassified 3096
147 Ga0097620_100290708 3300006931 Bacteria 1727
148 Ga0075435_100209869 3300007076 Bacteria 1652
149 Ga0105240_10010692 3300009093 Bacteria 12879
150 Ga0105240_10148022 3300009093 Bacteria 2800
151 Ga0105247_10008203 3300009101 Bacteria 6374
152 Ga0105247_10024227 3300009101 Bacteria 3656
153 Ga0114129_10037877 3300009147 Bacteria 6805
154 Ga0105243_10093862 3300009148 Bacteria 2477
155 Ga0105241_10083056 3300009174 Unclassified 2512
156 Ga0105241_10404726 3300009174 Unclassified 1198
157 Ga0105241_10466697 3300009174 Unclassified 1119
158 Ga0105248_10048175 3300009177 Bacteria 4780
159 Ga0105248_10108029 3300009177 Bacteria 3138
160 Ga0105248_10316924 3300009177 Unclassified 1756
161 Ga0105237_10145651 3300009545 Bacteria 2363
162 Ga0105237_10319036 3300009545 Bacteria 1557
163 Ga0105238_10580191 3300009551 Unclassified 1128
164 Ga0105239_10033503 3300010375 Bacteria 5641
165 Ga0105239_10046947 3300010375 Unclassified 4731
166 Ga0105239_10259448 3300010375 Bacteria 1953
167 Ga0105239_10303478 3300010375 Bacteria 1798
168 Ga0105239_10320278 3300010375 Bacteria 1748
169 Ga0105246_10004098 3300011119 Bacteria 8846
170 Ga0157373_10026152 3300013100 Unclassified 4218
171 Ga0157373_10158189 3300013100 Bacteria 1594
172 Ga0157373_10218870 3300013100 Bacteria 1343
173 Ga0157371_10073739 3300013102 Unclassified 2417
174 Ga0157369_10000176 3300013105 Bacteria 89387
175 Ga0157369_10017307 3300013105 Bacteria 8102
176 Ga0157369_10037422 3300013105 Bacteria 5312
177 Ga0157369_10068426 3300013105 Unclassified 3815
178 Ga0157374_10010153 3300013296 Bacteria 8090
179 Ga0157374_10022297 3300013296 Bacteria 5648
180 Ga0157374_10046801 3300013296 Unclassified 4007
181 Ga0157374_10108774 3300013296 Unclassified 2665
182 Ga0157378_10000636 3300013297 Bacteria 32952
183 Ga0157378_10074152 3300013297 Bacteria 3061
184 Ga0157378_10233475 3300013297 Bacteria 1754
185 Ga0163162_10001366 3300013306 Bacteria 22706
186 Ga0157372_10014616 3300013307 Bacteria 8397
187 Ga0157372_10036328 3300013307 Bacteria 5430
188 Ga0157372_10061081 3300013307 Bacteria 4218
189 Ga0157372_10074309 3300013307 Unclassified 3833
190 Ga0157372_10087878 3300013307 Bacteria 3528
191 Ga0157372_10105130 3300013307 Unclassified 3229
192 Ga0157372_10159196 3300013307 Bacteria 2609
193 Ga0157372_10250234 3300013307 Unclassified 2057
194 Ga0157375_10093650 3300013308 Bacteria 3071
195 Ga0157375_10111112 3300013308 Unclassified 2839
196 Ga0157375_10409459 3300013308 Bacteria 1522
197 Ga0163163_10557714 3300014325 Bacteria 1208
198 Ga0157380_10052965 3300014326 Unclassified 3215
199 Ga0182008_10005315 3300014497 Bacteria 7353
200 Ga0157377_10003260 3300014745 Bacteria 7325
201 Ga0157379_10008551 3300014968 Bacteria 8906
202 Ga0157379_10032084 3300014968 Bacteria 4681
203 Ga0157379_10314738 3300014968 Bacteria 1428
204 Ga0157376_10026363 3300014969 Bacteria 4592
205 Ga0157376_10034281 3300014969 Bacteria 4098
206 Ga0157376_10286537 3300014969 Bacteria 1553
207 Ga0157376_10492555 3300014969 Unclassified 1203
208 Ga0182006_1042915 3300015261 Unclassified 1770
209 Ga0182007_10018136 3300015262 Bacteria 2556
210 Ga0224570_101037 3300022730 Bacteria 2188
