F439933

General Info

Members Datasets Scaffolds Average Seq Length
421 203 842 266

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100039750|Ga0070707_1000397502
Length 291
Sequence VDHDRRSAPAGVKASAERPLAGRTVLAVFAHPDDESLACGGTLARLSDAGARVVLMCASRGENGSISDPALVPDGNLASVRTRELQEAAAILGIADLMILDHPDGDLRWAHVPQLHAEIVAAVEEYRPDAVITFAEDGLYWHLDHVGVHERTYTAVRSLGSQAPPLYYVTMSAGAIQNVVEAAHAKGGAPPDSSFWGIAPDAFGAGAKPPTFSVNVGDWVARKMAALRCHRTQMGRDNPIAWIGDDEARRLLGLEYFRRDGLTRLEALEALGEPVRIDVTRLLEANATRHA

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
121 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 6.41
Rhizosphere 93.35
Stem 0
Stem Tuber 0
Unclassified 12.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100039750 3300005468 Bacteria 4498
2 Ga0065712_10072362 3300005290 Bacteria 4786
3 Ga0070670_100028070 3300005331 Bacteria 4843
4 Ga0070670_100103158 3300005331 Bacteria 2457
5 Ga0070670_100320980 3300005331 Bacteria 1357
6 Ga0068869_100146070 3300005334 Bacteria 1830
7 Ga0070666_10018795 3300005335 Bacteria 4451
8 Ga0070666_10094231 3300005335 Unclassified 2060
9 Ga0068868_100060037 3300005338 Bacteria 3009
10 Ga0068868_100171740 3300005338 Bacteria 1795
11 Ga0068868_100452751 3300005338 Bacteria 1117
12 Ga0070660_100030378 3300005339 Unclassified 4054
13 Ga0070689_100045677 3300005340 Bacteria 3373
14 Ga0070669_100003556 3300005353 Bacteria 11247
15 Ga0070669_100035388 3300005353 Bacteria 3617
16 Ga0070669_100040487 3300005353 Bacteria 3387
17 Ga0070671_100027324 3300005355 Bacteria 4695
18 Ga0070671_100043280 3300005355 Unclassified 3742
19 Ga0070671_100305363 3300005355 Bacteria 1355
20 Ga0070674_100036936 3300005356 Bacteria 3283
21 Ga0070674_100067244 3300005356 Bacteria 2520
22 Ga0070673_100004287 3300005364 Bacteria 9004
23 Ga0070673_100033726 3300005364 Bacteria 3868
24 Ga0070673_100080753 3300005364 Bacteria 2636
25 Ga0070688_100249274 3300005365 Bacteria 1264
26 Ga0070659_100173354 3300005366 Bacteria 1768
27 Ga0070659_100326350 3300005366 Bacteria 1284
28 Ga0070667_100024224 3300005367 Bacteria 5042
29 Ga0070714_100029675 3300005435 Bacteria 4547
30 Ga0070713_100010070 3300005436 Bacteria 6817
31 Ga0070711_100378514 3300005439 Bacteria 1144
32 Ga0070694_100093442 3300005444 Bacteria 2114
33 Ga0070708_100502864 3300005445 Bacteria 1143
34 Ga0070678_100013951 3300005456 Bacteria 5054
35 Ga0070662_100237287 3300005457 Bacteria 1461
36 Ga0070681_10012443 3300005458 Bacteria 8441
37 Ga0070681_10516132 3300005458 Unclassified 1108
38 Ga0068867_100032719 3300005459 Bacteria 3762
39 Ga0068867_100243937 3300005459 Bacteria 1458
40 Ga0070707_100143288 3300005468 Bacteria 2326
41 Ga0070698_100035271 3300005471 Bacteria 5173
42 Ga0070698_100238368 3300005471 Bacteria 1752
43 Ga0070679_100282313 3300005530 Unclassified 1613
44 Ga0070697_100120867 3300005536 Bacteria 2191
45 Ga0070686_100000557 3300005544 Bacteria 22262
46 Ga0070686_100183380 3300005544 Bacteria 1489
47 Ga0070695_100001307 3300005545 Bacteria 13765
48 Ga0070695_100145727 3300005545 Bacteria 1647
49 Ga0070696_100033526 3300005546 Bacteria 3529
50 Ga0070696_100078476 3300005546 Bacteria 2335
51 Ga0070693_100186420 3300005547 Bacteria 1339
52 Ga0070665_100002605 3300005548 Bacteria 19694
53 Ga0070665_100091622 3300005548 Bacteria 3045
54 Ga0070704_100012580 3300005549 Bacteria 5230
55 Ga0070704_100024420 3300005549 Bacteria 3967
56 Ga0070664_100098673 3300005564 Bacteria 2538
57 Ga0070664_100471461 3300005564 Bacteria 1154
58 Ga0068857_100068220 3300005577 Bacteria 3166
59 Ga0068857_100101414 3300005577 Unclassified 2583
60 Ga0068854_100142503 3300005578 Unclassified 1841
61 Ga0068856_100173545 3300005614 Bacteria 2168
62 Ga0068856_100603878 3300005614 Bacteria 1118
63 Ga0068859_100011982 3300005617 Bacteria 8710
64 Ga0068859_100084920 3300005617 Bacteria 3210
65 Ga0068859_100165957 3300005617 Bacteria 2288
66 Ga0068859_100301146 3300005617 Bacteria 1696
67 Ga0068859_100325029 3300005617 Bacteria 1632
68 Ga0068864_100006668 3300005618 Bacteria 9453
69 Ga0068864_100087314 3300005618 Bacteria 2745
70 Ga0068864_100095563 3300005618 Bacteria 2628
