F437445

General Info

Members Datasets Scaffolds Average Seq Length
411 217 822 213

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100014944|Ga0070680_1000149445
Length 228
Sequence LNFAREGLLFIAIAAVVAAGAFGFAVTRRSWGLWLAAFVLLLLALWVAYFFRDPERVGERGPTLIVAPADGKLIMITEVDEPSFVQGRAIRLSIFMNVFNVHVNRYPVDGVVKYIHYNKGKFFNAAAEKSSLENEQMSVGLETTPADTGRTPRVGTTQKILVRQIAGLIARRIVTYSKVGEQVKQGDRMGIIRFGSRVDLFLPIGSTVRGKLGDMTTAGVTVLGELPH

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.19
Rhizosphere 97.57
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100014944 3300005336 Bacteria 6076
2 JGI25406J46586_10000150 3300003203 Bacteria 30726
3 JGI25406J46586_10089918 3300003203 Bacteria 928
4 Ga0065715_10254851 3300005293 Bacteria 1155
5 Ga0070658_10008738 3300005327 Bacteria 8136
6 Ga0070658_10024940 3300005327 Bacteria 4795
7 Ga0070658_10207941 3300005327 Unclassified 1653
8 Ga0070676_10223333 3300005328 Bacteria 1245
9 Ga0070683_100005536 3300005329 Bacteria 10551
10 Ga0070683_100011527 3300005329 Bacteria 7647
11 Ga0070683_100019045 3300005329 Bacteria 6090
12 Ga0070683_100044964 3300005329 Bacteria 4075
13 Ga0070683_100122630 3300005329 Bacteria 2455
14 Ga0070683_100242658 3300005329 Bacteria 1714
15 Ga0070690_100053092 3300005330 Bacteria 2592
16 Ga0070690_100134035 3300005330 Bacteria 1676
17 Ga0070670_100005849 3300005331 Bacteria 10397
18 Ga0070670_100244014 3300005331 Unclassified 1564
19 Ga0068869_100001276 3300005334 Bacteria 14887
20 Ga0068869_100041212 3300005334 Bacteria 3305
21 Ga0070680_100000152 3300005336 Bacteria 42779
22 Ga0070680_100003670 3300005336 Bacteria 11465
23 Ga0070680_100090243 3300005336 Unclassified 2536
24 Ga0070682_100001409 3300005337 Bacteria 13536
25 Ga0070682_100011598 3300005337 Bacteria 5039
26 Ga0070682_100018101 3300005337 Bacteria 4113
27 Ga0068868_100029623 3300005338 Bacteria 4193
28 Ga0068868_100126516 3300005338 Bacteria 2088
29 Ga0070660_100003771 3300005339 Bacteria 10473
30 Ga0070660_100005380 3300005339 Bacteria 8861
31 Ga0070660_100021776 3300005339 Bacteria 4731
32 Ga0070689_100126335 3300005340 Bacteria 2047
33 Ga0070691_10008316 3300005341 Bacteria 4752
34 Ga0070687_100217471 3300005343 Bacteria 1168
35 Ga0070661_100000736 3300005344 Bacteria 23848
36 Ga0070692_10027220 3300005345 Bacteria 2832
37 Ga0070692_10030153 3300005345 Bacteria 2710
38 Ga0070668_100340288 3300005347 Bacteria 1267
39 Ga0070668_100797662 3300005347 Unclassified 839
40 Ga0070669_100027566 3300005353 Bacteria 4088
41 Ga0070669_100140244 3300005353 Bacteria 1863
42 Ga0070675_100015795 3300005354 Bacteria 5976
43 Ga0070675_100210772 3300005354 Bacteria 1689
44 Ga0070671_100034286 3300005355 Bacteria 4202
45 Ga0070671_100048715 3300005355 Bacteria 3524
46 Ga0070674_100002412 3300005356 Bacteria 10324
47 Ga0070673_100150600 3300005364 Bacteria 1970
48 Ga0070673_100156522 3300005364 Unclassified 1934
49 Ga0070673_100587576 3300005364 Bacteria 1015
50 Ga0070688_100091628 3300005365 Bacteria 1987
51 Ga0070688_100099983 3300005365 Unclassified 1910
52 Ga0070659_100001269 3300005366 Bacteria 18314
53 Ga0070667_100638223 3300005367 Bacteria 983
54 Ga0070703_10066242 3300005406 Bacteria 1194
55 Ga0070709_10015100 3300005434 Bacteria 4387
56 Ga0070709_10419750 3300005434 Unclassified 1002
57 Ga0070713_100024231 3300005436 Bacteria 4724
58 Ga0070713_100083213 3300005436 Bacteria 2735
59 Ga0070710_10046647 3300005437 Bacteria 2414
60 Ga0070701_10141191 3300005438 Bacteria 1378
61 Ga0070700_100221040 3300005441 Bacteria 1342
62 Ga0070694_100015652 3300005444 Bacteria 4767
63 Ga0070694_100491619 3300005444 Bacteria 975
64 Ga0070708_100000070 3300005445 Bacteria 67477
65 Ga0070678_100008320 3300005456 Bacteria 6212
66 Ga0070678_100550593 3300005456 Bacteria 1024
67 Ga0070662_100000616 3300005457 Bacteria 21670
68 Ga0070681_10018522 3300005458 Bacteria 6959
69 Ga0070681_10041608 3300005458 Bacteria 4605
70 Ga0070681_10119424 3300005458 Bacteria 2572