211 Ga0224569_100121 3300022732 Bacteria 5618
212 Ga0224569_101894 3300022732 Unclassified 1729
213 Ga0224571_100002 3300022734 Bacteria 8449
214 Ga0224572_1005301 3300024225 Bacteria 2293
215 Ga0228598_1000066 3300024227 Bacteria 15341
216 Ga0228598_1002693 3300024227 Bacteria 3848
217 Ga0207697_10001690 3300025315 Bacteria 11898
218 Ga0207692_10004498 3300025898 Bacteria 5525
219 Ga0207688_10037474 3300025901 Bacteria 2689
220 Ga0207680_10015403 3300025903 Bacteria 3989
221 Ga0207647_10011970 3300025904 Bacteria 6056
222 Ga0207647_10044026 3300025904 Unclassified 2791
223 Ga0207685_10002877 3300025905 Unclassified 4057
224 Ga0207685_10060159 3300025905 Unclassified 1501
225 Ga0207699_10009381 3300025906 Bacteria 4870
226 Ga0207699_10011162 3300025906 Bacteria 4527
227 Ga0207699_10019424 3300025906 Bacteria 3624
228 Ga0207699_10076181 3300025906 Bacteria 2066
229 Ga0207699_10162828 3300025906 Bacteria 1486
230 Ga0207645_10008626 3300025907 Bacteria 7096
231 Ga0207643_10002048 3300025908 Bacteria 11120
232 Ga0207643_10182304 3300025908 Bacteria 1271
233 Ga0207705_10277773 3300025909 Unclassified 1282
234 Ga0207684_10002012 3300025910 Bacteria 20947
235 Ga0207684_10006515 3300025910 Bacteria 10639
236 Ga0207684_10105653 3300025910 Bacteria 2409
237 Ga0207684_10243926 3300025910 Bacteria 1550
238 Ga0207654_10145310 3300025911 Unclassified 1517
239 Ga0207707_10006887 3300025912 Bacteria 9913
240 Ga0207707_10021588 3300025912 Bacteria 5626
241 Ga0207695_10027278 3300025913 Bacteria 6362
242 Ga0207695_10027761 3300025913 Bacteria 6297
243 Ga0207695_10039608 3300025913 Bacteria 5063
244 Ga0207695_10057796 3300025913 Bacteria 4029
245 Ga0207695_10096437 3300025913 Unclassified 2959
246 Ga0207671_10368450 3300025914 Bacteria 1141
247 Ga0207693_10000020 3300025915 Bacteria 132847
248 Ga0207693_10004517 3300025915 Bacteria 11764
249 Ga0207693_10011476 3300025915 Bacteria 7166
250 Ga0207693_10029975 3300025915 Bacteria 4294
251 Ga0207663_10003063 3300025916 Bacteria 8100
252 Ga0207663_10005788 3300025916 Bacteria 6262
253 Ga0207663_10033627 3300025916 Unclassified 3057
254 Ga0207663_10066565 3300025916 Unclassified 2306
255 Ga0207663_10163308 3300025916 Bacteria 1575
256 Ga0207663_10322062 3300025916 Bacteria 1162
257 Ga0207660_10089692 3300025917 Bacteria 2276
258 Ga0207662_10047497 3300025918 Unclassified 2543
259 Ga0207657_10026130 3300025919 Bacteria 5371
260 Ga0207657_10039814 3300025919 Unclassified 4172
261 Ga0207649_10002392 3300025920 Bacteria 10523
262 Ga0207649_10019017 3300025920 Bacteria 3921
263 Ga0207652_10277379 3300025921 Bacteria 1512
264 Ga0207646_10000415 3300025922 Bacteria 57158
265 Ga0207646_10000438 3300025922 Bacteria 55782
266 Ga0207646_10083632 3300025922 Bacteria 2855
267 Ga0207646_10121222 3300025922 Bacteria 2349
268 Ga0207646_10168035 3300025922 Bacteria 1980
269 Ga0207646_10235489 3300025922 Bacteria 1654
270 Ga0207681_10242742 3300025923 Bacteria 1403
271 Ga0207694_10189708 3300025924 Bacteria 1669
272 Ga0207650_10000045 3300025925 Bacteria 181507
273 Ga0207687_10005307 3300025927 Bacteria 8531
274 Ga0207687_10014884 3300025927 Bacteria 5095
275 Ga0207700_10006742 3300025928 Bacteria 6974
