F435873

General Info

Members Datasets Scaffolds Average Seq Length
405 230 810 149

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100283052|Ga0070669_1002830522
Length 134
Sequence MSRRKWMAVVSLAGLFLGVYLTLYHYGFIGTLACNVSSCEKVQTSRWSMLFGLPVATWGAGFYALMLTLTVAGLQPRYEASRGLALLNYLEAFVLHAWCEWCLGSATMVLILFVLALVDWRETATLGNEEIATD

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 1.23
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 23.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100283052 3300005353 Bacteria 1329
2 Ga0058863_10169688 3300004799 Bacteria 3632
3 Ga0058861_11888633 3300004800 Bacteria 1094
4 Ga0058862_12855174 3300004803 Bacteria 763
5 Ga0065712_10132096 3300005290 Unclassified 1537
6 Ga0065715_10848970 3300005293 Unclassified 592
7 Ga0070658_10002687 3300005327 Bacteria 14792
8 Ga0070658_10079835 3300005327 Bacteria 2687
9 Ga0070658_10479803 3300005327 Bacteria 1073
10 Ga0070676_10083463 3300005328 Bacteria 1943
11 Ga0070676_10113503 3300005328 Bacteria 1691
12 Ga0070683_100012314 3300005329 Bacteria 7430
13 Ga0070683_100025502 3300005329 Bacteria 5310
14 Ga0070683_100027485 3300005329 Bacteria 5130
15 Ga0070683_100038849 3300005329 Bacteria 4365
16 Ga0070683_100064767 3300005329 Bacteria 3403
17 Ga0070683_100122531 3300005329 Unclassified 2457
18 Ga0070683_100493863 3300005329 Unclassified 1169
19 Ga0070683_100706334 3300005329 Bacteria 966
20 Ga0070690_100007982 3300005330 Bacteria 6075
21 Ga0070690_100058314 3300005330 Bacteria 2479
22 Ga0070690_100555725 3300005330 Bacteria 866
23 Ga0070670_100252491 3300005331 Bacteria 1536
24 Ga0070670_100949926 3300005331 Unclassified 780
25 Ga0070677_10183894 3300005333 Bacteria 997
26 Ga0068869_100000533 3300005334 Bacteria 21249
27 Ga0068869_100354552 3300005334 Unclassified 1197
28 Ga0070680_100000187 3300005336 Bacteria 40138
29 Ga0070680_100002251 3300005336 Bacteria 14251
30 Ga0070680_100026642 3300005336 Bacteria 4623
31 Ga0070682_100003385 3300005337 Bacteria 8846
32 Ga0068868_100006275 3300005338 Bacteria 8409
33 Ga0068868_100738960 3300005338 Unclassified 883
34 Ga0070660_100077494 3300005339 Bacteria 2605
35 Ga0070689_100009138 3300005340 Bacteria 7018
36 Ga0070687_100008380 3300005343 Bacteria 4377
37 Ga0070687_100827263 3300005343 Unclassified 658
38 Ga0070661_100000707 3300005344 Bacteria 24445
39 Ga0070661_100797412 3300005344 Unclassified 775
40 Ga0070692_10011137 3300005345 Bacteria 4121
41 Ga0070668_100341538 3300005347 Bacteria 1265
42 Ga0070669_100114711 3300005353 Bacteria 2048
43 Ga0070675_100007124 3300005354 Bacteria 8612
44 Ga0070675_100022944 3300005354 Bacteria 4987
45 Ga0070671_100251876 3300005355 Bacteria 1500
46 Ga0070671_101220547 3300005355 Bacteria 662
47 Ga0070674_100123349 3300005356 Bacteria 1921
48 Ga0070673_100108968 3300005364 Unclassified 2294
49 Ga0070673_100331975 3300005364 Bacteria 1346
50 Ga0070688_100005772 3300005365 Bacteria 6544
51 Ga0070688_100898664 3300005365 Unclassified 698
52 Ga0070688_100947628 3300005365 Unclassified 681