71 Ga0070681_10137142 3300005458 Bacteria 2377
72 Ga0070681_10544836 3300005458 Bacteria 1074
73 Ga0068867_100235369 3300005459 Bacteria 1482
74 Ga0070706_100011199 3300005467 Bacteria 8328
75 Ga0070706_100195232 3300005467 Bacteria 1891
76 Ga0070706_100209366 3300005467 Bacteria 1821
77 Ga0070706_100214068 3300005467 Bacteria 1799
78 Ga0070707_100027070 3300005468 Bacteria 5452
79 Ga0070707_100090587 3300005468 Bacteria 2960
80 Ga0070707_100209117 3300005468 Bacteria 1902
81 Ga0070698_100024429 3300005471 Bacteria 6306
82 Ga0070699_100093243 3300005518 Bacteria 2634
83 Ga0070699_100225092 3300005518 Bacteria 1672
84 Ga0070699_100371955 3300005518 Bacteria 1289
85 Ga0070679_100003237 3300005530 Bacteria 14878
86 Ga0070679_100006930 3300005530 Bacteria 10572
87 Ga0070679_100009647 3300005530 Bacteria 9131
88 Ga0070679_100060505 3300005530 Bacteria 3774
89 Ga0070679_100147506 3300005530 Bacteria 2330
90 Ga0070679_100325460 3300005530 Bacteria 1486
91 Ga0070684_100007826 3300005535 Bacteria 8335
92 Ga0070684_100020832 3300005535 Bacteria 5442
93 Ga0070684_100027010 3300005535 Bacteria 4840
94 Ga0070684_100040320 3300005535 Bacteria 4020
95 Ga0070684_100059587 3300005535 Unclassified 3338
96 Ga0070684_100064531 3300005535 Bacteria 3213
97 Ga0070697_100371284 3300005536 Bacteria 1238
98 Ga0068853_100021064 3300005539 Bacteria 5428
99 Ga0068853_100156304 3300005539 Bacteria 2055
100 Ga0068853_100219740 3300005539 Bacteria 1735
101 Ga0070672_100179352 3300005543 Bacteria 1764
102 Ga0070686_100305694 3300005544 Bacteria 1181
103 Ga0070695_100020140 3300005545 Bacteria 4071
104 Ga0070695_100070180 3300005545 Bacteria 2291
105 Ga0070696_100163568 3300005546 Unclassified 1641
106 Ga0070696_100217583 3300005546 Bacteria 1432
107 Ga0070696_100558377 3300005546 Unclassified 918
108 Ga0070693_100011550 3300005547 Bacteria 4450
109 Ga0070693_100031116 3300005547 Bacteria 2923
110 Ga0070693_100126635 3300005547 Bacteria 1591
111 Ga0070665_100401548 3300005548 Bacteria 1379
112 Ga0070704_100019231 3300005549 Bacteria 4386
113 Ga0070704_100053913 3300005549 Bacteria 2844
114 Ga0068855_100013928 3300005563 Bacteria 9698
115 Ga0068855_100035483 3300005563 Bacteria 5939
116 Ga0068855_100108040 3300005563 Bacteria 3196
117 Ga0068855_100291819 3300005563 Bacteria 1808
118 Ga0068855_100662337 3300005563 Bacteria 1120
119 Ga0068855_100729313 3300005563 Bacteria 1058
120 Ga0070664_100068882 3300005564 Bacteria 3026
121 Ga0068857_100000982 3300005577 Bacteria 21839
122 Ga0068857_100084752 3300005577 Bacteria 2832
123 Ga0068854_100004971 3300005578 Bacteria 8382
124 Ga0068854_100644672 3300005578 Bacteria 909
125 Ga0068856_100011069 3300005614 Bacteria 8759
126 Ga0068856_100206013 3300005614 Bacteria 1981
127 Ga0068856_100411908 3300005614 Bacteria 1371
128 Ga0070702_100001245 3300005615 Bacteria 10333
129 Ga0070702_100010143 3300005615 Bacteria 4630
130 Ga0068852_100057913 3300005616 Bacteria 3354
131 Ga0068852_100380855 3300005616 Bacteria 1384
132 Ga0068859_100419473 3300005617 Bacteria 1434
133 Ga0068864_100051411 3300005618 Bacteria 3550
134 Ga0068864_100079909 3300005618 Bacteria 2864
135 Ga0068864_100176041 3300005618 Bacteria 1953
136 Ga0068866_10000286 3300005718 Bacteria 24203
137 Ga0068861_100119893 3300005719 Bacteria 2120
138 Ga0068870_10007666 3300005840 Bacteria 4827
139 Ga0068870_10095959 3300005840 Bacteria 1667
140 Ga0068863_100015752 3300005841 Bacteria 7260
141 Ga0068858_100112080 3300005842 Bacteria 2548
142 Ga0068860_100034592 3300005843 Bacteria 4848
143 Ga0068860_100115966 3300005843 Bacteria 2562
144 Ga0081539_10030563 3300005985 Bacteria 3340
145 Ga0070716_100093030 3300006173 Bacteria 1829
146 Ga0097621_100425479 3300006237 Bacteria 1192
147 Ga0068871_100042263 3300006358 Bacteria 3658
148 Ga0068865_100006228 3300006881 Bacteria 7274
149 Ga0075436_100013384 3300006914 Bacteria 5620
150 Ga0097620_100419480 3300006931 Bacteria 1434
151 Ga0105240_10032132 3300009093 Bacteria 6797