276 Ga0207700_10013448 3300025928 Bacteria 5326
277 Ga0207700_10025497 3300025928 Bacteria 4106
278 Ga0207700_10031620 3300025928 Unclassified 3763
279 Ga0207700_10067135 3300025928 Bacteria 2744
280 Ga0207700_10129258 3300025928 Bacteria 2060
281 Ga0207664_10000487 3300025929 Bacteria 28268
282 Ga0207664_10036365 3300025929 Unclassified 3806
283 Ga0207664_10096874 3300025929 Bacteria 2429
284 Ga0207664_10278252 3300025929 Bacteria 1468
285 Ga0207664_10320097 3300025929 Unclassified 1368
286 Ga0207690_10034026 3300025932 Bacteria 3280
287 Ga0207690_10138165 3300025932 Bacteria 1792
288 Ga0207706_10001607 3300025933 Bacteria 22422
289 Ga0207706_10004877 3300025933 Bacteria 12548
290 Ga0207706_10137962 3300025933 Unclassified 2145
291 Ga0207686_10064270 3300025934 Bacteria 2336
292 Ga0207670_10061529 3300025936 Bacteria 2562
293 Ga0207704_10123289 3300025938 Bacteria 1778
294 Ga0207704_10268398 3300025938 Unclassified 1290
295 Ga0207665_10003560 3300025939 Bacteria 10410
296 Ga0207665_10008810 3300025939 Bacteria 6633
297 Ga0207665_10022036 3300025939 Bacteria 4189
298 Ga0207665_10112214 3300025939 Bacteria 1917
299 Ga0207665_10170366 3300025939 Bacteria 1572
300 Ga0207691_10013760 3300025940 Bacteria 7731
301 Ga0207711_10029305 3300025941 Bacteria 4641
302 Ga0207711_10046896 3300025941 Unclassified 3692
303 Ga0207689_10011111 3300025942 Bacteria 7731
304 Ga0207689_10049343 3300025942 Unclassified 3472
305 Ga0207661_10019936 3300025944 Bacteria 5005
306 Ga0207661_10258309 3300025944 Bacteria 1551
307 Ga0207679_10001970 3300025945 Bacteria 12727
308 Ga0207679_10310440 3300025945 Bacteria 1362
309 Ga0207667_10032695 3300025949 Bacteria 5601
310 Ga0207651_10021367 3300025960 Bacteria 3932
311 Ga0207640_10007888 3300025981 Bacteria 5875
312 Ga0207640_10045790 3300025981 Unclassified 2811
313 Ga0207640_10091288 3300025981 Bacteria 2110
314 Ga0207658_10034776 3300025986 Unclassified 3603
315 Ga0207703_10035939 3300026035 Unclassified 3940
316 Ga0207703_10212281 3300026035 Unclassified 1726
317 Ga0207639_10055658 3300026041 Bacteria 3028
318 Ga0207639_10312148 3300026041 Bacteria 1393
319 Ga0207678_10000355 3300026067 Bacteria 41678
320 Ga0207678_10029213 3300026067 Bacteria 4811
321 Ga0207708_10139817 3300026075 Bacteria 1898
322 Ga0207702_10085047 3300026078 Unclassified 2756
323 Ga0207641_10000075 3300026088 Bacteria 145149
324 Ga0207648_10001641 3300026089 Bacteria 24523
325 Ga0207676_10000743 3300026095 Bacteria 25540
326 Ga0207674_10002697 3300026116 Bacteria 22162
327 Ga0207674_10143319 3300026116 Bacteria 2348
328 Ga0207683_10004251 3300026121 Bacteria 12360
329 Ga0207698_10089099 3300026142 Bacteria 2518
330 Ga0268266_10022906 3300028379 Bacteria 5314
331 Ga0268266_10158564 3300028379 Unclassified 2046
332 Ga0268265_10005870 3300028380 Bacteria 8368
333 Ga0268264_10134856 3300028381 Unclassified 2193
334 Ga0268264_10247614 3300028381 Bacteria 1654
335 Ga0268264_10381788 3300028381 Bacteria 1349
336 Ga0265338_10017868 3300028800 Bacteria 7620
337 Ga0265762_1000450 3300030760 Bacteria 7116
338 Ga0265762_1000977 3300030760 Bacteria 5126
339 Ga0265762_1001918 3300030760 Unclassified 3773
340 Ga0265760_10001458 3300031090 Bacteria 6958