71 Ga0068866_10173127 3300005718 Bacteria 1269
72 Ga0068866_10249474 3300005718 Bacteria 1085
73 Ga0068861_100013505 3300005719 Bacteria 5715
74 Ga0068861_100045245 3300005719 Bacteria 3313
75 Ga0068861_100460124 3300005719 Bacteria 1142
76 Ga0068861_100624210 3300005719 Unclassified 992
77 Ga0068863_100058494 3300005841 Bacteria 3647
78 Ga0068863_100302707 3300005841 Bacteria 1551
79 Ga0068858_100003869 3300005842 Bacteria 14793
80 Ga0068858_100010724 3300005842 Bacteria 8670
81 Ga0068858_100048613 3300005842 Bacteria 3929
82 Ga0068858_100142746 3300005842 Bacteria 2248
83 Ga0068858_100231496 3300005842 Bacteria 1752
84 Ga0068858_100341540 3300005842 Bacteria 1433
85 Ga0068858_100381779 3300005842 Unclassified 1352
86 Ga0068860_100027647 3300005843 Bacteria 5461
87 Ga0068860_100337829 3300005843 Bacteria 1480
88 Ga0068860_100560956 3300005843 Bacteria 1145
89 Ga0081455_10306850 3300005937 Bacteria 1136
90 Ga0097621_100000434 3300006237 Bacteria 29118
91 Ga0097621_100009378 3300006237 Bacteria 7102
92 Ga0097621_100038929 3300006237 Bacteria 3817
93 Ga0097621_100195735 3300006237 Bacteria 1752
94 Ga0097621_100238090 3300006237 Unclassified 1590
95 Ga0068871_100040658 3300006358 Bacteria 3725
96 Ga0068871_100063926 3300006358 Bacteria 3011
97 Ga0068871_100085717 3300006358 Unclassified 2616
98 Ga0068871_100097060 3300006358 Bacteria 2463
99 Ga0068871_100217255 3300006358 Bacteria 1655
100 Ga0075433_10042780 3300006852 Bacteria 3932
101 Ga0075433_10202323 3300006852 Bacteria 1766
102 Ga0075433_10422064 3300006852 Unclassified 1176
103 Ga0075433_10475189 3300006852 Bacteria 1101
104 Ga0075433_10486505 3300006852 Bacteria 1087
105 Ga0075434_100002939 3300006871 Bacteria 15151
106 Ga0075434_100025374 3300006871 Bacteria 5798
107 Ga0075434_100099629 3300006871 Bacteria 2911
108 Ga0075434_100648068 3300006871 Unclassified 1074
109 Ga0075436_100013561 3300006914 Bacteria 5581
110 Ga0075436_100035719 3300006914 Bacteria 3427
111 Ga0075436_100108178 3300006914 Bacteria 1939
112 Ga0097620_100011982 3300006931 Bacteria 8710
113 Ga0097620_100084921 3300006931 Bacteria 3210
114 Ga0097620_100165958 3300006931 Bacteria 2288
115 Ga0097620_100301139 3300006931 Bacteria 1696
116 Ga0097620_100325011 3300006931 Bacteria 1632
117 Ga0075435_100001670 3300007076 Bacteria 14403
118 Ga0075435_100008775 3300007076 Bacteria 7278
119 Ga0075435_100014350 3300007076 Bacteria 5918
120 Ga0075435_100051522 3300007076 Bacteria 3316
121 Ga0105240_10172994 3300009093 Bacteria 2556
122 Ga0105240_10228140 3300009093 Bacteria 2166
123 Ga0105240_10281670 3300009093 Bacteria 1909
124 Ga0111539_10014363 3300009094 Bacteria 9884
125 Ga0111539_10028397 3300009094 Bacteria 6826
126 Ga0111539_10235712 3300009094 Bacteria 2130
127 Ga0105245_10036978 3300009098 Bacteria 4339
128 Ga0105245_10062515 3300009098 Bacteria 3360
129 Ga0105245_10063368 3300009098 Bacteria 3338
130 Ga0105245_10465487 3300009098 Bacteria 1275
131 Ga0105247_10003456 3300009101 Bacteria 10297
132 Ga0114129_10002855 3300009147 Bacteria 24166
133 Ga0114129_10003232 3300009147 Bacteria 22871
134 Ga0114129_10003412 3300009147 Bacteria 22328
135 Ga0114129_10013722 3300009147 Bacteria 11547
136 Ga0114129_10021193 3300009147 Bacteria 9231
137 Ga0114129_10027891 3300009147 Bacteria 7995
138 Ga0114129_10045457 3300009147 Bacteria 6172
139 Ga0114129_10209076 3300009147 Bacteria 2639
140 Ga0114129_10286564 3300009147 Bacteria 2199
141 Ga0114129_10449830 3300009147 Bacteria 1689
142 Ga0105243_10062196 3300009148 Bacteria 2988
143 Ga0105242_10001526 3300009176 Bacteria 18195
144 Ga0105242_10008108 3300009176 Bacteria 8081
145 Ga0105242_10133403 3300009176 Bacteria 2147
146 Ga0105242_10435730 3300009176 Bacteria 1232
147 Ga0105248_10002676 3300009177 Bacteria 19788
148 Ga0105248_10007351 3300009177 Bacteria 12085
149 Ga0105248_10011401 3300009177 Bacteria 9799
150 Ga0105248_10014969 3300009177 Bacteria 8539
151 Ga0105248_10173828 3300009177 Bacteria 2428
152 Ga0105248_10209383 3300009177 Bacteria 2197
153 Ga0105248_10268502 3300009177 Bacteria 1921
