F441284

General Info

Members Datasets Scaffolds Average Seq Length
426 247 852 105

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0005540|Ga0495672_0005540_1903_2226
Length 107
Sequence VDSNALNRPLRVARYIATKASDDDRGPLVVMHPSDARARLLTDGELAWVYGPRRHDLATVRIDAEDSLKLGDVVLRDIAGASPSEIVRVVKPDLDTRGRRPPGKALA

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
207 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 24.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0005540 3300047320 Bacteria 9991
2 JGI25406J46586_10045801 3300003203 Unclassified 1503
3 Ga0058863_11270231 3300004799 Unclassified 1156
4 Ga0070683_100023422 3300005329 Bacteria 5523
5 Ga0070683_100043001 3300005329 Bacteria 4162
6 Ga0070683_100309839 3300005329 Bacteria 1502
7 Ga0070683_100741546 3300005329 Unclassified 941
8 Ga0070690_100073313 3300005330 Bacteria 2227
9 Ga0070690_101229190 3300005330 Unclassified 598
10 Ga0070670_100024323 3300005331 Bacteria 5209
11 Ga0070666_10270033 3300005335 Bacteria 1207
12 Ga0070680_100005312 3300005336 Bacteria 9749
13 Ga0070680_100008289 3300005336 Bacteria 7951
14 Ga0070680_100041878 3300005336 Unclassified 3714
15 Ga0070682_100104955 3300005337 Bacteria 1872
16 Ga0068868_100037872 3300005338 Bacteria 3741
17 Ga0070660_100365623 3300005339 Bacteria 1189
18 Ga0070689_100184967 3300005340 Bacteria 1694
19 Ga0070689_100299488 3300005340 Bacteria 1338
20 Ga0070689_101331056 3300005340 Unclassified 647
21 Ga0070691_10998209 3300005341 Unclassified 522
22 Ga0070687_100173152 3300005343 Unclassified 1286
23 Ga0070687_100646531 3300005343 Bacteria 732
24 Ga0070661_100003348 3300005344 Bacteria 11053
25 Ga0070661_100465594 3300005344 Bacteria 1007
26 Ga0070692_10009656 3300005345 Bacteria 4362
27 Ga0070692_10764329 3300005345 Bacteria 656
28 Ga0070668_101252106 3300005347 Unclassified 673
29 Ga0070668_101975106 3300005347 Unclassified 538
30 Ga0070669_100159028 3300005353 Unclassified 1754
31 Ga0070669_100549072 3300005353 Bacteria 963
32 Ga0070675_100008403 3300005354 Bacteria 8010
33 Ga0070675_100395968 3300005354 Bacteria 1231
34 Ga0070675_100950089 3300005354 Bacteria 788
35 Ga0070671_100261222 3300005355 Bacteria 1472
36 Ga0070674_100482607 3300005356 Bacteria 1029
37 Ga0070673_100085150 3300005364 Bacteria 2572
38 Ga0070673_100148653 3300005364 Bacteria 1982
39 Ga0070688_100207975 3300005365 Unclassified 1372
40 Ga0070688_101287909 3300005365 Unclassified 590
41 Ga0070659_100021049 3300005366 Bacteria 4961
42 Ga0070667_100182548 3300005367 Bacteria 1856
43 Ga0070667_100207860 3300005367 Unclassified 1739
44 Ga0070709_10679300 3300005434 Unclassified 799
45 Ga0070714_100097809 3300005435 Unclassified 2581
46 Ga0070714_100574636 3300005435 Bacteria 1081
47 Ga0070713_100004668 3300005436 Bacteria 9248
48 Ga0070711_100403382 3300005439 Bacteria 1110
49 Ga0070700_100168148 3300005441 Unclassified 1516
50 Ga0070694_100286727 3300005444 Bacteria 1257
51 Ga0070708_100000916 3300005445 Bacteria 22331
52 Ga0070663_100100935 3300005455 Unclassified 2153
53 Ga0070678_100401687 3300005456 Bacteria 1191
54 Ga0070678_100597778 3300005456 Unclassified 985
55 Ga0070662_100073893 3300005457 Unclassified 2520
56 Ga0070681_10003086 3300005458 Bacteria 15466
57 Ga0070681_10016204 3300005458 Bacteria 7432
58 Ga0070681_10263034 3300005458 Unclassified 1637
59 Ga0070685_10369490 3300005466 Bacteria 985
60 Ga0070685_10725689 3300005466 Unclassified 727
61 Ga0070707_100126466 3300005468 Bacteria 2484
62 Ga0070707_100707681 3300005468 Bacteria 970
63 Ga0070707_100918110 3300005468 Unclassified 840
64 Ga0070698_100430528 3300005471 Unclassified 1254
65 Ga0070679_100002281 3300005530 Bacteria 17341
66 Ga0070679_100012580 3300005530 Bacteria 8091
67 Ga0070679_100025456 3300005530 Bacteria 5806
68 Ga0070679_100098149 3300005530 Bacteria 2917
69 Ga0070679_100660209 3300005530 Bacteria 988
70 Ga0070684_100016271 3300005535 Bacteria 6076
71 Ga0070684_100089373 3300005535 Bacteria 2738
72 Ga0070684_100090344 3300005535 Unclassified 2723
73 Ga0070684_100182690 3300005535 Bacteria 1907
74 Ga0070684_100403248 3300005535 Bacteria 1261