152 Ga0105240_10139235 3300009093 Bacteria 2903
153 Ga0105240_10363990 3300009093 Bacteria 1637
154 Ga0105240_10445228 3300009093 Bacteria 1451
155 Ga0105240_10503340 3300009093 Bacteria 1347
156 Ga0105245_10004091 3300009098 Bacteria 12946
157 Ga0105245_10049933 3300009098 Bacteria 3748
158 Ga0105245_10311254 3300009098 Bacteria 1549
159 Ga0105243_10099593 3300009148 Bacteria 2409
160 Ga0105241_10000046 3300009174 Bacteria 97861
161 Ga0105241_10013012 3300009174 Bacteria 6102
162 Ga0105241_10031449 3300009174 Bacteria 3974
163 Ga0105242_10027734 3300009176 Bacteria 4501
164 Ga0105242_10095208 3300009176 Bacteria 2513
165 Ga0105242_10361114 3300009176 Bacteria 1344
166 Ga0105248_10012353 3300009177 Bacteria 9424
167 Ga0105248_10018472 3300009177 Bacteria 7706
168 Ga0105248_10052639 3300009177 Bacteria 4568
169 Ga0105248_10097334 3300009177 Bacteria 3315
170 Ga0105248_10099311 3300009177 Bacteria 3280
171 Ga0105249_10143443 3300009553 Bacteria 2292
172 Ga0105249_10446537 3300009553 Bacteria 1331
173 Ga0105239_10044271 3300010375 Bacteria 4880
174 Ga0105246_10004300 3300011119 Bacteria 8662
175 Ga0105246_10029342 3300011119 Bacteria 3622
176 Ga0157373_10386826 3300013100 Bacteria 1001
177 Ga0157371_10002595 3300013102 Bacteria 17153
178 Ga0157371_10023253 3300013102 Bacteria 4532
179 Ga0157371_10601948 3300013102 Bacteria 818
180 Ga0157370_10001327 3300013104 Bacteria 30737
181 Ga0157370_10041084 3300013104 Bacteria 4464
182 Ga0157370_10124776 3300013104 Bacteria 2404
183 Ga0157369_10013531 3300013105 Bacteria 9220
184 Ga0157369_10013974 3300013105 Bacteria 9074
185 Ga0157369_10015602 3300013105 Bacteria 8561
186 Ga0157369_10066177 3300013105 Bacteria 3888
187 Ga0157369_10220843 3300013105 Bacteria 1984
188 Ga0157369_10363827 3300013105 Bacteria 1502
189 Ga0157369_10554226 3300013105 Bacteria 1188
190 Ga0157374_10157117 3300013296 Unclassified 2214
191 Ga0157374_10159933 3300013296 Bacteria 2194
192 Ga0157374_10543545 3300013296 Bacteria 1169
193 Ga0157374_10681808 3300013296 Bacteria 1040
194 Ga0157378_11059024 3300013297 Bacteria 847
195 Ga0157378_11143293 3300013297 Bacteria 817
196 Ga0163162_10161840 3300013306 Bacteria 2360
197 Ga0163162_10591208 3300013306 Bacteria 1236
198 Ga0163162_11086632 3300013306 Bacteria 906
199 Ga0157372_10002631 3300013307 Bacteria 19448
200 Ga0157372_10010051 3300013307 Bacteria 10062
201 Ga0157372_10020576 3300013307 Bacteria 7121
202 Ga0157372_10024798 3300013307 Bacteria 6517
203 Ga0157372_10028666 3300013307 Bacteria 6078
204 Ga0157372_10179571 3300013307 Bacteria 2450
205 Ga0157372_10637304 3300013307 Bacteria 1241
206 Ga0157375_10027708 3300013308 Bacteria 5300
207 Ga0157375_10068313 3300013308 Bacteria 3556
208 Ga0157375_10227086 3300013308 Bacteria 2026
209 Ga0157375_10633048 3300013308 Bacteria 1227
210 Ga0163163_10013941 3300014325 Bacteria 7375
211 Ga0163163_10084180 3300014325 Bacteria 3186
212 Ga0157380_10077310 3300014326 Bacteria 2712
213 Ga0157379_10066038 3300014968 Bacteria 3234
214 Ga0157376_10003451 3300014969 Bacteria 10890
215 Ga0157376_10195442 3300014969 Bacteria 1858
216 Ga0163161_10074962 3300017792 Bacteria 2482
217 Ga0206353_10709312 3300020082 Bacteria 1694
218 Ga0207653_10042003 3300025885 Bacteria 1503
219 Ga0207642_10000840 3300025899 Bacteria 9534
220 Ga0207699_10044716 3300025906 Bacteria 2579
221 Ga0207699_10510780 3300025906 Unclassified 868
222 Ga0207645_10028110 3300025907 Bacteria 3631
223 Ga0207643_10026053 3300025908 Bacteria 3235
224 Ga0207705_10002736 3300025909 Bacteria 13518
225 Ga0207705_10159125 3300025909 Unclassified 1696
226 Ga0207705_10263051 3300025909 Bacteria 1317
227 Ga0207684_10457326 3300025910 Bacteria 1096
228 Ga0207654_10000057 3300025911 Bacteria 75851
229 Ga0207654_10014753 3300025911 Bacteria 4041
230 Ga0207707_10002361 3300025912 Bacteria 17006
231 Ga0207707_10046717 3300025912 Bacteria 3771
232 Ga0207707_10049049 3300025912 Bacteria 3679