154 Ga0105248_10298025 3300009177 Unclassified 1816
155 Ga0105248_10317433 3300009177 Bacteria 1755
156 Ga0105238_10150391 3300009551 Unclassified 2303
157 Ga0105238_10290297 3300009551 Unclassified 1618
158 Ga0105239_10527213 3300010375 Bacteria 1344
159 Ga0157369_10316560 3300013105 Bacteria 1622
160 Ga0157378_10122797 3300013297 Bacteria 2396
161 Ga0157378_10311283 3300013297 Bacteria 1527
162 Ga0157378_10966095 3300013297 Bacteria 885
163 Ga0163162_10016171 3300013306 Bacteria 7296
164 Ga0163162_10264681 3300013306 Bacteria 1851
165 Ga0157372_10257602 3300013307 Unclassified 2026
166 Ga0157375_10209637 3300013308 Bacteria 2106
167 Ga0157375_10231031 3300013308 Bacteria 2009
168 Ga0157375_10341223 3300013308 Bacteria 1663
169 Ga0157375_10356505 3300013308 Bacteria 1629
170 Ga0157375_10372900 3300013308 Bacteria 1593
171 Ga0157375_10499985 3300013308 Bacteria 1380
172 Ga0157375_10678050 3300013308 Bacteria 1185
173 Ga0163163_10004639 3300014325 Bacteria 11743
174 Ga0163163_10024602 3300014325 Bacteria 5732
175 Ga0163163_10084329 3300014325 Bacteria 3183
176 Ga0157380_10087890 3300014326 Bacteria 2556
177 Ga0157380_10163568 3300014326 Bacteria 1937
178 Ga0157380_10355461 3300014326 Bacteria 1372
179 Ga0157379_10069472 3300014968 Unclassified 3150
180 Ga0157379_10123354 3300014968 Bacteria 2331
181 Ga0157379_10154067 3300014968 Bacteria 2073
182 Ga0157379_10353868 3300014968 Unclassified 1345
183 Ga0157379_10381590 3300014968 Bacteria 1293
184 Ga0157376_10007090 3300014969 Bacteria 7957
185 Ga0157376_10013272 3300014969 Bacteria 6144
186 Ga0157376_10054202 3300014969 Bacteria 3342
187 Ga0157376_10255044 3300014969 Bacteria 1640
188 Ga0157376_10287616 3300014969 Bacteria 1551
189 Ga0157376_10381750 3300014969 Bacteria 1357
190 Ga0163161_10269276 3300017792 Bacteria 1332
191 Ga0207682_10030375 3300025893 Unclassified 2164
192 Ga0207642_10018838 3300025899 Bacteria 2659
193 Ga0207710_10019857 3300025900 Bacteria 2869
194 Ga0207680_10084707 3300025903 Bacteria 2001
195 Ga0207680_10288255 3300025903 Unclassified 1142
196 Ga0207645_10194100 3300025907 Bacteria 1335
197 Ga0207695_10127094 3300025913 Unclassified 2510
198 Ga0207695_10231370 3300025913 Bacteria 1752
199 Ga0207663_10299683 3300025916 Bacteria 1200
200 Ga0207662_10059353 3300025918 Bacteria 2292
201 Ga0207649_10102423 3300025920 Bacteria 1898
202 Ga0207649_10207367 3300025920 Bacteria 1388
203 Ga0207649_10266924 3300025920 Bacteria 1239
204 Ga0207646_10113479 3300025922 Bacteria 2433
205 Ga0207646_10203403 3300025922 Bacteria 1789
206 Ga0207681_10022014 3300025923 Bacteria 4060
207 Ga0207681_10029626 3300025923 Bacteria 3558
208 Ga0207650_10046251 3300025925 Bacteria 3205
209 Ga0207659_10135032 3300025926 Bacteria 1909
210 Ga0207687_10040174 3300025927 Unclassified 3206
211 Ga0207687_10081463 3300025927 Bacteria 2339
212 Ga0207687_10136198 3300025927 Bacteria 1857
213 Ga0207644_10033931 3300025931 Bacteria 3570
214 Ga0207690_10218702 3300025932 Bacteria 1456
215 Ga0207690_10291195 3300025932 Bacteria 1274
216 Ga0207706_10158701 3300025933 Unclassified 1989
217 Ga0207706_10244230 3300025933 Bacteria 1569
218 Ga0207686_10002007 3300025934 Bacteria 11232
219 Ga0207686_10016131 3300025934 Bacteria 4186
220 Ga0207709_10209439 3300025935 Unclassified 1398
221 Ga0207704_10047396 3300025938 Bacteria 2568
222 Ga0207704_10135874 3300025938 Unclassified 1711
223 Ga0207665_10237276 3300025939 Bacteria 1342
224 Ga0207691_10080075 3300025940 Bacteria 2939
225 Ga0207691_10376127 3300025940 Unclassified 1213
226 Ga0207711_10021450 3300025941 Bacteria 5396
227 Ga0207711_10077317 3300025941 Bacteria 2901
228 Ga0207711_10135878 3300025941 Bacteria 2208
229 Ga0207711_10150323 3300025941 Unclassified 2101
230 Ga0207711_10204327 3300025941 Bacteria 1803
231 Ga0207711_10277949 3300025941 Bacteria 1542
232 Ga0207711_10389258 3300025941 Bacteria 1294
233 Ga0207689_10108988 3300025942 Bacteria 2276
234 Ga0207679_10131482 3300025945 Unclassified 2009
235 Ga0207667_10213275 3300025949 Bacteria 1979
236 Ga0207667_10227989 3300025949 Bacteria 1908