75 Ga0070684_100555165 3300005535 Bacteria 1066
76 Ga0070672_100153017 3300005543 Bacteria 1909
77 Ga0070672_100239062 3300005543 Unclassified 1527
78 Ga0070672_100544762 3300005543 Unclassified 1007
79 Ga0070686_100658766 3300005544 Unclassified 831
80 Ga0070695_100111222 3300005545 Bacteria 1859
81 Ga0070695_100321606 3300005545 Bacteria 1150
82 Ga0070695_101124401 3300005545 Unclassified 644
83 Ga0070696_100003509 3300005546 Bacteria 10425
84 Ga0070693_100034588 3300005547 Bacteria 2796
85 Ga0070693_100966879 3300005547 Bacteria 642
86 Ga0068855_100036520 3300005563 Bacteria 5848
87 Ga0068855_100098514 3300005563 Bacteria 3368
88 Ga0068855_100152953 3300005563 Bacteria 2623
89 Ga0070664_100373284 3300005564 Bacteria 1301
90 Ga0068857_100006677 3300005577 Bacteria 9917
91 Ga0068854_100521999 3300005578 Bacteria 1003
92 Ga0068856_100016568 3300005614 Bacteria 7133
93 Ga0068856_100114473 3300005614 Bacteria 2696
94 Ga0068856_100726231 3300005614 Bacteria 1013
95 Ga0070702_100000983 3300005615 Bacteria 11242
96 Ga0070702_100539229 3300005615 Unclassified 864
97 Ga0068852_101696394 3300005616 Bacteria 654
98 Ga0068859_100018750 3300005617 Bacteria 6952
99 Ga0068859_100049149 3300005617 Bacteria 4236
100 Ga0068859_102402534 3300005617 Unclassified 581
101 Ga0068864_100011327 3300005618 Bacteria 7370
102 Ga0068864_100199977 3300005618 Bacteria 1835
103 Ga0068864_100448505 3300005618 Bacteria 1233
104 Ga0068864_100928673 3300005618 Bacteria 860
105 Ga0068866_10533912 3300005718 Bacteria 782
106 Ga0068870_10038065 3300005840 Unclassified 2482
107 Ga0068870_10263635 3300005840 Bacteria 1073
108 Ga0068870_10888891 3300005840 Unclassified 628
109 Ga0068863_100043891 3300005841 Bacteria 4244
110 Ga0068863_100363254 3300005841 Bacteria 1412
111 Ga0068858_100085164 3300005842 Bacteria 2940
112 Ga0068858_101132982 3300005842 Bacteria 768
113 Ga0068860_100003352 3300005843 Bacteria 16495
114 Ga0068862_100149817 3300005844 Unclassified 2076
115 Ga0081455_10378715 3300005937 Bacteria 989
116 Ga0081539_10001227 3300005985 Bacteria 45841
117 Ga0070717_10291884 3300006028 Bacteria 1448
118 Ga0070717_10518027 3300006028 Bacteria 1079
119 Ga0075432_10295952 3300006058 Bacteria 670
120 Ga0070715_10429801 3300006163 Unclassified 741
121 Ga0070716_100062991 3300006173 Unclassified 2152
122 Ga0070712_100071149 3300006175 Unclassified 2488
123 Ga0070712_101469395 3300006175 Bacteria 595
124 Ga0097621_100023642 3300006237 Bacteria 4787
125 Ga0075434_100114260 3300006871 Bacteria 2713
126 Ga0075434_100118284 3300006871 Unclassified 2664
127 Ga0075434_101776843 3300006871 Bacteria 624
128 Ga0097620_100018753 3300006931 Bacteria 6952
129 Ga0097620_100049148 3300006931 Bacteria 4236
130 Ga0097620_102402511 3300006931 Unclassified 581
131 Ga0105245_10004293 3300009098 Bacteria 12626
132 Ga0105245_10157889 3300009098 Unclassified 2150
133 Ga0105247_10472157 3300009101 Bacteria 909
134 Ga0114129_12463744 3300009147 Unclassified 622
135 Ga0105243_10243749 3300009148 Unclassified 1601
136 Ga0105241_11946311 3300009174 Bacteria 577
137 Ga0105242_10035542 3300009176 Bacteria 3995
138 Ga0105242_10383284 3300009176 Bacteria 1307
139 Ga0105248_10085913 3300009177 Bacteria 3540
140 Ga0105248_10200927 3300009177 Bacteria 2246
141 Ga0105248_10214499 3300009177 Unclassified 2168
142 Ga0105248_10491691 3300009177 Bacteria 1383
143 Ga0105248_13104917 3300009177 Bacteria 529
144 Ga0105237_11478097 3300009545 Bacteria 686
145 Ga0105237_11702931 3300009545 Bacteria 638
146 Ga0105238_10073695 3300009551 Unclassified 3408
147 Ga0105249_11339578 3300009553 Bacteria 787
148 Ga0105239_10313487 3300010375 Bacteria 1768
149 Ga0105246_10007328 3300011119 Bacteria 6757
150 Ga0105246_10085138 3300011119 Bacteria 2263
151 Ga0157371_10007457 3300013102 Bacteria 8850
152 Ga0157369_10079213 3300013105 Bacteria 3519
153 Ga0157369_10887249 3300013105 Bacteria 915
154 Ga0157369_10952213 3300013105 Bacteria 880
155 Ga0157369_12222433 3300013105 Unclassified 556
156 Ga0157374_10065102 3300013296 Bacteria 3423
157 Ga0157374_10504732 3300013296 Unclassified 1214