233 Ga0207707_10398184 3300025912 Bacteria 1182
234 Ga0207695_10002761 3300025913 Bacteria 25587
235 Ga0207695_10004126 3300025913 Bacteria 19950
236 Ga0207695_10461989 3300025913 Bacteria 1152
237 Ga0207663_10409636 3300025916 Bacteria 1038
238 Ga0207660_10000035 3300025917 Bacteria 65610
239 Ga0207660_10001620 3300025917 Bacteria 15099
240 Ga0207660_10052885 3300025917 Bacteria 2893
241 Ga0207660_10151506 3300025917 Bacteria 1782
242 Ga0207660_10404645 3300025917 Bacteria 1099
243 Ga0207657_10008241 3300025919 Bacteria 10607
244 Ga0207657_10013399 3300025919 Bacteria 8046
245 Ga0207657_10029195 3300025919 Bacteria 5023
246 Ga0207649_10011669 3300025920 Bacteria 4854
247 Ga0207652_10084580 3300025921 Bacteria 2779
248 Ga0207652_10106960 3300025921 Bacteria 2477
249 Ga0207652_10125902 3300025921 Bacteria 2282
250 Ga0207646_10115784 3300025922 Bacteria 2408
251 Ga0207646_10171889 3300025922 Unclassified 1957
252 Ga0207646_10291361 3300025922 Bacteria 1475
253 Ga0207681_10028965 3300025923 Bacteria 3591
254 Ga0207681_10141180 3300025923 Bacteria 1794
255 Ga0207659_10161994 3300025926 Bacteria 1757
256 Ga0207687_10170421 3300025927 Bacteria 1679
257 Ga0207687_10249943 3300025927 Bacteria 1409
258 Ga0207687_10696500 3300025927 Bacteria 862
259 Ga0207700_10064835 3300025928 Bacteria 2784
260 Ga0207644_10220504 3300025931 Bacteria 1503
261 Ga0207644_10516704 3300025931 Unclassified 986
262 Ga0207690_10004041 3300025932 Bacteria 8664
263 Ga0207690_10123564 3300025932 Bacteria 1884
264 Ga0207690_10192512 3300025932 Bacteria 1543
265 Ga0207706_10000116 3300025933 Bacteria 85356
266 Ga0207706_10017685 3300025933 Bacteria 6423
267 Ga0207706_10144443 3300025933 Unclassified 2093
268 Ga0207686_10017156 3300025934 Bacteria 4075
269 Ga0207709_10080475 3300025935 Bacteria 2098
270 Ga0207670_10094237 3300025936 Bacteria 2124
271 Ga0207669_10004359 3300025937 Bacteria 6218
272 Ga0207704_10072668 3300025938 Bacteria 2187
273 Ga0207665_10000382 3300025939 Bacteria 30416
274 Ga0207691_10083410 3300025940 Bacteria 2869
275 Ga0207711_10029176 3300025941 Bacteria 4650
276 Ga0207711_10044795 3300025941 Bacteria 3778
277 Ga0207689_10000178 3300025942 Bacteria 55729
278 Ga0207689_10001407 3300025942 Bacteria 22971
279 Ga0207661_10002349 3300025944 Bacteria 13036
280 Ga0207661_10027918 3300025944 Bacteria 4317
281 Ga0207661_10096100 3300025944 Bacteria 2478
282 Ga0207661_10185645 3300025944 Bacteria 1819
283 Ga0207679_10008696 3300025945 Bacteria 6474
284 Ga0207679_10049832 3300025945 Bacteria 3057
285 Ga0207667_10018835 3300025949 Bacteria 7730
286 Ga0207667_10039060 3300025949 Bacteria 5060
287 Ga0207667_10051345 3300025949 Bacteria 4348
288 Ga0207667_10052642 3300025949 Bacteria 4286
289 Ga0207667_10062331 3300025949 Bacteria 3899
290 Ga0207667_10106145 3300025949 Bacteria 2897
291 Ga0207667_10394067 3300025949 Bacteria 1410
292 Ga0207651_10114688 3300025960 Unclassified 2030
293 Ga0207651_10129647 3300025960 Bacteria 1928
294 Ga0207712_10001922 3300025961 Bacteria 13662
295 Ga0207712_10190450 3300025961 Bacteria 1619
296 Ga0207668_10064029 3300025972 Bacteria 2597
297 Ga0207640_10023491 3300025981 Bacteria 3706
298 Ga0207658_10041454 3300025986 Bacteria 3334
299 Ga0207677_10030712 3300026023 Bacteria 3433
300 Ga0207677_10035104 3300026023 Bacteria 3253
301 Ga0207677_10343379 3300026023 Bacteria 1248
302 Ga0207703_10032784 3300026035 Bacteria 4113
303 Ga0207639_10016524 3300026041 Bacteria 5225
304 Ga0207639_10146957 3300026041 Bacteria 1970
305 Ga0207678_10002659 3300026067 Bacteria 16239
306 Ga0207678_10174697 3300026067 Bacteria 1834
307 Ga0207708_10070998 3300026075 Bacteria 2667
308 Ga0207702_10006386 3300026078 Bacteria 10176
309 Ga0207702_10012470 3300026078 Bacteria 7074
310 Ga0207702_10195745 3300026078 Bacteria 1871
311 Ga0207702_10382801 3300026078 Bacteria 1353
312 Ga0207641_10247236 3300026088 Bacteria 1664
313 Ga0207648_10000168 3300026089 Bacteria 67700
314 Ga0207648_10075574 3300026089 Bacteria 2936