53 Ga0070659_100296089 3300005366 Bacteria 1348
54 Ga0070667_100133340 3300005367 Bacteria 2170
55 Ga0070667_100968423 3300005367 Unclassified 793
56 Ga0070714_100126910 3300005435 Bacteria 2276
57 Ga0070713_100046289 3300005436 Bacteria 3569
58 Ga0070713_100264225 3300005436 Bacteria 1574
59 Ga0070701_10117639 3300005438 Unclassified 1493
60 Ga0070711_100289751 3300005439 Bacteria 1298
61 Ga0070708_100000036 3300005445 Bacteria 86294
62 Ga0070708_100743910 3300005445 Unclassified 922
63 Ga0070678_100380579 3300005456 Unclassified 1221
64 Ga0070678_100805752 3300005456 Unclassified 853
65 Ga0070678_101271251 3300005456 Bacteria 684
66 Ga0070662_100124635 3300005457 Bacteria 1978
67 Ga0070681_10007193 3300005458 Bacteria 10847
68 Ga0070681_10012965 3300005458 Bacteria 8278
69 Ga0070681_10048565 3300005458 Bacteria 4240
70 Ga0068867_100145862 3300005459 Bacteria 1855
71 Ga0070685_10006893 3300005466 Bacteria 5800
72 Ga0070707_100687364 3300005468 Unclassified 986
73 Ga0070679_100001041 3300005530 Bacteria 24203
74 Ga0070679_100007683 3300005530 Bacteria 10094
75 Ga0070679_100040979 3300005530 Bacteria 4609
76 Ga0070679_100712570 3300005530 Bacteria 946
77 Ga0070684_100005777 3300005535 Bacteria 9515
78 Ga0070684_100009260 3300005535 Bacteria 7751
79 Ga0070684_100016885 3300005535 Bacteria 5978
80 Ga0070684_100062146 3300005535 Bacteria 3271
81 Ga0070684_100068552 3300005535 Bacteria 3118
82 Ga0070684_100643132 3300005535 Unclassified 987
83 Ga0070672_100007363 3300005543 Bacteria 7459
84 Ga0070686_100227610 3300005544 Bacteria 1351
85 Ga0070695_100008722 3300005545 Bacteria 6026
86 Ga0070693_100007810 3300005547 Bacteria 5245
87 Ga0070665_100100365 3300005548 Bacteria 2898
88 Ga0070665_100344628 3300005548 Bacteria 1495
89 Ga0068855_100016401 3300005563 Bacteria 8906
90 Ga0068855_100023066 3300005563 Bacteria 7459
91 Ga0068855_100676750 3300005563 Bacteria 1106
92 Ga0070664_100001891 3300005564 Bacteria 16808
93 Ga0070664_100025047 3300005564 Bacteria 4943
94 Ga0070664_100224956 3300005564 Unclassified 1680
95 Ga0070664_101114377 3300005564 Bacteria 744
96 Ga0070664_101292126 3300005564 Unclassified 689
97 Ga0068857_100001744 3300005577 Bacteria 17493
98 Ga0068857_100374998 3300005577 Bacteria 1320
99 Ga0068856_100001046 3300005614 Bacteria 29354
100 Ga0068856_100169122 3300005614 Bacteria 2198
101 Ga0070702_100000266 3300005615 Bacteria 17860
102 Ga0070702_100783864 3300005615 Unclassified 735
103 Ga0068852_100010900 3300005616 Bacteria 6811
104 Ga0068852_100032085 3300005616 Bacteria 4345
105 Ga0068852_100657340 3300005616 Bacteria 1056
106 Ga0068859_100006639 3300005617 Bacteria 11749
107 Ga0068859_100046406 3300005617 Bacteria 4363
108 Ga0068859_100108583 3300005617 Bacteria 2836
109 Ga0068864_100113433 3300005618 Bacteria 2416
110 Ga0068864_100638393 3300005618 Unclassified 1036
111 Ga0068861_100409014 3300005719 Unclassified 1206
112 Ga0068870_10009484 3300005840 Bacteria 4432
113 Ga0068870_10037510 3300005840 Bacteria 2498
114 Ga0068863_100005740 3300005841 Bacteria 12177