237 Ga0207651_10009246 3300025960 Bacteria 5381
238 Ga0207651_10032979 3300025960 Bacteria 3334
239 Ga0207651_10263729 3300025960 Bacteria 1416
240 Ga0207668_10007999 3300025972 Bacteria 6293
241 Ga0207658_10089124 3300025986 Bacteria 2387
242 Ga0207703_10007832 3300026035 Bacteria 8450
243 Ga0207703_10068484 3300026035 Bacteria 2924
244 Ga0207708_10083553 3300026075 Bacteria 2455
245 Ga0207702_10033142 3300026078 Bacteria 4313
246 Ga0207641_10002725 3300026088 Bacteria 16112
247 Ga0207641_10017365 3300026088 Bacteria 5891
248 Ga0207641_10304368 3300026088 Bacteria 1507
249 Ga0207648_10194283 3300026089 Bacteria 1799
250 Ga0207648_10298669 3300026089 Unclassified 1444
251 Ga0207676_10023696 3300026095 Bacteria 4534
252 Ga0207676_10025021 3300026095 Bacteria 4426
253 Ga0207676_10066219 3300026095 Bacteria 2880
254 Ga0207674_10036223 3300026116 Bacteria 5144
255 Ga0207674_10143240 3300026116 Unclassified 2349
256 Ga0207674_10143868 3300026116 Bacteria 2343
257 Ga0207675_100043269 3300026118 Bacteria 4206
258 Ga0207675_100080307 3300026118 Bacteria 3057
259 Ga0207675_100157201 3300026118 Bacteria 2166
260 Ga0207683_10003587 3300026121 Bacteria 13535
261 Ga0207683_10056198 3300026121 Bacteria 3452
262 Ga0207428_10036863 3300027907 Bacteria 3983
263 Ga0268266_10006481 3300028379 Bacteria 10714
264 Ga0268266_10014665 3300028379 Bacteria 6733
265 Ga0268266_10032426 3300028379 Bacteria 4439
266 Ga0268266_10053190 3300028379 Unclassified 3478
267 Ga0268265_10003706 3300028380 Bacteria 10876
268 Ga0268265_10051706 3300028380 Bacteria 3102
269 Ga0268265_10724617 3300028380 Bacteria 963
270 Ga0268264_10140181 3300028381 Bacteria 2155
271 Ga0268264_10303430 3300028381 Bacteria 1504
272 Ga0268264_10328716 3300028381 Unclassified 1448
273 Ga0268264_10518090 3300028381 Bacteria 1165
274 Ga0265314_10018627 3300031711 Bacteria 5407
275 Ga0307405_10225568 3300031731 Bacteria 1378
276 Ga0307416_100095261 3300032002 Bacteria 2570
277 Ga0373930_0007831 3300034816 Bacteria 1850
278 Ga0373948_0000259 3300034817 Bacteria 6371
279 Ga0373958_0000107 3300034819 Bacteria 8936
280 Ga0373938_0000302 3300034957 Bacteria 7965
281 Ga0373928_0000957 3300035084 Bacteria 5677
282 Ga0373934_0026585 3300035086 Bacteria 2246
283 Ga0373940_0017346 3300035088 Unclassified 1795
284 Ga0373944_0009347 3300035089 Bacteria 2657
285 Ga0373944_0141700 3300035089 Bacteria 842
286 Ga0373949_0010768 3300035090 Unclassified 2008
287 Ga0373951_0002287 3300035091 Bacteria 4876
288 Ga0373952_0000600 3300035092 Bacteria 6371
289 Ga0373923_0096233 3300035111 Bacteria 1301
290 Ga0373932_0000545 3300035112 Bacteria 11539
291 Ga0373939_0000290 3300035114 Bacteria 13217
292 Ga0373941_0000240 3300035115 Bacteria 10555
293 Ga0373956_0042501 3300035119 Bacteria 2021
294 Ga0373943_0012846 3300035170 Bacteria 3775
295 Ga0373943_0044927 3300035170 Bacteria 2151
296 Ga0373946_0008794 3300035171 Bacteria 3707
297 Ga0373942_0000216 3300035207 Bacteria 15152
298 Ga0373961_0000740 3300035241 Bacteria 11292
299 Ga0373962_0004590 3300035242 Bacteria 3338
300 Ga0373931_0072817 3300035691 Bacteria 1880
301 Ga0373933_0079507 3300035724 Bacteria 2008
302 Ga0373933_0296212 3300035724 Bacteria 1047
303 Ga0373947_0010022 3300035725 Bacteria 5441
304 Ga0373937_0012396 3300036401 Bacteria 7497
305 Ga0373937_0208027 3300036401 Bacteria 1840
306 Ga0373937_0231539 3300036401 Bacteria 1740
307 Ga0373937_0252322 3300036401 Bacteria 1663
308 Ga0373925_0048787 3300037068 Bacteria 3156
309 Ga0373925_0069894 3300037068 Bacteria 2653
310 Ga0373925_0100111 3300037068 Bacteria 2227
311 Ga0450916_003007 3300042530 Bacteria 1828
312 Ga0466963_0135320 3300044694 Bacteria 1705
313 Ga0451576_0007443 3300045051 Bacteria 13082
314 Ga0451576_0126142 3300045051 Bacteria 2667
315 Ga0495580_0238820 3300046472 Bacteria 1246
316 Ga0495582_0082261 3300046473 Bacteria 1789
317 Ga0495582_0148161 3300046473 Bacteria 1332
318 Ga0495639_0087534 3300046475 Bacteria 1458
319 Ga0495608_0005022 3300046511 Bacteria 9466
320 Ga0495628_0062695 3300046516 Unclassified 2914
321 Ga0495628_0096399 3300046516 Bacteria 2285