315 Ga0207676_10101565 3300026095 Bacteria 2385
316 Ga0207676_10269786 3300026095 Bacteria 1540
317 Ga0207674_10000096 3300026116 Bacteria 98870
318 Ga0207674_10010553 3300026116 Bacteria 10454
319 Ga0207675_100053591 3300026118 Bacteria 3764
320 Ga0207675_101154192 3300026118 Bacteria 795
321 Ga0207683_10049442 3300026121 Bacteria 3681
322 Ga0207683_10242552 3300026121 Bacteria 1644
323 Ga0207698_10020246 3300026142 Bacteria 4575
324 Ga0210000_1010596 3300027462 Bacteria 1364
325 Ga0268266_10851155 3300028379 Bacteria 881
326 Ga0268265_10199268 3300028380 Bacteria 1736
327 Ga0268264_10152442 3300028381 Bacteria 2074
328 Ga0265332_10006274 3300031238 Bacteria 5409
329 Ga0265340_10095190 3300031247 Bacteria 1389
330 Ga0265314_10040976 3300031711 Bacteria 3319
331 Ga0307410_10364656 3300031852 Bacteria 1158
332 Ga0373956_0018154 3300035119 Bacteria 2975
333 Ga0373931_0150723 3300035691 Bacteria 1355
334 Ga0373935_0036661 3300035692 Bacteria 3067
335 Ga0373927_0048170 3300035695 Bacteria 2756
336 Ga0373927_0057371 3300035695 Bacteria 2518
337 Ga0373947_0040247 3300035725 Bacteria 2783
338 Ga0373937_0978017 3300036401 Archaea 795
339 Ga0373925_0024065 3300037068 Bacteria 4445
340 Ga0451853_3665973 3300041512 Bacteria 1522
341 Ga0451577_0102897 3300042876 Bacteria 2552
342 Ga0451576_0053265 3300045051 Bacteria 4239
343 Ga0451576_0141899 3300045051 Bacteria 2504
344 Ga0451576_0350841 3300045051 Bacteria 1545
345 Ga0451576_0700374 3300045051 Bacteria 1064
346 Ga0495603_0210786 3300046455 Bacteria 1122
347 Ga0495629_0016914 3300046459 Bacteria 5234
348 Ga0495651_0128894 3300046462 Bacteria 1849
349 Ga0495651_0186168 3300046462 Bacteria 1465
350 Ga0495580_0062608 3300046472 Bacteria 2610
351 Ga0495580_0329436 3300046472 Archaea 1037
352 Ga0495582_0035906 3300046473 Bacteria 2726
353 Ga0495582_0045882 3300046473 Unclassified 2407
354 Ga0495582_0139508 3300046473 Bacteria 1373
355 Ga0495664_0237192 3300046477 Bacteria 1103
356 Ga0495594_0010180 3300046499 Bacteria 4874
357 Ga0495594_0106037 3300046499 Bacteria 1583
358 Ga0495594_0130946 3300046499 Bacteria 1421
359 Ga0495594_0176713 3300046499 Bacteria 1215
360 Ga0495666_0133327 3300046526 Archaea 1160
361 Ga0495640_0229177 3300046533 Unclassified 1169
362 Ga0495586_0008671 3300046535 Bacteria 5413
363 Ga0495586_0010174 3300046535 Bacteria 5007
364 Ga0495587_0002308 3300046536 Bacteria 12770
365 Ga0495645_0000639 3300046543 Bacteria 24143
366 Ga0495667_0097116 3300046559 Bacteria 1907
367 Ga0495656_0330187 3300046615 Bacteria 787
368 Ga0495599_0083935 3300046678 Bacteria 1989
369 Ga0495623_0001530 3300046679 Bacteria 15620
370 Ga0495658_0186570 3300046683 Bacteria 1288
371 Ga0495581_0012916 3300047315 Bacteria 4840
372 Ga0495674_0051211 3300047319 Bacteria 3641
373 Ga0495674_0530247 3300047319 Bacteria 939
374 Ga0495675_0021500 3300047444 Bacteria 4109
375 Ga0495684_0024281 3300047471 Bacteria 4666
376 Ga0495684_0123318 3300047471 Bacteria 1950
377 Ga0495602_0195564 3300048088 Bacteria 1547
378 Ga0496101_0719806 3300048904 Bacteria 788
379 Ga0496104_0220078 3300048907 Bacteria 1811
380 Ga0496106_0207188 3300048909 Bacteria 1561
381 Ga0496108_0196367 3300048911 Bacteria 1750
382 Ga0496109_0375436 3300048912 Bacteria 1343
383 Ga0496110_0187535 3300048913 Bacteria 1878
384 Ga0496112_0003153 3300048915 Bacteria 13546
385 Ga0496113_0161322 3300048916 Bacteria 1772
386 Ga0496114_0041445 3300048917 Bacteria 3816
387 Ga0501033_0003163 3300049570 Bacteria 13680
388 Ga0501034_0146197 3300049571 Bacteria 2341
389 Ga0501034_0355319 3300049571 Bacteria 1393
390 Ga0501034_0368997 3300049571 Bacteria 1362
391 Ga0501034_0414258 3300049571 Bacteria 1269
392 Ga0501036_0029967 3300049572 Bacteria 4598
393 Ga0501038_0130558 3300049574 Bacteria 2063
394 Ga0501043_0020788 3300049579 Bacteria 5148
395 Ga0501043_0273790 3300049579 Bacteria 1295
396 Ga0501047_0002753 3300049581 Bacteria 16716
397 Ga0501047_0562342 3300049581 Bacteria 964