158 Ga0157378_11597325 3300013297 Bacteria 698
159 Ga0163162_10389820 3300013306 Bacteria 1526
160 Ga0157372_10026042 3300013307 Bacteria 6362
161 Ga0157372_10108042 3300013307 Bacteria 3184
162 Ga0157372_11240664 3300013307 Bacteria 861
163 Ga0157375_10016125 3300013308 Bacteria 6701
164 Ga0157375_10073106 3300013308 Bacteria 3447
165 Ga0163163_10424098 3300014325 Bacteria 1389
166 Ga0163163_10442898 3300014325 Bacteria 1359
167 Ga0163163_12402510 3300014325 Unclassified 585
168 Ga0157377_10004903 3300014745 Bacteria 6229
169 Ga0157377_10163413 3300014745 Unclassified 1386
170 Ga0157379_10614320 3300014968 Bacteria 1016
171 Ga0157376_10071983 3300014969 Unclassified 2939
172 Ga0206353_10680022 3300020082 Unclassified 730
173 Ga0213876_10485864 3300021384 Unclassified 657
174 Ga0207697_10136204 3300025315 Bacteria 1063
175 Ga0207680_10134998 3300025903 Bacteria 1630
176 Ga0207699_10411883 3300025906 Unclassified 964
177 Ga0207643_10043800 3300025908 Bacteria 2526
178 Ga0207643_10081049 3300025908 Bacteria 1880
179 Ga0207684_10382904 3300025910 Bacteria 1210
180 Ga0207707_10009007 3300025912 Bacteria 8669
181 Ga0207707_10256021 3300025912 Unclassified 1520
182 Ga0207707_10311456 3300025912 Bacteria 1360
183 Ga0207695_10036542 3300025913 Bacteria 5310
184 Ga0207671_10383176 3300025914 Bacteria 1117
185 Ga0207693_10107942 3300025915 Unclassified 2183
186 Ga0207663_10087822 3300025916 Bacteria 2054
187 Ga0207663_10704105 3300025916 Bacteria 800
188 Ga0207660_10002260 3300025917 Bacteria 12716
189 Ga0207660_10018635 3300025917 Bacteria 4631
190 Ga0207660_10051026 3300025917 Bacteria 2940
191 Ga0207662_10071130 3300025918 Unclassified 2106
192 Ga0207662_10495583 3300025918 Bacteria 841
193 Ga0207657_10162313 3300025919 Bacteria 1814
194 Ga0207649_10016676 3300025920 Bacteria 4149
195 Ga0207652_10001953 3300025921 Bacteria 17846
196 Ga0207652_10015883 3300025921 Bacteria 6135
197 Ga0207652_10262434 3300025921 Bacteria 1558
198 Ga0207652_10262570 3300025921 Bacteria 1558
199 Ga0207652_10595165 3300025921 Bacteria 992
200 Ga0207652_10634641 3300025921 Unclassified 956
201 Ga0207646_10086139 3300025922 Bacteria 2810
202 Ga0207681_10278472 3300025923 Unclassified 1316
203 Ga0207650_10004665 3300025925 Bacteria 9371
204 Ga0207650_10540768 3300025925 Bacteria 976
205 Ga0207659_10572716 3300025926 Unclassified 961
206 Ga0207659_10856538 3300025926 Bacteria 781
207 Ga0207687_10165665 3300025927 Bacteria 1700
208 Ga0207700_10019349 3300025928 Bacteria 4597
209 Ga0207690_10006864 3300025932 Bacteria 6753
210 Ga0207706_10047323 3300025933 Unclassified 3806
211 Ga0207706_10057016 3300025933 Bacteria 3442
212 Ga0207686_10165310 3300025934 Bacteria 1555
213 Ga0207686_10320531 3300025934 Bacteria 1158
214 Ga0207670_10021543 3300025936 Unclassified 3979
215 Ga0207670_10222538 3300025936 Bacteria 1445
216 Ga0207670_10434281 3300025936 Unclassified 1056
217 Ga0207670_11010918 3300025936 Unclassified 700
218 Ga0207669_10861669 3300025937 Unclassified 755
219 Ga0207691_10232606 3300025940 Unclassified 1595
220 Ga0207691_10346149 3300025940 Bacteria 1272
221 Ga0207711_10237318 3300025941 Bacteria 1671
222 Ga0207711_10432024 3300025941 Unclassified 1225
223 Ga0207689_10001895 3300025942 Bacteria 19779
224 Ga0207661_10003716 3300025944 Bacteria 10641
225 Ga0207661_10028790 3300025944 Bacteria 4259
226 Ga0207661_10057116 3300025944 Bacteria 3137
227 Ga0207661_10250396 3300025944 Bacteria 1574
228 Ga0207661_10324615 3300025944 Bacteria 1384
229 Ga0207661_11694818 3300025944 Bacteria 577
230 Ga0207679_10008608 3300025945 Bacteria 6505
231 Ga0207679_10483211 3300025945 Unclassified 1103
232 Ga0207667_10304552 3300025949 Bacteria 1628
233 Ga0207667_10331901 3300025949 Unclassified 1553
234 Ga0207667_10560263 3300025949 Bacteria 1155
235 Ga0207668_12108245 3300025972 Unclassified 508
236 Ga0207658_10505626 3300025986 Bacteria 1077
237 Ga0207677_10073339 3300026023 Bacteria 2424
238 Ga0207703_10336268 3300026035 Unclassified 1386
239 Ga0207639_10164483 3300026041 Bacteria 1873
240 Ga0207702_10597542 3300026078 Unclassified 1082
241 Ga0207702_11064876 3300026078 Unclassified 802