341 Ga0265760_10003041 3300031090 Bacteria 4897
342 Ga0265325_10024816 3300031241 Bacteria 3258
343 Ga0265325_10065291 3300031241 Bacteria 1838
344 Ga0265340_10005877 3300031247 Bacteria 6787
345 Ga0265340_10037147 3300031247 Bacteria 2413
346 Ga0265339_10127549 3300031249 Unclassified 1303
347 Ga0265314_10004812 3300031711 Bacteria 12356
348 Ga0265314_10018305 3300031711 Bacteria 5464
349 Ga0316212_1004881 3300033547 Bacteria 1947
350 Ga0373958_0026100 3300034819 Bacteria 1117
351 Ga0373944_0051426 3300035089 Bacteria 1299
352 Ga0373932_0011582 3300035112 Bacteria 2158
353 Ga0373936_0001467 3300035113 Bacteria 8568
354 Ga0373936_0007859 3300035113 Bacteria 4006
355 Ga0373945_0006767 3300035116 Unclassified 3705
356 Ga0373945_0032908 3300035116 Bacteria 1839
357 Ga0373954_0009473 3300035118 Bacteria 4284
358 Ga0373943_0001357 3300035170 Bacteria 11049
359 Ga0373946_0003405 3300035171 Bacteria 5642
360 Ga0373955_0125608 3300035172 Bacteria 1494
361 Ga0373924_0010420 3300035410 Bacteria 3425
362 Ga0373931_0006868 3300035691 Bacteria 5350
363 Ga0373935_0009281 3300035692 Bacteria 5889
364 Ga0373927_0004852 3300035695 Bacteria 9354
365 Ga0373927_0049775 3300035695 Bacteria 2709
366 Ga0373947_0063536 3300035725 Bacteria 2249
367 Ga0373947_0097253 3300035725 Bacteria 1845
368 Ga0373937_0177633 3300036401 Unclassified 1999
369 Ga0373925_0004010 3300037068 Bacteria 11203
370 Ga0373925_0106727 3300037068 Bacteria 2159
371 Ga0373925_0121000 3300037068 Bacteria 2032
372 Ga0395905_0052397 3300037471 Bacteria 3820
373 Ga0395905_0061691 3300037471 Bacteria 3507
374 Ga0395905_0095654 3300037471 Bacteria 2788
375 Ga0395905_0232354 3300037471 Bacteria 1724
376 Ga0436362_0147413 3300039453 Bacteria 5519
377 Ga0466963_0072846 3300044694 Bacteria 2315
378 Ga0451576_0046747 3300045051 Bacteria 4556
379 Ga0451576_0067869 3300045051 Bacteria 3712
380 Ga0451576_0608155 3300045051 Bacteria 1149
381 Ga0466967_0017074 3300045976 Bacteria 5747
382 Ga0466967_0211107 3300045976 Bacteria 1841
383 Ga0495629_0066836 3300046459 Bacteria 2509
384 Ga0495580_0004129 3300046472 Bacteria 12243
385 Ga0495580_0005047 3300046472 Bacteria 10999
386 Ga0495580_0018033 3300046472 Bacteria 5263
387 Ga0495580_0019428 3300046472 Bacteria 5048
388 Ga0495580_0029364 3300046472 Unclassified 3991
389 Ga0495580_0186637 3300046472 Unclassified 1431
390 Ga0495582_0004729 3300046473 Bacteria 7652
391 Ga0495664_0022392 3300046477 Bacteria 3662
392 Ga0495628_0182107 3300046516 Bacteria 1589
393 Ga0495630_0095899 3300046517 Bacteria 2243
394 Ga0495634_0171141 3300046642 Bacteria 1365
395 Ga0495635_0177115 3300046663 Unclassified 1450
396 Ga0495588_0174297 3300046674 Bacteria 1137
397 Ga0495657_0177056 3300046675 Bacteria 1311
398 Ga0495669_0013617 3300046684 Bacteria 3470
399 Ga0495624_0063576 3300046690 Bacteria 2307
400 Ga0495674_0028977 3300047319 Bacteria 5043
401 Ga0495674_0071705 3300047319 Bacteria 2989
402 Ga0495602_0060847 3300048088 Bacteria 3288
403 Ga0496100_0182326 3300048903 Unclassified 1519
404 Ga0496100_0252699 3300048903 Unclassified 1304
405 Ga0496101_0083341 3300048904 Bacteria 2367
406 Ga0496101_0176590 3300048904 Bacteria 1643
407 Ga0496102_0004026 3300048905 Bacteria 12448