322 Ga0495630_0019371 3300046517 Bacteria 5001
323 Ga0495640_0250110 3300046533 Unclassified 1110
324 Ga0495586_0155055 3300046535 Bacteria 1290
325 Ga0495621_0013153 3300046539 Bacteria 2596
326 Ga0495621_0165020 3300046539 Bacteria 878
327 Ga0495645_0001612 3300046543 Bacteria 15271
328 Ga0495667_0015946 3300046559 Bacteria 5079
329 Ga0495634_0028058 3300046642 Bacteria 3911
330 Ga0495635_0016280 3300046663 Bacteria 5192
331 Ga0495599_0109016 3300046678 Bacteria 1725
332 Ga0495599_0128820 3300046678 Unclassified 1572
333 Ga0495647_0065416 3300046681 Bacteria 1444
334 Ga0495658_0018696 3300046683 Bacteria 3607
335 Ga0495658_0268071 3300046683 Bacteria 1076
336 Ga0495669_0004879 3300046684 Bacteria 5566
337 Ga0495613_0081931 3300046689 Bacteria 2344
338 Ga0495600_0061611 3300046809 Bacteria 2451
339 Ga0495600_0065915 3300046809 Bacteria 2368
340 Ga0495581_0102626 3300047315 Bacteria 1662
341 Ga0495604_0031903 3300047317 Bacteria 4177
342 Ga0495674_0008046 3300047319 Bacteria 10065
343 Ga0495674_0361593 3300047319 Bacteria 1177
344 Ga0495674_0518619 3300047319 Unclassified 952
345 Ga0495680_0244355 3300047322 Bacteria 1274
346 Ga0495684_0000747 3300047471 Bacteria 26203
347 Ga0495684_0136743 3300047471 Unclassified 1839
348 Ga0496100_0015930 3300048903 Unclassified 4402
349 Ga0496101_0000503 3300048904 Bacteria 24571
350 Ga0496102_0184171 3300048905 Unclassified 1968
351 Ga0496102_0207472 3300048905 Bacteria 1847
352 Ga0496104_0007612 3300048907 Bacteria 9588
353 Ga0496104_0021320 3300048907 Bacteria 5947
354 Ga0496104_0059955 3300048907 Bacteria 3604
355 Ga0496104_0384648 3300048907 Bacteria 1316
356 Ga0496105_0060812 3300048908 Bacteria 3117
357 Ga0496105_0225363 3300048908 Bacteria 1525
358 Ga0496106_0003423 3300048909 Bacteria 11820
359 Ga0496106_0047537 3300048909 Bacteria 3230
360 Ga0496106_0260891 3300048909 Bacteria 1386
361 Ga0496108_0002181 3300048911 Bacteria 15709
362 Ga0496108_0037493 3300048911 Bacteria 4038
363 Ga0496108_0255641 3300048911 Bacteria 1524
364 Ga0496108_0593112 3300048911 Bacteria 966
365 Ga0496109_0144313 3300048912 Bacteria 2226
366 Ga0496110_0304610 3300048913 Bacteria 1451
367 Ga0496111_0195896 3300048914 Unclassified 1502
368 Ga0496112_0042270 3300048915 Bacteria 4458
369 Ga0496113_0102323 3300048916 Unclassified 2221
370 Ga0496113_0104168 3300048916 Bacteria 2201
371 Ga0496114_0000636 3300048917 Bacteria 25883
372 Ga0496114_0023956 3300048917 Bacteria 4981
373 Ga0496114_0106745 3300048917 Bacteria 2396
374 Ga0496114_0178765 3300048917 Unclassified 1852
375 Ga0501032_0043606 3300049569 Bacteria 3037
376 Ga0501034_0046645 3300049571 Bacteria 4378
377 Ga0501043_0063971 3300049579 Bacteria 2889
378 Ga0501073_0087412 3300049589 Bacteria 2168
379 Ga0501074_0262340 3300049590 Unclassified 1228
380 Ga0501080_0423749 3300049742 Bacteria 1195
381 Ga0501083_0289587 3300049744 Bacteria 1065
382 Ga0501044_0005292 3300049823 Bacteria 14348
383 nmdc:mga05p37_11145_c1 3300050507 Bacteria 10682
384 nmdc:mga05p37_15549_c1 3300050507 Bacteria 9147
385 nmdc:mga05p37_16537_c1 3300050507 Bacteria 8888
386 nmdc:mga05p37_175043_c1 3300050507 Unclassified 2615
387 nmdc:mga05p37_184713_c1 3300050507 Bacteria 2535
388 nmdc:mga05p37_57754_c1 3300050507 Bacteria 4779
389 nmdc:mga05p37_6413_c1 3300050507 Bacteria 13868
390 nmdc:mga05p37_74289_c1 3300050507 Bacteria 4184
391 nmdc:mga06r32_223240_c1 3300050510 Bacteria 1872
392 nmdc:mga08y16_10480_c1 3300050511 Bacteria 9723
393 nmdc:mga08y16_248981_c1 3300050511 Bacteria 1836
394 nmdc:mga0n895_10643_c1 3300050512 Bacteria 8142
395 nmdc:mga0n895_134200_c1 3300050512 Bacteria 2501
396 nmdc:mga0n895_217079_c1 3300050512 Bacteria 1942
397 nmdc:mga0n895_717419_c1 3300050512 Unclassified 995
398 nmdc:mga0n895_8333_c1 3300050512 Bacteria 8970
399 nmdc:mga0rr50_191_c1 3300050513 Bacteria 33287
400 nmdc:mga0rr50_21156_c1 3300050513 Bacteria 4435
401 nmdc:mga0rr50_3831_c1 3300050513 Bacteria 8732
402 nmdc:mga0rr50_79658_c1 3300050513 Bacteria 2523
403 nmdc:mga0rr50_84088_c1 3300050513 Bacteria 2463