242 Ga0207702_11386201 3300026078 Bacteria 697
243 Ga0207641_10305216 3300026088 Bacteria 1505
244 Ga0207641_10520946 3300026088 Unclassified 1156
245 Ga0207641_10675244 3300026088 Unclassified 1016
246 Ga0207648_10665041 3300026089 Bacteria 963
247 Ga0207676_10070304 3300026095 Bacteria 2806
248 Ga0207676_10106860 3300026095 Bacteria 2333
249 Ga0207676_10171943 3300026095 Bacteria 1889
250 Ga0207674_10000595 3300026116 Bacteria 47608
251 Ga0207674_10910632 3300026116 Bacteria 848
252 Ga0207683_10055453 3300026121 Bacteria 3475
253 Ga0207683_10681473 3300026121 Unclassified 953
254 Ga0207698_10453294 3300026142 Bacteria 1239
255 Ga0207428_10243317 3300027907 Unclassified 1343
256 Ga0268265_10093331 3300028380 Bacteria 2411
257 Ga0268264_10063107 3300028381 Bacteria 3113
258 Ga0307408_100025526 3300031548 Bacteria 4048
259 Ga0307405_10000926 3300031731 Bacteria 11672
260 Ga0307405_10062923 3300031731 Bacteria 2351
261 Ga0307413_10001550 3300031824 Bacteria 8837
262 Ga0307413_10027518 3300031824 Bacteria 3151
263 Ga0307413_10109853 3300031824 Bacteria 1844
264 Ga0307410_10001178 3300031852 Bacteria 11548
265 Ga0307406_10010088 3300031901 Bacteria 5319
266 Ga0307406_10014044 3300031901 Bacteria 4601
267 Ga0307407_10005490 3300031903 Bacteria 5508
268 Ga0307407_10038776 3300031903 Bacteria 2643
269 Ga0307407_10468185 3300031903 Bacteria 918
270 Ga0307412_10044345 3300031911 Bacteria 2901
271 Ga0307412_10123644 3300031911 Bacteria 1867
272 Ga0307409_100005483 3300031995 Bacteria 7314
273 Ga0307409_100025127 3300031995 Bacteria 4171
274 Ga0307409_100263730 3300031995 Bacteria 1583
275 Ga0307409_102598993 3300031995 Unclassified 535
276 Ga0307416_100001287 3300032002 Bacteria 13525
277 Ga0307416_100064632 3300032002 Bacteria 3003
278 Ga0307416_100571479 3300032002 Bacteria 1206
279 Ga0307411_10013870 3300032005 Bacteria 4464
280 Ga0307411_10066066 3300032005 Bacteria 2428
281 Ga0307411_10271570 3300032005 Bacteria 1345
282 Ga0307415_100002278 3300032126 Bacteria 9515
283 Ga0307415_101060148 3300032126 Bacteria 757
284 Ga0307415_101791657 3300032126 Bacteria 594
285 Ga0373958_0068350 3300034819 Unclassified 783
286 Ga0373959_0015716 3300034820 Bacteria 1393
287 Ga0373934_0007598 3300035086 Bacteria 4028
288 Ga0373923_0002211 3300035111 Bacteria 5919
289 Ga0373936_0529171 3300035113 Unclassified 550
290 Ga0373939_0140289 3300035114 Bacteria 871
291 Ga0373953_0039762 3300035117 Bacteria 1865
292 Ga0373956_0001846 3300035119 Bacteria 8733
293 Ga0373956_0226781 3300035119 Bacteria 887
294 Ga0373957_0016332 3300035120 Bacteria 2568
295 Ga0373943_0152978 3300035170 Unclassified 1251
296 Ga0373946_0539970 3300035171 Bacteria 601
297 Ga0373955_0015542 3300035172 Bacteria 3728
298 Ga0373955_0103872 3300035172 Bacteria 1635
299 Ga0373924_0056611 3300035410 Bacteria 1633
300 Ga0373931_0050053 3300035691 Unclassified 2222
301 Ga0373935_0216101 3300035692 Bacteria 1330
302 Ga0373935_0647600 3300035692 Bacteria 775
303 Ga0373927_0029532 3300035695 Bacteria 3574
304 Ga0373933_0000620 3300035724 Bacteria 22190
305 Ga0373933_0257772 3300035724 Bacteria 1124
306 Ga0373937_0008615 3300036401 Bacteria 8858
307 Ga0373937_0161975 3300036401 Bacteria 2097
308 Ga0373937_1917146 3300036401 Bacteria 539
309 Ga0373925_0129392 3300037068 Bacteria 1967
310 Ga0373925_0735483 3300037068 Bacteria 813
311 Ga0436364_0619104 3300037853 Unclassified 735
312 Ga0436365_1284100 3300039437 Bacteria 1765
313 Ga0466957_0635736 3300044842 Bacteria 749
314 Ga0466959_0032346 3300045049 Bacteria 3872
315 Ga0451576_0091250 3300045051 Bacteria 3169
316 Ga0451576_0108685 3300045051 Bacteria 2886
317 Ga0451576_1208471 3300045051 Bacteria 789
318 Ga0466958_0151417 3300045836 Bacteria 1463
319 Ga0466967_0089519 3300045976 Bacteria 2795
320 Ga0495592_0065281 3300046454 Bacteria 2665
321 Ga0495629_0019724 3300046459 Bacteria 4813
322 Ga0495629_0030308 3300046459 Bacteria 3836
323 Ga0495629_0032825 3300046459 Bacteria 3674
324 Ga0495629_0519917 3300046459 Bacteria 801
325 Ga0495651_0008999 3300046462 Bacteria 7665
326 Ga0495653_0006132 3300046463 Bacteria 9856