408 Ga0496102_0088576 3300048905 Bacteria 2862
409 Ga0496103_0055153 3300048906 Bacteria 2464
410 Ga0496104_0149495 3300048907 Bacteria 2243
411 Ga0496105_0073777 3300048908 Bacteria 2819
412 Ga0496105_0094380 3300048908 Bacteria 2471
413 Ga0496105_0196874 3300048908 Unclassified 1646
414 Ga0496106_0108075 3300048909 Bacteria 2164
415 Ga0496106_0278384 3300048909 Unclassified 1340
416 Ga0496109_0002050 3300048912 Bacteria 16708
417 Ga0496109_0433021 3300048912 Bacteria 1242
418 Ga0496110_0059528 3300048913 Unclassified 3367
419 Ga0496111_0195241 3300048914 Bacteria 1504
420 Ga0496112_0000880 3300048915 Bacteria 21562
421 Ga0496112_0056737 3300048915 Unclassified 3855
422 Ga0496112_0119369 3300048915 Bacteria 2607
423 Ga0496113_0000158 3300048916 Bacteria 29931
424 Ga0496113_0166749 3300048916 Unclassified 1743
425 Ga0496115_0040776 3300048918 Bacteria 3692
426 Ga0501083_0105371 3300049744 Bacteria 1857
427 nmdc:mga0rr50_11593_c1 3300050513 Bacteria 5652
428 Ga0495601_0041355 3300053077 Bacteria 2889
429 Ga0501084_0390473 3300054114 Bacteria 1176
430 Ga0207702_10009954
431 JGI24751J29686_10006630
432 Ga0065715_10092480
433 Ga0070676_10004962
434 Ga0070683_100027059
435 Ga0070690_100018190
436 Ga0070670_100036996
437 Ga0068869_100018132
438 Ga0068869_100030621
439 Ga0070666_10009972
440 Ga0070666_10057130
441 Ga0070680_100068094
442 Ga0070682_100026200
443 Ga0070682_100104600
444 Ga0068868_100064877
445 Ga0068868_100126664
446 Ga0068868_100138981
447 Ga0070660_100029695
448 Ga0070689_100013854
449 Ga0070689_100186789
450 Ga0070687_100064292
451 Ga0070661_100016349
452 Ga0070661_100017890
453 Ga0070669_100018478
454 Ga0070669_100066483
455 Ga0070673_100087732
456 Ga0070673_100398433
457 Ga0070659_100025017
458 Ga0070709_10021439
459 Ga0070709_10022328
460 Ga0070709_10028918
461 Ga0070709_10207412
462 Ga0070714_100000536
463 Ga0070714_100041539
464 Ga0070714_100065814
465 Ga0070714_100297131
466 Ga0070714_100322861
467 Ga0070713_100001327
468 Ga0070713_100004472
469 Ga0070713_100010860
470 Ga0070713_100017360
471 Ga0070713_100078040
472 Ga0070713_100092584
473 Ga0070713_100305064
474 Ga0070710_10007418
475 Ga0070710_10036035
476 Ga0070710_10069529
477 Ga0070711_100004864
478 Ga0070711_100005596
479 Ga0070711_100008072
480 Ga0070711_100009558
481 Ga0070711_100131121
482 Ga0070711_100248587
483 Ga0070694_100116413
484 Ga0070694_100287827
485 Ga0070708_100000659
486 Ga0070708_100020682
487 Ga0070708_100024681
488 Ga0070708_100025049
489 Ga0070708_100025323
490 Ga0070708_100029390
491 Ga0070708_100082734
492 Ga0070708_100196775
493 Ga0070708_100326711
494 Ga0070663_100038833
495 Ga0070678_100005729
496 Ga0070678_100256136
497 Ga0070662_100225055
498 Ga0070681_10012236
499 Ga0070681_10046368
500 Ga0068867_100011344
501 Ga0070685_10010689
502 Ga0070706_100000501
503 Ga0070706_100132338
504 Ga0070707_100012023
505 Ga0070707_100042192
506 Ga0070707_100083146
507 Ga0070698_100001838
508 Ga0070698_100021582
509 Ga0070699_100001042
510 Ga0070699_100083543
511 Ga0070699_100149301
512 Ga0070679_100095512
513 Ga0070679_100232317
514 Ga0070684_100020077
515 Ga0070684_100067178
516 Ga0070697_100000617
517 Ga0070697_100004883