398 Ga0501070_0032868 3300049586 Bacteria 4340
399 Ga0501070_0245034 3300049586 Bacteria 1467
400 Ga0501070_0339726 3300049586 Bacteria 1220
401 Ga0501079_0127896 3300049741 Bacteria 1976
402 Ga0501035_0009893 3300049822 Bacteria 8853
403 Ga0501044_0009604 3300049823 Bacteria 10528
404 Ga0501044_0036266 3300049823 Bacteria 5160
405 nmdc:mga0n895_339552_c1 3300050512 Bacteria 1521
406 nmdc:mga08x19_488337_c1 3300050514 Unclassified 869
407 Ga0495601_0055654 3300053077 Bacteria 2505
408 Ga0495601_0144759 3300053077 Bacteria 1551
409 Ga0495595_0039809 3300053084 Bacteria 2146
410 Ga0501084_0165111 3300054114 Bacteria 1869
411 Ga0501082_0684101 3300060353 Bacteria 898
412 Ga0070680_100014944
413 JGI25406J46586_10000150
414 JGI25406J46586_10089918
415 Ga0065715_10254851
416 Ga0070658_10008738
417 Ga0070658_10024940
418 Ga0070658_10207941
419 Ga0070676_10223333
420 Ga0070683_100005536
421 Ga0070683_100011527
422 Ga0070683_100019045
423 Ga0070683_100044964
424 Ga0070683_100122630
425 Ga0070683_100242658
426 Ga0070690_100053092
427 Ga0070690_100134035
428 Ga0070670_100005849
429 Ga0070670_100244014
430 Ga0068869_100001276
431 Ga0068869_100041212
432 Ga0070680_100000152
433 Ga0070680_100003670
434 Ga0070680_100090243
435 Ga0070682_100001409
436 Ga0070682_100011598
437 Ga0070682_100018101
438 Ga0068868_100029623
439 Ga0068868_100126516
440 Ga0070660_100003771
441 Ga0070660_100005380
442 Ga0070660_100021776
443 Ga0070689_100126335
444 Ga0070691_10008316
445 Ga0070687_100217471
446 Ga0070661_100000736
447 Ga0070692_10027220
448 Ga0070692_10030153
449 Ga0070668_100340288
450 Ga0070668_100797662
451 Ga0070669_100027566
452 Ga0070669_100140244
453 Ga0070675_100015795
454 Ga0070675_100210772
455 Ga0070671_100034286
456 Ga0070671_100048715
457 Ga0070674_100002412
458 Ga0070673_100150600
459 Ga0070673_100156522
460 Ga0070673_100587576
461 Ga0070688_100091628
462 Ga0070688_100099983
463 Ga0070659_100001269
464 Ga0070667_100638223
465 Ga0070703_10066242
466 Ga0070709_10015100
467 Ga0070709_10419750
468 Ga0070713_100024231
469 Ga0070713_100083213
470 Ga0070710_10046647
471 Ga0070701_10141191
472 Ga0070700_100221040
473 Ga0070694_100015652
474 Ga0070694_100491619
475 Ga0070708_100000070
476 Ga0070678_100008320
477 Ga0070678_100550593
478 Ga0070662_100000616
479 Ga0070681_10018522
480 Ga0070681_10041608
481 Ga0070681_10119424
482 Ga0070681_10137142
483 Ga0070681_10544836
484 Ga0068867_100235369
485 Ga0070706_100011199
486 Ga0070706_100195232
487 Ga0070706_100209366
488 Ga0070706_100214068
489 Ga0070707_100027070
490 Ga0070707_100090587
491 Ga0070707_100209117
492 Ga0070698_100024429
493 Ga0070699_100093243
494 Ga0070699_100225092
495 Ga0070699_100371955
496 Ga0070679_100003237
497 Ga0070679_100006930
498 Ga0070679_100009647
499 Ga0070679_100060505
500 Ga0070679_100147506
501 Ga0070679_100325460
502 Ga0070684_100007826
503 Ga0070684_100020832
504 Ga0070684_100027010
505 Ga0070684_100040320
506 Ga0070684_100059587
507 Ga0070684_100064531
508 Ga0070697_100371284
509 Ga0068853_100021064
510 Ga0068853_100156304
511 Ga0068853_100219740
512 Ga0070672_100179352
513 Ga0070686_100305694
514 Ga0070695_100020140
515 Ga0070695_100070180
516 Ga0070696_100163568
517 Ga0070696_100217583
518 Ga0070696_100558377
519 Ga0070693_100011550
520 Ga0070693_100031116
521 Ga0070693_100126635
522 Ga0070665_100401548
523 Ga0070704_100019231
524 Ga0070704_100053913
525 Ga0068855_100013928
526 Ga0068855_100035483
527 Ga0068855_100108040
528 Ga0068855_100291819
529 Ga0068855_100662337
530 Ga0068855_100729313
531 Ga0070664_100068882
532 Ga0068857_100000982
533 Ga0068857_100084752
534 Ga0068854_100004971
535 Ga0068854_100644672
536 Ga0068856_100011069
537 Ga0068856_100206013
538 Ga0068856_100411908
539 Ga0070702_100001245
540 Ga0070702_100010143
541 Ga0068852_100057913
542 Ga0068852_100380855
543 Ga0068859_100419473
544 Ga0068864_100051411
545 Ga0068864_100079909
546 Ga0068864_100176041