327 Ga0495653_0558341 3300046463 Unclassified 708
328 Ga0495580_0083328 3300046472 Unclassified 2228
329 Ga0495580_0761491 3300046472 Bacteria 630
330 Ga0495582_0014785 3300046473 Bacteria 4287
331 Ga0495582_0077718 3300046473 Bacteria 1841
332 Ga0495639_0018704 3300046475 Unclassified 3018
333 Ga0495664_0024070 3300046477 Bacteria 3537
334 Ga0495594_0042370 3300046499 Bacteria 2493
335 Ga0495594_0077835 3300046499 Bacteria 1850
336 Ga0495608_0002844 3300046511 Bacteria 12397
337 Ga0495618_0554840 3300046514 Bacteria 687
338 Ga0495628_0026821 3300046516 Bacteria 4690
339 Ga0495628_0164829 3300046516 Bacteria 1683
340 Ga0495630_0006665 3300046517 Bacteria 8231
341 Ga0495630_0012975 3300046517 Bacteria 6053
342 Ga0495652_0176855 3300046529 Bacteria 1642
343 Ga0495652_0242137 3300046529 Bacteria 1341
344 Ga0495665_0018935 3300046531 Bacteria 3700
345 Ga0495665_0663929 3300046531 Bacteria 518
346 Ga0495640_0658865 3300046533 Bacteria 630
347 Ga0495640_0676601 3300046533 Unclassified 620
348 Ga0495586_0189278 3300046535 Bacteria 1165
349 Ga0495587_0005112 3300046536 Bacteria 8576
350 Ga0495598_0131442 3300046537 Bacteria 859
351 Ga0495621_0344976 3300046539 Unclassified 624
352 Ga0495645_0000528 3300046543 Bacteria 26299
353 Ga0495645_0875573 3300046543 Unclassified 534
354 Ga0495667_0001598 3300046559 Bacteria 15016
355 Ga0495667_0077126 3300046559 Bacteria 2168
356 Ga0495635_0190503 3300046663 Bacteria 1392
357 Ga0495635_0577116 3300046663 Unclassified 736
358 Ga0495659_0090422 3300046664 Unclassified 1174
359 Ga0495588_0218910 3300046674 Bacteria 1005
360 Ga0495657_0002079 3300046675 Bacteria 17005
361 Ga0495599_0005911 3300046678 Bacteria 7355
362 Ga0495623_0001550 3300046679 Bacteria 15511
363 Ga0495623_0273846 3300046679 Bacteria 941
364 Ga0495646_0170284 3300046680 Bacteria 1200
365 Ga0495647_0049320 3300046681 Unclassified 1631
366 Ga0495613_0229498 3300046689 Bacteria 1301
367 Ga0495613_0284478 3300046689 Bacteria 1147
368 Ga0495600_0001713 3300046809 Bacteria 12251
369 Ga0495581_0008516 3300047315 Bacteria 5946
370 Ga0495581_0175463 3300047315 Unclassified 1253
371 Ga0495581_0263644 3300047315 Bacteria 1007
372 Ga0495581_0743573 3300047315 Bacteria 564
373 Ga0495604_0000849 3300047317 Bacteria 25522
374 Ga0495674_0009478 3300047319 Bacteria 9250
375 Ga0495674_0043347 3300047319 Bacteria 4005
376 Ga0495680_0045083 3300047322 Bacteria 3484
377 Ga0495675_0005533 3300047444 Bacteria 7705
378 Ga0495675_0006109 3300047444 Bacteria 7370
379 Ga0495675_0083334 3300047444 Unclassified 2013
380 Ga0495675_0206249 3300047444 Bacteria 1195
381 Ga0495684_0005287 3300047471 Bacteria 10057
382 Ga0495684_0481195 3300047471 Bacteria 857
383 Ga0495593_0596159 3300047673 Unclassified 555
384 Ga0495602_0011287 3300048088 Bacteria 9239
385 Ga0496101_1174661 3300048904 Unclassified 602
386 Ga0496104_0179145 3300048907 Unclassified 2030
387 Ga0496108_0369321 3300048911 Bacteria 1252
388 Ga0496109_0044641 3300048912 Bacteria 4021
389 Ga0496112_0464857 3300048915 Bacteria 1202
390 Ga0496113_0060838 3300048916 Bacteria 2848
391 Ga0501031_0869605 3300049568 Bacteria 577
392 Ga0501032_0329427 3300049569 Unclassified 985
393 Ga0501033_0032999 3300049570 Bacteria 3887
394 Ga0501034_0018600 3300049571 Bacteria 7123
395 Ga0501034_1387784 3300049571 Unclassified 578
396 Ga0501036_0036577 3300049572 Bacteria 4155
397 Ga0501037_0361928 3300049573 Unclassified 999
398 Ga0501038_0188715 3300049574 Bacteria 1659
399 Ga0501043_0301508 3300049579 Bacteria 1224
400 Ga0501043_0322169 3300049579 Unclassified 1178
401 Ga0501046_0460349 3300049580 Bacteria 914
402 Ga0501047_0040307 3300049581 Bacteria 4517
403 Ga0501047_0078518 3300049581 Bacteria 3174
404 Ga0501073_0502548 3300049589 Bacteria 838
405 Ga0501075_0613117 3300049591 Bacteria 830
406 Ga0501080_0170101 3300049742 Unclassified 2010
407 Ga0501080_0930855 3300049742 Bacteria 756
408 Ga0501035_0039613 3300049822 Bacteria 4263
409 Ga0501035_0505585 3300049822 Unclassified 994
410 Ga0501044_0011197 3300049823 Bacteria 9727
411 Ga0501044_0091360 3300049823 Bacteria 3071