518 Ga0070697_100008473
519 Ga0070697_100019760
520 Ga0070697_100025659
521 Ga0070697_100075291
522 Ga0070697_100228876
523 Ga0068853_100250011
524 Ga0068853_100303412
525 Ga0070696_100098245
526 Ga0070693_100199519
527 Ga0070665_100290613
528 Ga0068855_100064938
529 Ga0068855_100100718
530 Ga0068855_100162278
531 Ga0070664_100004025
532 Ga0070664_100025907
533 Ga0068857_100013737
534 Ga0068857_100056683
535 Ga0068854_100044780
536 Ga0068854_100066274
537 Ga0068854_100196214
538 Ga0068856_100025236
539 Ga0068852_100031695
540 Ga0068852_100234262
541 Ga0068859_100036160
542 Ga0068859_100091286
543 Ga0068859_100290696
544 Ga0068864_100349962
545 Ga0068866_10001080
546 Ga0068851_10001498
547 Ga0068870_10001286
548 Ga0068863_100037045
549 Ga0068858_100033065
550 Ga0068858_100076697
551 Ga0068860_100041738
552 Ga0068862_100036843
553 Ga0070717_10003108
554 Ga0070717_10012454
555 Ga0070717_10036837
556 Ga0070717_10082823
557 Ga0070717_10261644
558 Ga0070716_100001343
559 Ga0070716_100011153
560 Ga0070716_100030550
561 Ga0070712_100007038
562 Ga0070712_100012947
563 Ga0070712_100017812
564 Ga0070712_100025444
565 Ga0097621_100109367
566 Ga0097621_100153771
567 Ga0097621_100285941
568 Ga0068871_100002621
569 Ga0068871_100036861
570 Ga0068871_100045291
571 Ga0075434_100002099
572 Ga0068865_100029822
573 Ga0075436_100049835
574 Ga0097620_100036159
575 Ga0097620_100091286
576 Ga0097620_100290708
577 Ga0075435_100209869
578 Ga0105240_10010692
579 Ga0105240_10148022
580 Ga0105247_10008203
581 Ga0105247_10024227
582 Ga0114129_10037877
583 Ga0105243_10093862
584 Ga0105241_10083056
585 Ga0105241_10404726
586 Ga0105241_10466697
587 Ga0105248_10048175
588 Ga0105248_10108029
589 Ga0105248_10316924
590 Ga0105237_10145651
591 Ga0105237_10319036
592 Ga0105238_10580191
593 Ga0105239_10033503
594 Ga0105239_10046947
595 Ga0105239_10259448
596 Ga0105239_10303478
597 Ga0105239_10320278
598 Ga0105246_10004098
599 Ga0157373_10026152
600 Ga0157373_10158189
601 Ga0157373_10218870
602 Ga0157371_10073739
603 Ga0157369_10000176
604 Ga0157369_10017307
605 Ga0157369_10037422
606 Ga0157369_10068426
607 Ga0157374_10010153
608 Ga0157374_10022297
609 Ga0157374_10046801
610 Ga0157374_10108774
611 Ga0157378_10000636
612 Ga0157378_10074152
613 Ga0157378_10233475
614 Ga0163162_10001366
615 Ga0157372_10014616
616 Ga0157372_10036328
617 Ga0157372_10061081
618 Ga0157372_10074309
619 Ga0157372_10087878
620 Ga0157372_10105130
621 Ga0157372_10159196
622 Ga0157372_10250234
623 Ga0157375_10093650
624 Ga0157375_10111112
625 Ga0157375_10409459
626 Ga0163163_10557714
627 Ga0157380_10052965
628 Ga0182008_10005315
629 Ga0157377_10003260
630 Ga0157379_10008551
631 Ga0157379_10032084
632 Ga0157379_10314738
633 Ga0157376_10026363
634 Ga0157376_10034281
635 Ga0157376_10286537
636 Ga0157376_10492555
637 Ga0182006_1042915
638 Ga0182007_10018136
639 Ga0224570_101037
640 Ga0224569_100121
641 Ga0224569_101894
642 Ga0224571_100002
643 Ga0224572_1005301
644 Ga0228598_1000066
645 Ga0228598_1002693
646 Ga0207697_10001690
647 Ga0207692_10004498
648 Ga0207688_10037474
649 Ga0207680_10015403
650 Ga0207647_10011970
651 Ga0207647_10044026
652 Ga0207685_10002877
653 Ga0207685_10060159