404 nmdc:mga08x19_2617_c1 3300050514 Bacteria 10916
405 nmdc:mga08x19_64501_c1 3300050514 Bacteria 2378
406 nmdc:mga08x19_69563_c1 3300050514 Bacteria 2293
407 nmdc:mga08x19_98754_c1 3300050514 Bacteria 1935
408 nmdc:mga0a205_172807_c1 3300050515 Bacteria 2057
409 nmdc:mga0a205_224059_c1 3300050515 Bacteria 1765
410 nmdc:mga0a205_34203_c1 3300050515 Bacteria 4876
411 nmdc:mga0a205_433087_c1 3300050515 Unclassified 1176
412 Ga0495601_0000931 3300053077 Bacteria 15878
413 Ga0495601_0025128 3300053077 Bacteria 3671
414 Ga0495595_0050266 3300053084 Unclassified 1930
415 Ga0495619_0001802 3300053085 Bacteria 14250
416 Ga0495619_0052886 3300053085 Bacteria 2685
417 Ga0495619_0081195 3300053085 Unclassified 2183
418 Ga0495619_0085056 3300053085 Bacteria 2135
419 Ga0495619_0088516 3300053085 Unclassified 2094
420 Ga0500658_0039435 3300053134 Bacteria 1888
421 Ga0501084_0210198 3300054114 Bacteria 1642
422 Ga0070707_100039750
423 Ga0065712_10072362
424 Ga0070670_100028070
425 Ga0070670_100103158
426 Ga0070670_100320980
427 Ga0068869_100146070
428 Ga0070666_10018795
429 Ga0070666_10094231
430 Ga0068868_100060037
431 Ga0068868_100171740
432 Ga0068868_100452751
433 Ga0070660_100030378
434 Ga0070689_100045677
435 Ga0070669_100003556
436 Ga0070669_100035388
437 Ga0070669_100040487
438 Ga0070671_100027324
439 Ga0070671_100043280
440 Ga0070671_100305363
441 Ga0070674_100036936
442 Ga0070674_100067244
443 Ga0070673_100004287
444 Ga0070673_100033726
445 Ga0070673_100080753
446 Ga0070688_100249274
447 Ga0070659_100173354
448 Ga0070659_100326350
449 Ga0070667_100024224
450 Ga0070714_100029675
451 Ga0070713_100010070
452 Ga0070711_100378514
453 Ga0070694_100093442
454 Ga0070708_100502864
455 Ga0070678_100013951
456 Ga0070662_100237287
457 Ga0070681_10012443
458 Ga0070681_10516132
459 Ga0068867_100032719
460 Ga0068867_100243937
461 Ga0070707_100143288
462 Ga0070698_100035271
463 Ga0070698_100238368
464 Ga0070679_100282313
465 Ga0070697_100120867
466 Ga0070686_100000557
467 Ga0070686_100183380
468 Ga0070695_100001307
469 Ga0070695_100145727
470 Ga0070696_100033526
471 Ga0070696_100078476
472 Ga0070693_100186420
473 Ga0070665_100002605
474 Ga0070665_100091622
475 Ga0070704_100012580
476 Ga0070704_100024420
477 Ga0070664_100098673
478 Ga0070664_100471461
479 Ga0068857_100068220
480 Ga0068857_100101414
481 Ga0068854_100142503
482 Ga0068856_100173545
483 Ga0068856_100603878
484 Ga0068859_100011982
485 Ga0068859_100084920
486 Ga0068859_100165957
487 Ga0068859_100301146
488 Ga0068859_100325029
489 Ga0068864_100006668
490 Ga0068864_100087314
491 Ga0068864_100095563
492 Ga0068866_10173127
493 Ga0068866_10249474
494 Ga0068861_100013505
495 Ga0068861_100045245
496 Ga0068861_100460124
497 Ga0068861_100624210
498 Ga0068863_100058494
499 Ga0068863_100302707
500 Ga0068858_100003869
501 Ga0068858_100010724
502 Ga0068858_100048613
503 Ga0068858_100142746
504 Ga0068858_100231496
505 Ga0068858_100341540
506 Ga0068858_100381779
507 Ga0068860_100027647
508 Ga0068860_100337829
509 Ga0068860_100560956
510 Ga0081455_10306850
511 Ga0097621_100000434
512 Ga0097621_100009378
513 Ga0097621_100038929
514 Ga0097621_100195735
515 Ga0097621_100238090
516 Ga0068871_100040658
517 Ga0068871_100063926
518 Ga0068871_100085717
519 Ga0068871_100097060
520 Ga0068871_100217255
521 Ga0075433_10042780
522 Ga0075433_10202323
523 Ga0075433_10422064
524 Ga0075433_10475189
525 Ga0075433_10486505
526 Ga0075434_100002939
527 Ga0075434_100025374
528 Ga0075434_100099629
529 Ga0075434_100648068
530 Ga0075436_100013561
531 Ga0075436_100035719
532 Ga0075436_100108178
533 Ga0097620_100011982
534 Ga0097620_100084921
535 Ga0097620_100165958
536 Ga0097620_100301139
537 Ga0097620_100325011
538 Ga0075435_100001670
539 Ga0075435_100008775
540 Ga0075435_100014350
541 Ga0075435_100051522
542 Ga0105240_10172994
543 Ga0105240_10228140
544 Ga0105240_10281670
545 Ga0111539_10014363
546 Ga0111539_10028397
547 Ga0111539_10235712
548 Ga0105245_10036978
549 Ga0105245_10062515
550 Ga0105245_10063368
551 Ga0105245_10465487
552 Ga0105247_10003456
553 Ga0114129_10002855
554 Ga0114129_10003232