412 Ga0501044_0249211 3300049823 Bacteria 1718
413 Ga0501044_0385156 3300049823 Bacteria 1317
414 nmdc:mga0n895_1448344_c1 3300050512 Unclassified 654
415 nmdc:mga0n895_1952883_c1 3300050512 Unclassified 545
416 nmdc:mga0n895_41050_c1 3300050512 Bacteria 4497
417 nmdc:mga0n895_627745_c1 3300050512 Bacteria 1075
418 nmdc:mga0rr50_725159_c1 3300050513 Bacteria 848
419 Ga0495601_0022951 3300053077 Bacteria 3834
420 Ga0495601_0231263 3300053077 Unclassified 1208
421 Ga0495595_0023325 3300053084 Bacteria 2723
422 Ga0495595_0282375 3300053084 Unclassified 834
423 Ga0495619_0005136 3300053085 Bacteria 8311
424 Ga0495619_0368912 3300053085 Unclassified 992
425 Ga0495619_0632271 3300053085 Bacteria 731
426 Ga0501082_0821263 3300060353 Bacteria 813
427 Ga0495672_0005540
428 JGI25406J46586_10045801
429 Ga0058863_11270231
430 Ga0070683_100023422
431 Ga0070683_100043001
432 Ga0070683_100309839
433 Ga0070683_100741546
434 Ga0070690_100073313
435 Ga0070690_101229190
436 Ga0070670_100024323
437 Ga0070666_10270033
438 Ga0070680_100005312
439 Ga0070680_100008289
440 Ga0070680_100041878
441 Ga0070682_100104955
442 Ga0068868_100037872
443 Ga0070660_100365623
444 Ga0070689_100184967
445 Ga0070689_100299488
446 Ga0070689_101331056
447 Ga0070691_10998209
448 Ga0070687_100173152
449 Ga0070687_100646531
450 Ga0070661_100003348
451 Ga0070661_100465594
452 Ga0070692_10009656
453 Ga0070692_10764329
454 Ga0070668_101252106
455 Ga0070668_101975106
456 Ga0070669_100159028
457 Ga0070669_100549072
458 Ga0070675_100008403
459 Ga0070675_100395968
460 Ga0070675_100950089
461 Ga0070671_100261222
462 Ga0070674_100482607
463 Ga0070673_100085150
464 Ga0070673_100148653
465 Ga0070688_100207975
466 Ga0070688_101287909
467 Ga0070659_100021049
468 Ga0070667_100182548
469 Ga0070667_100207860
470 Ga0070709_10679300
471 Ga0070714_100097809
472 Ga0070714_100574636
473 Ga0070713_100004668
474 Ga0070711_100403382
475 Ga0070700_100168148
476 Ga0070694_100286727
477 Ga0070708_100000916
478 Ga0070663_100100935
479 Ga0070678_100401687
480 Ga0070678_100597778
481 Ga0070662_100073893
482 Ga0070681_10003086
483 Ga0070681_10016204
484 Ga0070681_10263034
485 Ga0070685_10369490
486 Ga0070685_10725689
487 Ga0070707_100126466
488 Ga0070707_100707681
489 Ga0070707_100918110
490 Ga0070698_100430528
491 Ga0070679_100002281
492 Ga0070679_100012580
493 Ga0070679_100025456
494 Ga0070679_100098149
495 Ga0070679_100660209
496 Ga0070684_100016271
497 Ga0070684_100089373
498 Ga0070684_100090344
499 Ga0070684_100182690
500 Ga0070684_100403248
501 Ga0070684_100555165
502 Ga0070672_100153017
503 Ga0070672_100239062
504 Ga0070672_100544762
505 Ga0070686_100658766
506 Ga0070695_100111222
507 Ga0070695_100321606
508 Ga0070695_101124401
509 Ga0070696_100003509
510 Ga0070693_100034588
511 Ga0070693_100966879
512 Ga0068855_100036520
513 Ga0068855_100098514
514 Ga0068855_100152953
515 Ga0070664_100373284
516 Ga0068857_100006677
517 Ga0068854_100521999
518 Ga0068856_100016568
519 Ga0068856_100114473
520 Ga0068856_100726231
521 Ga0070702_100000983
522 Ga0070702_100539229
523 Ga0068852_101696394
524 Ga0068859_100018750
525 Ga0068859_100049149
526 Ga0068859_102402534
527 Ga0068864_100011327
528 Ga0068864_100199977
529 Ga0068864_100448505
530 Ga0068864_100928673
531 Ga0068866_10533912
532 Ga0068870_10038065
533 Ga0068870_10263635
534 Ga0068870_10888891
535 Ga0068863_100043891
536 Ga0068863_100363254
537 Ga0068858_100085164
538 Ga0068858_101132982
539 Ga0068860_100003352
540 Ga0068862_100149817
541 Ga0081455_10378715
542 Ga0081539_10001227
543 Ga0070717_10291884
544 Ga0070717_10518027
545 Ga0075432_10295952
546 Ga0070715_10429801
547 Ga0070716_100062991
548 Ga0070712_100071149
549 Ga0070712_101469395
550 Ga0097621_100023642
551 Ga0075434_100114260
552 Ga0075434_100118284
553 Ga0075434_101776843
554 Ga0097620_100018753
555 Ga0097620_100049148
556 Ga0097620_102402511
557 Ga0105245_10004293
558 Ga0105245_10157889
559 Ga0105247_10472157
560 Ga0114129_12463744
561 Ga0105243_10243749
562 Ga0105241_11946311
563 Ga0105242_10035542
564 Ga0105242_10383284
565 Ga0105248_10085913
566 Ga0105248_10200927