654 Ga0207699_10009381
655 Ga0207699_10011162
656 Ga0207699_10019424
657 Ga0207699_10076181
658 Ga0207699_10162828
659 Ga0207645_10008626
660 Ga0207643_10002048
661 Ga0207643_10182304
662 Ga0207705_10277773
663 Ga0207684_10002012
664 Ga0207684_10006515
665 Ga0207684_10105653
666 Ga0207684_10243926
667 Ga0207654_10145310
668 Ga0207707_10006887
669 Ga0207707_10021588
670 Ga0207695_10027278
671 Ga0207695_10027761
672 Ga0207695_10039608
673 Ga0207695_10057796
674 Ga0207695_10096437
675 Ga0207671_10368450
676 Ga0207693_10000020
677 Ga0207693_10004517
678 Ga0207693_10011476
679 Ga0207693_10029975
680 Ga0207663_10003063
681 Ga0207663_10005788
682 Ga0207663_10033627
683 Ga0207663_10066565
684 Ga0207663_10163308
685 Ga0207663_10322062
686 Ga0207660_10089692
687 Ga0207662_10047497
688 Ga0207657_10026130
689 Ga0207657_10039814
690 Ga0207649_10002392
691 Ga0207649_10019017
692 Ga0207652_10277379
693 Ga0207646_10000415
694 Ga0207646_10000438
695 Ga0207646_10083632
696 Ga0207646_10121222
697 Ga0207646_10168035
698 Ga0207646_10235489
699 Ga0207681_10242742
700 Ga0207694_10189708
701 Ga0207650_10000045
702 Ga0207687_10005307
703 Ga0207687_10014884
704 Ga0207700_10006742
705 Ga0207700_10013448
706 Ga0207700_10025497
707 Ga0207700_10031620
708 Ga0207700_10067135
709 Ga0207700_10129258
710 Ga0207664_10000487
711 Ga0207664_10036365
712 Ga0207664_10096874
713 Ga0207664_10278252
714 Ga0207664_10320097
715 Ga0207690_10034026
716 Ga0207690_10138165
717 Ga0207706_10001607
718 Ga0207706_10004877
719 Ga0207706_10137962
720 Ga0207686_10064270
721 Ga0207670_10061529
722 Ga0207704_10123289
723 Ga0207704_10268398
724 Ga0207665_10003560
725 Ga0207665_10008810
726 Ga0207665_10022036
727 Ga0207665_10112214
728 Ga0207665_10170366
729 Ga0207691_10013760
730 Ga0207711_10029305
731 Ga0207711_10046896
732 Ga0207689_10011111
733 Ga0207689_10049343
734 Ga0207661_10019936
735 Ga0207661_10258309
736 Ga0207679_10001970
737 Ga0207679_10310440
738 Ga0207667_10032695
739 Ga0207651_10021367
740 Ga0207640_10007888
741 Ga0207640_10045790
742 Ga0207640_10091288
743 Ga0207658_10034776
744 Ga0207703_10035939
745 Ga0207703_10212281
746 Ga0207639_10055658
747 Ga0207639_10312148
748 Ga0207678_10000355
749 Ga0207678_10029213
750 Ga0207708_10139817
751 Ga0207702_10085047
752 Ga0207641_10000075
753 Ga0207648_10001641
754 Ga0207676_10000743
755 Ga0207674_10002697
756 Ga0207674_10143319
757 Ga0207683_10004251
758 Ga0207698_10089099
759 Ga0268266_10022906
760 Ga0268266_10158564
761 Ga0268265_10005870
762 Ga0268264_10134856
763 Ga0268264_10247614
764 Ga0268264_10381788
765 Ga0265338_10017868
766 Ga0265762_1000450
767 Ga0265762_1000977
768 Ga0265762_1001918
769 Ga0265760_10001458
770 Ga0265760_10003041
771 Ga0265325_10024816
772 Ga0265325_10065291
773 Ga0265340_10005877
774 Ga0265340_10037147
775 Ga0265339_10127549
776 Ga0265314_10004812
777 Ga0265314_10018305
778 Ga0316212_1004881
779 Ga0373958_0026100
780 Ga0373944_0051426
781 Ga0373932_0011582
782 Ga0373936_0001467
783 Ga0373936_0007859
784 Ga0373945_0006767
785 Ga0373945_0032908
786 Ga0373954_0009473
787 Ga0373943_0001357
788 Ga0373946_0003405
789 Ga0373955_0125608
790 Ga0373924_0010420
791 Ga0373931_0006868
792 Ga0373935_0009281