547 Ga0068866_10000286
548 Ga0068861_100119893
549 Ga0068870_10007666
550 Ga0068870_10095959
551 Ga0068863_100015752
552 Ga0068858_100112080
553 Ga0068860_100034592
554 Ga0068860_100115966
555 Ga0081539_10030563
556 Ga0070716_100093030
557 Ga0097621_100425479
558 Ga0068871_100042263
559 Ga0068865_100006228
560 Ga0075436_100013384
561 Ga0097620_100419480
562 Ga0105240_10032132
563 Ga0105240_10139235
564 Ga0105240_10363990
565 Ga0105240_10445228
566 Ga0105240_10503340
567 Ga0105245_10004091
568 Ga0105245_10049933
569 Ga0105245_10311254
570 Ga0105243_10099593
571 Ga0105241_10000046
572 Ga0105241_10013012
573 Ga0105241_10031449
574 Ga0105242_10027734
575 Ga0105242_10095208
576 Ga0105242_10361114
577 Ga0105248_10012353
578 Ga0105248_10018472
579 Ga0105248_10052639
580 Ga0105248_10097334
581 Ga0105248_10099311
582 Ga0105249_10143443
583 Ga0105249_10446537
584 Ga0105239_10044271
585 Ga0105246_10004300
586 Ga0105246_10029342
587 Ga0157373_10386826
588 Ga0157371_10002595
589 Ga0157371_10023253
590 Ga0157371_10601948
591 Ga0157370_10001327
592 Ga0157370_10041084
593 Ga0157370_10124776
594 Ga0157369_10013531
595 Ga0157369_10013974
596 Ga0157369_10015602
597 Ga0157369_10066177
598 Ga0157369_10220843
599 Ga0157369_10363827
600 Ga0157369_10554226
601 Ga0157374_10157117
602 Ga0157374_10159933
603 Ga0157374_10543545
604 Ga0157374_10681808
605 Ga0157378_11059024
606 Ga0157378_11143293
607 Ga0163162_10161840
608 Ga0163162_10591208
609 Ga0163162_11086632
610 Ga0157372_10002631
611 Ga0157372_10010051
612 Ga0157372_10020576
613 Ga0157372_10024798
614 Ga0157372_10028666
615 Ga0157372_10179571
616 Ga0157372_10637304
617 Ga0157375_10027708
618 Ga0157375_10068313
619 Ga0157375_10227086
620 Ga0157375_10633048
621 Ga0163163_10013941
622 Ga0163163_10084180
623 Ga0157380_10077310
624 Ga0157379_10066038
625 Ga0157376_10003451
626 Ga0157376_10195442
627 Ga0163161_10074962
628 Ga0206353_10709312
629 Ga0207653_10042003
630 Ga0207642_10000840
631 Ga0207699_10044716
632 Ga0207699_10510780
633 Ga0207645_10028110
634 Ga0207643_10026053
635 Ga0207705_10002736
636 Ga0207705_10159125
637 Ga0207705_10263051
638 Ga0207684_10457326
639 Ga0207654_10000057
640 Ga0207654_10014753
641 Ga0207707_10002361
642 Ga0207707_10046717
643 Ga0207707_10049049
644 Ga0207707_10398184
645 Ga0207695_10002761
646 Ga0207695_10004126
647 Ga0207695_10461989
648 Ga0207663_10409636
649 Ga0207660_10000035
650 Ga0207660_10001620
651 Ga0207660_10052885
652 Ga0207660_10151506
653 Ga0207660_10404645
654 Ga0207657_10008241
655 Ga0207657_10013399
656 Ga0207657_10029195
657 Ga0207649_10011669
658 Ga0207652_10084580
659 Ga0207652_10106960
660 Ga0207652_10125902
661 Ga0207646_10115784
662 Ga0207646_10171889
663 Ga0207646_10291361
664 Ga0207681_10028965
665 Ga0207681_10141180
666 Ga0207659_10161994
667 Ga0207687_10170421
668 Ga0207687_10249943
669 Ga0207687_10696500
670 Ga0207700_10064835
671 Ga0207644_10220504
672 Ga0207644_10516704
673 Ga0207690_10004041
674 Ga0207690_10123564
675 Ga0207690_10192512
676 Ga0207706_10000116
677 Ga0207706_10017685
678 Ga0207706_10144443
679 Ga0207686_10017156
680 Ga0207709_10080475
681 Ga0207670_10094237
682 Ga0207669_10004359
683 Ga0207704_10072668
684 Ga0207665_10000382
685 Ga0207691_10083410
686 Ga0207711_10029176
687 Ga0207711_10044795
688 Ga0207689_10000178
689 Ga0207689_10001407
690 Ga0207661_10002349
691 Ga0207661_10027918
692 Ga0207661_10096100
693 Ga0207661_10185645
694 Ga0207679_10008696
695 Ga0207679_10049832
696 Ga0207667_10018835
697 Ga0207667_10039060
698 Ga0207667_10051345
699 Ga0207667_10052642
700 Ga0207667_10062331
701 Ga0207667_10106145
702 Ga0207667_10394067
703 Ga0207651_10114688
704 Ga0207651_10129647
705 Ga0207712_10001922
706 Ga0207712_10190450
707 Ga0207668_10064029
708 Ga0207640_10023491
709 Ga0207658_10041454
710 Ga0207677_10030712
711 Ga0207677_10035104
712 Ga0207677_10343379
713 Ga0207703_10032784
714 Ga0207639_10016524
715 Ga0207639_10146957
716 Ga0207678_10002659
717 Ga0207678_10174697