567 Ga0105248_10214499
568 Ga0105248_10491691
569 Ga0105248_13104917
570 Ga0105237_11478097
571 Ga0105237_11702931
572 Ga0105238_10073695
573 Ga0105249_11339578
574 Ga0105239_10313487
575 Ga0105246_10007328
576 Ga0105246_10085138
577 Ga0157371_10007457
578 Ga0157369_10079213
579 Ga0157369_10887249
580 Ga0157369_10952213
581 Ga0157369_12222433
582 Ga0157374_10065102
583 Ga0157374_10504732
584 Ga0157378_11597325
585 Ga0163162_10389820
586 Ga0157372_10026042
587 Ga0157372_10108042
588 Ga0157372_11240664
589 Ga0157375_10016125
590 Ga0157375_10073106
591 Ga0163163_10424098
592 Ga0163163_10442898
593 Ga0163163_12402510
594 Ga0157377_10004903
595 Ga0157377_10163413
596 Ga0157379_10614320
597 Ga0157376_10071983
598 Ga0206353_10680022
599 Ga0213876_10485864
600 Ga0207697_10136204
601 Ga0207680_10134998
602 Ga0207699_10411883
603 Ga0207643_10043800
604 Ga0207643_10081049
605 Ga0207684_10382904
606 Ga0207707_10009007
607 Ga0207707_10256021
608 Ga0207707_10311456
609 Ga0207695_10036542
610 Ga0207671_10383176
611 Ga0207693_10107942
612 Ga0207663_10087822
613 Ga0207663_10704105
614 Ga0207660_10002260
615 Ga0207660_10018635
616 Ga0207660_10051026
617 Ga0207662_10071130
618 Ga0207662_10495583
619 Ga0207657_10162313
620 Ga0207649_10016676
621 Ga0207652_10001953
622 Ga0207652_10015883
623 Ga0207652_10262434
624 Ga0207652_10262570
625 Ga0207652_10595165
626 Ga0207652_10634641
627 Ga0207646_10086139
628 Ga0207681_10278472
629 Ga0207650_10004665
630 Ga0207650_10540768
631 Ga0207659_10572716
632 Ga0207659_10856538
633 Ga0207687_10165665
634 Ga0207700_10019349
635 Ga0207690_10006864
636 Ga0207706_10047323
637 Ga0207706_10057016
638 Ga0207686_10165310
639 Ga0207686_10320531
640 Ga0207670_10021543
641 Ga0207670_10222538
642 Ga0207670_10434281
643 Ga0207670_11010918
644 Ga0207669_10861669
645 Ga0207691_10232606
646 Ga0207691_10346149
647 Ga0207711_10237318
648 Ga0207711_10432024
649 Ga0207689_10001895
650 Ga0207661_10003716
651 Ga0207661_10028790
652 Ga0207661_10057116
653 Ga0207661_10250396
654 Ga0207661_10324615
655 Ga0207661_11694818
656 Ga0207679_10008608
657 Ga0207679_10483211
658 Ga0207667_10304552
659 Ga0207667_10331901
660 Ga0207667_10560263
661 Ga0207668_12108245
662 Ga0207658_10505626
663 Ga0207677_10073339
664 Ga0207703_10336268
665 Ga0207639_10164483
666 Ga0207702_10597542
667 Ga0207702_11064876
668 Ga0207702_11386201
669 Ga0207641_10305216
670 Ga0207641_10520946
671 Ga0207641_10675244
672 Ga0207648_10665041
673 Ga0207676_10070304
674 Ga0207676_10106860
675 Ga0207676_10171943
676 Ga0207674_10000595
677 Ga0207674_10910632
678 Ga0207683_10055453
679 Ga0207683_10681473
680 Ga0207698_10453294
681 Ga0207428_10243317
682 Ga0268265_10093331
683 Ga0268264_10063107
684 Ga0307408_100025526
685 Ga0307405_10000926
686 Ga0307405_10062923
687 Ga0307413_10001550
688 Ga0307413_10027518
689 Ga0307413_10109853
690 Ga0307410_10001178
691 Ga0307406_10010088
692 Ga0307406_10014044
693 Ga0307407_10005490
694 Ga0307407_10038776
695 Ga0307407_10468185
696 Ga0307412_10044345
697 Ga0307412_10123644
698 Ga0307409_100005483
699 Ga0307409_100025127
700 Ga0307409_100263730
701 Ga0307409_102598993
702 Ga0307416_100001287
703 Ga0307416_100064632
704 Ga0307416_100571479
705 Ga0307411_10013870
706 Ga0307411_10066066
707 Ga0307411_10271570
708 Ga0307415_100002278
709 Ga0307415_101060148
710 Ga0307415_101791657
711 Ga0373958_0068350
712 Ga0373959_0015716
713 Ga0373934_0007598
714 Ga0373923_0002211
715 Ga0373936_0529171
716 Ga0373939_0140289
717 Ga0373953_0039762
718 Ga0373956_0001846
719 Ga0373956_0226781
720 Ga0373957_0016332
721 Ga0373943_0152978
722 Ga0373946_0539970
723 Ga0373955_0015542
724 Ga0373955_0103872
725 Ga0373924_0056611
726 Ga0373931_0050053
727 Ga0373935_0216101
728 Ga0373935_0647600
729 Ga0373927_0029532
730 Ga0373933_0000620
731 Ga0373933_0257772
732 Ga0373937_0008615
733 Ga0373937_0161975
734 Ga0373937_1917146
735 Ga0373925_0129392
736 Ga0373925_0735483
737 Ga0436364_0619104
738 Ga0436365_1284100
739 Ga0466957_0635736
740 Ga0466959_0032346
741 Ga0451576_0091250
742 Ga0451576_0108685
743 Ga0451576_1208471
744 Ga0466958_0151417
745 Ga0466967_0089519