793 Ga0373927_0004852
794 Ga0373927_0049775
795 Ga0373947_0063536
796 Ga0373947_0097253
797 Ga0373937_0177633
798 Ga0373925_0004010
799 Ga0373925_0106727
800 Ga0373925_0121000
801 Ga0395905_0052397
802 Ga0395905_0061691
803 Ga0395905_0095654
804 Ga0395905_0232354
805 Ga0436362_0147413
806 Ga0466963_0072846
807 Ga0451576_0046747
808 Ga0451576_0067869
809 Ga0451576_0608155
810 Ga0466967_0017074
811 Ga0466967_0211107
812 Ga0495629_0066836
813 Ga0495580_0004129
814 Ga0495580_0005047
815 Ga0495580_0018033
816 Ga0495580_0019428
817 Ga0495580_0029364
818 Ga0495580_0186637
819 Ga0495582_0004729
820 Ga0495664_0022392
821 Ga0495628_0182107
822 Ga0495630_0095899
823 Ga0495634_0171141
824 Ga0495635_0177115
825 Ga0495588_0174297
826 Ga0495657_0177056
827 Ga0495669_0013617
828 Ga0495624_0063576
829 Ga0495674_0028977
830 Ga0495674_0071705
831 Ga0495602_0060847
832 Ga0496100_0182326
833 Ga0496100_0252699
834 Ga0496101_0083341
835 Ga0496101_0176590
836 Ga0496102_0004026
837 Ga0496102_0088576
838 Ga0496103_0055153
839 Ga0496104_0149495
840 Ga0496105_0073777
841 Ga0496105_0094380
842 Ga0496105_0196874
843 Ga0496106_0108075
844 Ga0496106_0278384
845 Ga0496109_0002050
846 Ga0496109_0433021
847 Ga0496110_0059528
848 Ga0496111_0195241
849 Ga0496112_0000880
850 Ga0496112_0056737
851 Ga0496112_0119369
852 Ga0496113_0000158
853 Ga0496113_0166749
854 Ga0496115_0040776
855 Ga0501083_0105371
856 nmdc:mga0rr50_11593_c1
857 Ga0495601_0041355
858 Ga0501084_0390473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

125

307

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v1q-assembly1.cif.gz_A crystal structure of streptococcus suis suib 0.7662 60 307
4fhg-assembly1.cif.gz_A spore photoproduct lyase c140s mutant 0.7545 46 307
4rh1-assembly1.cif.gz_A spore photoproduct lyase c140a/s76c mutant with bound adomet and dinucleoside spore photoproduct 0.7484 37 307
4fhf-assembly1.cif.gz_A spore photoproduct lyase c140a mutant with dinucleoside spore photoproduct 0.7478 37 307
5v1t-assembly1.cif.gz_A crystal structure of streptococcus suis suib bound to precursor peptide suia 0.7314 60 305
ID Description Score Start End Superfamily
af_P9WL79_106_315_3.80.30.30 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.9471 99 305 3.80.30.30
af_P9WL79_106_315_3.80.30.30 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.9297 99 305 3.80.30.30
af_Q58096_62_257_3.80.30.30 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.8293 99 305 3.80.30.30
af_Q58096_62_257_3.80.30.30 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme; 0.791 99 305 3.80.30.30
af_Q4CUJ9_220_394_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.7387 159 256 3.30.750.200
ID Description Score Start End GO Terms
AF-A0A2V7V4T4-F1-model_v4 Radical SAM protein 0.9856 133 242 GO:0046872
GO:0051536
AF-A0A2V9U6V4-F1-model_v4 Radical SAM protein 0.975 122 316 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V9LTQ7-F1-model_v4 Radical SAM protein 0.9681 100 313 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V8BQD0-F1-model_v4 Radical SAM protein 0.9673 174 307 GO:0046872
GO:0051536
AF-A0A534ZWF8-F1-model_v4 Radical SAM protein 0.9639 115 305 GO:0003824
GO:0046872
GO:0051536

Map