555 Ga0114129_10003412
556 Ga0114129_10013722
557 Ga0114129_10021193
558 Ga0114129_10027891
559 Ga0114129_10045457
560 Ga0114129_10209076
561 Ga0114129_10286564
562 Ga0114129_10449830
563 Ga0105243_10062196
564 Ga0105242_10001526
565 Ga0105242_10008108
566 Ga0105242_10133403
567 Ga0105242_10435730
568 Ga0105248_10002676
569 Ga0105248_10007351
570 Ga0105248_10011401
571 Ga0105248_10014969
572 Ga0105248_10173828
573 Ga0105248_10209383
574 Ga0105248_10268502
575 Ga0105248_10298025
576 Ga0105248_10317433
577 Ga0105238_10150391
578 Ga0105238_10290297
579 Ga0105239_10527213
580 Ga0157369_10316560
581 Ga0157378_10122797
582 Ga0157378_10311283
583 Ga0157378_10966095
584 Ga0163162_10016171
585 Ga0163162_10264681
586 Ga0157372_10257602
587 Ga0157375_10209637
588 Ga0157375_10231031
589 Ga0157375_10341223
590 Ga0157375_10356505
591 Ga0157375_10372900
592 Ga0157375_10499985
593 Ga0157375_10678050
594 Ga0163163_10004639
595 Ga0163163_10024602
596 Ga0163163_10084329
597 Ga0157380_10087890
598 Ga0157380_10163568
599 Ga0157380_10355461
600 Ga0157379_10069472
601 Ga0157379_10123354
602 Ga0157379_10154067
603 Ga0157379_10353868
604 Ga0157379_10381590
605 Ga0157376_10007090
606 Ga0157376_10013272
607 Ga0157376_10054202
608 Ga0157376_10255044
609 Ga0157376_10287616
610 Ga0157376_10381750
611 Ga0163161_10269276
612 Ga0207682_10030375
613 Ga0207642_10018838
614 Ga0207710_10019857
615 Ga0207680_10084707
616 Ga0207680_10288255
617 Ga0207645_10194100
618 Ga0207695_10127094
619 Ga0207695_10231370
620 Ga0207663_10299683
621 Ga0207662_10059353
622 Ga0207649_10102423
623 Ga0207649_10207367
624 Ga0207649_10266924
625 Ga0207646_10113479
626 Ga0207646_10203403
627 Ga0207681_10022014
628 Ga0207681_10029626
629 Ga0207650_10046251
630 Ga0207659_10135032
631 Ga0207687_10040174
632 Ga0207687_10081463
633 Ga0207687_10136198
634 Ga0207644_10033931
635 Ga0207690_10218702
636 Ga0207690_10291195
637 Ga0207706_10158701
638 Ga0207706_10244230
639 Ga0207686_10002007
640 Ga0207686_10016131
641 Ga0207709_10209439
642 Ga0207704_10047396
643 Ga0207704_10135874
644 Ga0207665_10237276
645 Ga0207691_10080075
646 Ga0207691_10376127
647 Ga0207711_10021450
648 Ga0207711_10077317
649 Ga0207711_10135878
650 Ga0207711_10150323
651 Ga0207711_10204327
652 Ga0207711_10277949
653 Ga0207711_10389258
654 Ga0207689_10108988
655 Ga0207679_10131482
656 Ga0207667_10213275
657 Ga0207667_10227989
658 Ga0207651_10009246
659 Ga0207651_10032979
660 Ga0207651_10263729
661 Ga0207668_10007999
662 Ga0207658_10089124
663 Ga0207703_10007832
664 Ga0207703_10068484
665 Ga0207708_10083553
666 Ga0207702_10033142
667 Ga0207641_10002725
668 Ga0207641_10017365
669 Ga0207641_10304368
670 Ga0207648_10194283
671 Ga0207648_10298669
672 Ga0207676_10023696
673 Ga0207676_10025021
674 Ga0207676_10066219
675 Ga0207674_10036223
676 Ga0207674_10143240
677 Ga0207674_10143868
678 Ga0207675_100043269
679 Ga0207675_100080307
680 Ga0207675_100157201
681 Ga0207683_10003587
682 Ga0207683_10056198
683 Ga0207428_10036863
684 Ga0268266_10006481
685 Ga0268266_10014665
686 Ga0268266_10032426
687 Ga0268266_10053190
688 Ga0268265_10003706
689 Ga0268265_10051706
690 Ga0268265_10724617
691 Ga0268264_10140181
692 Ga0268264_10303430
693 Ga0268264_10328716
694 Ga0268264_10518090
695 Ga0265314_10018627
696 Ga0307405_10225568
697 Ga0307416_100095261
698 Ga0373930_0007831
699 Ga0373948_0000259
700 Ga0373958_0000107
701 Ga0373938_0000302
702 Ga0373928_0000957
703 Ga0373934_0026585
704 Ga0373940_0017346
705 Ga0373944_0009347
706 Ga0373944_0141700
707 Ga0373949_0010768
708 Ga0373951_0002287
709 Ga0373952_0000600
710 Ga0373923_0096233
711 Ga0373932_0000545
712 Ga0373939_0000290
713 Ga0373941_0000240
714 Ga0373956_0042501
715 Ga0373943_0012846
716 Ga0373943_0044927
717 Ga0373946_0008794
718 Ga0373942_0000216
719 Ga0373961_0000740
720 Ga0373962_0004590
721 Ga0373931_0072817
722 Ga0373933_0079507
723 Ga0373933_0296212
724 Ga0373947_0010022
725 Ga0373937_0012396
726 Ga0373937_0208027
727 Ga0373937_0231539
728 Ga0373937_0252322
729 Ga0373925_0048787
730 Ga0373925_0069894
731 Ga0373925_0100111