746 Ga0495592_0065281
747 Ga0495629_0019724
748 Ga0495629_0030308
749 Ga0495629_0032825
750 Ga0495629_0519917
751 Ga0495651_0008999
752 Ga0495653_0006132
753 Ga0495653_0558341
754 Ga0495580_0083328
755 Ga0495580_0761491
756 Ga0495582_0014785
757 Ga0495582_0077718
758 Ga0495639_0018704
759 Ga0495664_0024070
760 Ga0495594_0042370
761 Ga0495594_0077835
762 Ga0495608_0002844
763 Ga0495618_0554840
764 Ga0495628_0026821
765 Ga0495628_0164829
766 Ga0495630_0006665
767 Ga0495630_0012975
768 Ga0495652_0176855
769 Ga0495652_0242137
770 Ga0495665_0018935
771 Ga0495665_0663929
772 Ga0495640_0658865
773 Ga0495640_0676601
774 Ga0495586_0189278
775 Ga0495587_0005112
776 Ga0495598_0131442
777 Ga0495621_0344976
778 Ga0495645_0000528
779 Ga0495645_0875573
780 Ga0495667_0001598
781 Ga0495667_0077126
782 Ga0495635_0190503
783 Ga0495635_0577116
784 Ga0495659_0090422
785 Ga0495588_0218910
786 Ga0495657_0002079
787 Ga0495599_0005911
788 Ga0495623_0001550
789 Ga0495623_0273846
790 Ga0495646_0170284
791 Ga0495647_0049320
792 Ga0495613_0229498
793 Ga0495613_0284478
794 Ga0495600_0001713
795 Ga0495581_0008516
796 Ga0495581_0175463
797 Ga0495581_0263644
798 Ga0495581_0743573
799 Ga0495604_0000849
800 Ga0495674_0009478
801 Ga0495674_0043347
802 Ga0495680_0045083
803 Ga0495675_0005533
804 Ga0495675_0006109
805 Ga0495675_0083334
806 Ga0495675_0206249
807 Ga0495684_0005287
808 Ga0495684_0481195
809 Ga0495593_0596159
810 Ga0495602_0011287
811 Ga0496101_1174661
812 Ga0496104_0179145
813 Ga0496108_0369321
814 Ga0496109_0044641
815 Ga0496112_0464857
816 Ga0496113_0060838
817 Ga0501031_0869605
818 Ga0501032_0329427
819 Ga0501033_0032999
820 Ga0501034_0018600
821 Ga0501034_1387784
822 Ga0501036_0036577
823 Ga0501037_0361928
824 Ga0501038_0188715
825 Ga0501043_0301508
826 Ga0501043_0322169
827 Ga0501046_0460349
828 Ga0501047_0040307
829 Ga0501047_0078518
830 Ga0501073_0502548
831 Ga0501075_0613117
832 Ga0501080_0170101
833 Ga0501080_0930855
834 Ga0501035_0039613
835 Ga0501035_0505585
836 Ga0501044_0011197
837 Ga0501044_0091360
838 Ga0501044_0249211
839 Ga0501044_0385156
840 nmdc:mga0n895_1448344_c1
841 nmdc:mga0n895_1952883_c1
842 nmdc:mga0n895_41050_c1
843 nmdc:mga0n895_627745_c1
844 nmdc:mga0rr50_725159_c1
845 Ga0495601_0022951
846 Ga0495601_0231263
847 Ga0495595_0023325
848 Ga0495595_0282375
849 Ga0495619_0005136
850 Ga0495619_0368912
851 Ga0495619_0632271
852 Ga0501082_0821263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aay-assembly1.cif.gz_C crystal structure of the arsenite oxidase protein complex from rhizobium species strain nt-26 0.9288 31 78
1e60-assembly1.cif.gz_A oxidized dmso reductase exposed to hepes - structure ii buffer 0.9136 32 78
6tg9-assembly1.cif.gz_A cryo-em structure of nadh reduced form of nad+-dependent formate dehydrogenase from rhodobacter capsulatus 0.9131 31 78
1dms-assembly1.cif.gz_A structure of dmso reductase 0.912 32 78
1e18-assembly1.cif.gz_A tungsten-susbstituted dmso reductase from rhodobacter capsulatus 0.9113 32 78
ID Description Score Start End Superfamily
4aayA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9286 31 78 2.40.40.20
af_Q2FVM1_41_1229_3.40.50.12440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8278 13 78 3.40.50.12440
1uhdA00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.8245 34 92 2.40.40.20
af_P46468_319_424_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.8234 13 92 2.40.40.20
af_P9WIV9_711_804_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.8193 27 93 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A2G4ID34-F1-model_v4 Molybdopterin dinucleotide-binding domain-containing protein 0.9611 8 97
AF-A0A258LZ95-F1-model_v4 Nitrate reductase 0.9585 31 78 GO:0016020
GO:0016491
GO:0042128
GO:0043546
GO:0045333
GO:0046872
GO:0051536
GO:1990204
AF-A0A1G3VWU5-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.9488 31 78 GO:0016491
GO:0043546
GO:0046872
GO:0051539
AF-A0A3A4PGW2-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.948 31 78 GO:0016491
GO:0043546
GO:0046872
GO:0051539
AF-A0A2G4FT75-F1-model_v4 Uncharacterized protein 0.9457 11 99

Map