718 Ga0207708_10070998
719 Ga0207702_10006386
720 Ga0207702_10012470
721 Ga0207702_10195745
722 Ga0207702_10382801
723 Ga0207641_10247236
724 Ga0207648_10000168
725 Ga0207648_10075574
726 Ga0207676_10101565
727 Ga0207676_10269786
728 Ga0207674_10000096
729 Ga0207674_10010553
730 Ga0207675_100053591
731 Ga0207675_101154192
732 Ga0207683_10049442
733 Ga0207683_10242552
734 Ga0207698_10020246
735 Ga0210000_1010596
736 Ga0268266_10851155
737 Ga0268265_10199268
738 Ga0268264_10152442
739 Ga0265332_10006274
740 Ga0265340_10095190
741 Ga0265314_10040976
742 Ga0307410_10364656
743 Ga0373956_0018154
744 Ga0373931_0150723
745 Ga0373935_0036661
746 Ga0373927_0048170
747 Ga0373927_0057371
748 Ga0373947_0040247
749 Ga0373937_0978017
750 Ga0373925_0024065
751 Ga0451853_3665973
752 Ga0451577_0102897
753 Ga0451576_0053265
754 Ga0451576_0141899
755 Ga0451576_0350841
756 Ga0451576_0700374
757 Ga0495603_0210786
758 Ga0495629_0016914
759 Ga0495651_0128894
760 Ga0495651_0186168
761 Ga0495580_0062608
762 Ga0495580_0329436
763 Ga0495582_0035906
764 Ga0495582_0045882
765 Ga0495582_0139508
766 Ga0495664_0237192
767 Ga0495594_0010180
768 Ga0495594_0106037
769 Ga0495594_0130946
770 Ga0495594_0176713
771 Ga0495666_0133327
772 Ga0495640_0229177
773 Ga0495586_0008671
774 Ga0495586_0010174
775 Ga0495587_0002308
776 Ga0495645_0000639
777 Ga0495667_0097116
778 Ga0495656_0330187
779 Ga0495599_0083935
780 Ga0495623_0001530
781 Ga0495658_0186570
782 Ga0495581_0012916
783 Ga0495674_0051211
784 Ga0495674_0530247
785 Ga0495675_0021500
786 Ga0495684_0024281
787 Ga0495684_0123318
788 Ga0495602_0195564
789 Ga0496101_0719806
790 Ga0496104_0220078
791 Ga0496106_0207188
792 Ga0496108_0196367
793 Ga0496109_0375436
794 Ga0496110_0187535
795 Ga0496112_0003153
796 Ga0496113_0161322
797 Ga0496114_0041445
798 Ga0501033_0003163
799 Ga0501034_0146197
800 Ga0501034_0355319
801 Ga0501034_0368997
802 Ga0501034_0414258
803 Ga0501036_0029967
804 Ga0501038_0130558
805 Ga0501043_0020788
806 Ga0501043_0273790
807 Ga0501047_0002753
808 Ga0501047_0562342
809 Ga0501070_0032868
810 Ga0501070_0245034
811 Ga0501070_0339726
812 Ga0501079_0127896
813 Ga0501035_0009893
814 Ga0501044_0009604
815 Ga0501044_0036266
816 nmdc:mga0n895_339552_c1
817 nmdc:mga08x19_488337_c1
818 Ga0495601_0055654
819 Ga0495601_0144759
820 Ga0495595_0039809
821 Ga0501084_0165111
822 Ga0501082_0684101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

43

224

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i23-assembly1.cif.gz_C clostridium thermocellum rna polymerase transcription open complex with sigi1 and its promoter 0.7059 109 186
7yh5-assembly3.cif.gz_E mazg(mycobacterium tuberculosis) 0.6634 2 52
3dfy-assembly2.cif.gz_K crystal structure of apo dipeptide epimerase from thermotoga maritima 0.6491 115 162
3dfy-assembly2.cif.gz_P crystal structure of apo dipeptide epimerase from thermotoga maritima 0.6213 115 162
4z17-assembly1.cif.gz_B thermostable enolase from chloroflexus aurantiacus 0.6052 114 158
ID Description Score Start End Superfamily
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9737 50 219 2.70.70.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9464 50 219 2.70.70.10
af_P39006_187_491_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8494 94 218 1.25.10.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8346 48 219 2.70.70.10
af_Q9UTB5_356_515_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8298 97 216 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A3D3JDM5-F1-model_v4 deleted 0.985 66 221
AF-A0A7Z9S463-F1-model_v4 Phosphatidylserine decarboxylase family protein (EC 4.1.1.65) 0.9835 95 221 GO:0004609
GO:0005886
GO:0008654
AF-A0A1A3DMM6-F1-model_v4 Phosphatidylserine decarboxylase 0.9809 64 222 GO:0004609
GO:0005886
GO:0008654
AF-A0A656KSX9-F1-model_v4 deleted 0.9807 68 222
AF-A0A1V3WNV3-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9805 111 222 GO:0004609
GO:0005886
GO:0008654

Map