732 Ga0450916_003007
733 Ga0466963_0135320
734 Ga0451576_0007443
735 Ga0451576_0126142
736 Ga0495580_0238820
737 Ga0495582_0082261
738 Ga0495582_0148161
739 Ga0495639_0087534
740 Ga0495608_0005022
741 Ga0495628_0062695
742 Ga0495628_0096399
743 Ga0495630_0019371
744 Ga0495640_0250110
745 Ga0495586_0155055
746 Ga0495621_0013153
747 Ga0495621_0165020
748 Ga0495645_0001612
749 Ga0495667_0015946
750 Ga0495634_0028058
751 Ga0495635_0016280
752 Ga0495599_0109016
753 Ga0495599_0128820
754 Ga0495647_0065416
755 Ga0495658_0018696
756 Ga0495658_0268071
757 Ga0495669_0004879
758 Ga0495613_0081931
759 Ga0495600_0061611
760 Ga0495600_0065915
761 Ga0495581_0102626
762 Ga0495604_0031903
763 Ga0495674_0008046
764 Ga0495674_0361593
765 Ga0495674_0518619
766 Ga0495680_0244355
767 Ga0495684_0000747
768 Ga0495684_0136743
769 Ga0496100_0015930
770 Ga0496101_0000503
771 Ga0496102_0184171
772 Ga0496102_0207472
773 Ga0496104_0007612
774 Ga0496104_0021320
775 Ga0496104_0059955
776 Ga0496104_0384648
777 Ga0496105_0060812
778 Ga0496105_0225363
779 Ga0496106_0003423
780 Ga0496106_0047537
781 Ga0496106_0260891
782 Ga0496108_0002181
783 Ga0496108_0037493
784 Ga0496108_0255641
785 Ga0496108_0593112
786 Ga0496109_0144313
787 Ga0496110_0304610
788 Ga0496111_0195896
789 Ga0496112_0042270
790 Ga0496113_0102323
791 Ga0496113_0104168
792 Ga0496114_0000636
793 Ga0496114_0023956
794 Ga0496114_0106745
795 Ga0496114_0178765
796 Ga0501032_0043606
797 Ga0501034_0046645
798 Ga0501043_0063971
799 Ga0501073_0087412
800 Ga0501074_0262340
801 Ga0501080_0423749
802 Ga0501083_0289587
803 Ga0501044_0005292
804 nmdc:mga05p37_11145_c1
805 nmdc:mga05p37_15549_c1
806 nmdc:mga05p37_16537_c1
807 nmdc:mga05p37_175043_c1
808 nmdc:mga05p37_184713_c1
809 nmdc:mga05p37_57754_c1
810 nmdc:mga05p37_6413_c1
811 nmdc:mga05p37_74289_c1
812 nmdc:mga06r32_223240_c1
813 nmdc:mga08y16_10480_c1
814 nmdc:mga08y16_248981_c1
815 nmdc:mga0n895_10643_c1
816 nmdc:mga0n895_134200_c1
817 nmdc:mga0n895_217079_c1
818 nmdc:mga0n895_717419_c1
819 nmdc:mga0n895_8333_c1
820 nmdc:mga0rr50_191_c1
821 nmdc:mga0rr50_21156_c1
822 nmdc:mga0rr50_3831_c1
823 nmdc:mga0rr50_79658_c1
824 nmdc:mga0rr50_84088_c1
825 nmdc:mga08x19_2617_c1
826 nmdc:mga08x19_64501_c1
827 nmdc:mga08x19_69563_c1
828 nmdc:mga08x19_98754_c1
829 nmdc:mga0a205_172807_c1
830 nmdc:mga0a205_224059_c1
831 nmdc:mga0a205_34203_c1
832 nmdc:mga0a205_433087_c1
833 Ga0495601_0000931
834 Ga0495601_0025128
835 Ga0495595_0050266
836 Ga0495619_0001802
837 Ga0495619_0052886
838 Ga0495619_0081195
839 Ga0495619_0085056
840 Ga0495619_0088516
841 Ga0500658_0039435
842 Ga0501084_0210198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

26

156

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7t-assembly2.cif.gz_B rv1170 (mshb) from mycobacterium tuberculosis 0.7413 8 255
1q7t-assembly1.cif.gz_A rv1170 (mshb) from mycobacterium tuberculosis 0.7333 8 255
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.733 8 244
1q74-assembly1.cif.gz_A the crystal structure of 1d-myo-inositol 2-acetamido-2-deoxy-alpha-d-glucopyranoside deacetylase (mshb) 0.7317 8 255
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.7308 8 244
ID Description Score Start End Superfamily
af_L0T643_2_220_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8347 7 243 3.40.50.10320
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8258 2 215 3.40.50.10320
af_Q2G0L0_1_219_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.81 9 246 3.40.50.10320
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8009 2 215 3.40.50.10320
af_L0T643_2_220_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7958 7 243 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7Y4TH48-F1-model_v4 PIG-L family deacetylase 0.9428 36 257 GO:0016811
AF-A0A0G1F4D1-F1-model_v4 N-acetylglucosaminylphosphatidylinositol deacetylase 0.9362 8 142 GO:0016811
AF-A0A2E6ZTV9-F1-model_v4 PIG-L family deacetylase 0.9342 9 257 GO:0016811
AF-A0A3M2KV35-F1-model_v4 PIG-L family deacetylase 0.9289 10 137 GO:0016811
AF-A0A7Y4TH48-F1-model_v4 PIG-L family deacetylase 0.9263 36 257 GO:0016811

Map