115 Ga0068863_102019046 3300005841 Unclassified 587
116 Ga0068858_100054311 3300005842 Bacteria 3704
117 Ga0068858_100645027 3300005842 Bacteria 1029
118 Ga0068860_100016481 3300005843 Bacteria 7207
119 Ga0068862_100147573 3300005844 Bacteria 2091
120 Ga0081455_10187438 3300005937 Bacteria 1561
121 Ga0070712_100209435 3300006175 Bacteria 1536
122 Ga0097621_100001310 3300006237 Bacteria 17124
123 Ga0068871_100040147 3300006358 Bacteria 3747
124 Ga0068871_100127573 3300006358 Bacteria 2154
125 Ga0075434_100516946 3300006871 Bacteria 1214
126 Ga0075434_101057804 3300006871 Unclassified 825
127 Ga0068865_100182250 3300006881 Bacteria 1618
128 Ga0068865_101022698 3300006881 Unclassified 724
129 Ga0075436_100161593 3300006914 Bacteria 1579
130 Ga0097620_100006639 3300006931 Bacteria 11749
131 Ga0097620_100046406 3300006931 Bacteria 4363
132 Ga0097620_100108579 3300006931 Bacteria 2836
133 Ga0075435_100333153 3300007076 Unclassified 1300
134 Ga0075435_100749179 3300007076 Bacteria 850
135 Ga0105240_11375778 3300009093 Bacteria 742
136 Ga0111539_10263220 3300009094 Bacteria 2007
137 Ga0105245_10006776 3300009098 Bacteria 10043
138 Ga0105245_10024397 3300009098 Bacteria 5310
139 Ga0105245_10242557 3300009098 Unclassified 1747
140 Ga0105245_11652890 3300009098 Unclassified 692
141 Ga0105243_10027649 3300009148 Bacteria 4348
142 Ga0105243_11989950 3300009148 Unclassified 615
143 Ga0105241_10011130 3300009174 Bacteria 6598
144 Ga0105241_10835531 3300009174 Unclassified 851
145 Ga0105241_11227412 3300009174 Unclassified 711
146 Ga0105242_10004781 3300009176 Bacteria 10477
147 Ga0105242_10070590 3300009176 Bacteria 2896
148 Ga0105242_11396861 3300009176 Unclassified 727
149 Ga0105248_10000565 3300009177 Bacteria 42008
150 Ga0105248_10016696 3300009177 Bacteria 8081
151 Ga0105248_10058309 3300009177 Bacteria 4336
152 Ga0105248_10086711 3300009177 Bacteria 3522
153 Ga0105248_10207067 3300009177 Bacteria 2210
154 Ga0105248_10477035 3300009177 Bacteria 1406
155 Ga0105237_10164387 3300009545 Unclassified 2218
156 Ga0105238_10188883 3300009551 Unclassified 2037
157 Ga0105238_10466926 3300009551 Bacteria 1260
158 Ga0105249_11020166 3300009553 Bacteria 896
159 Ga0105239_10203511 3300010375 Bacteria 2218
160 Ga0105239_10566004 3300010375 Bacteria 1295
161 Ga0157373_10001620 3300013100 Bacteria 17168
162 Ga0157373_10427072 3300013100 Bacteria 952
163 Ga0157370_10000540 3300013104 Bacteria 47409
164 Ga0157370_11239734 3300013104 Unclassified 672
165 Ga0157369_10051703 3300013105 Bacteria 4446
166 Ga0157369_10211971 3300013105 Bacteria 2030
167 Ga0157369_10352272 3300013105 Unclassified 1529
168 Ga0157369_10406029 3300013105 Unclassified 1413
169 Ga0157369_11110752 3300013105 Bacteria 808
170 Ga0157374_10338435 3300013296 Bacteria 1493
171 Ga0157374_10391165 3300013296 Bacteria 1386
172 Ga0157374_10430809 3300013296 Unclassified 1319
173 Ga0157378_10093018 3300013297 Bacteria 2744
174 Ga0157378_12190403 3300013297 Bacteria 604
175 Ga0163162_10087669 3300013306 Bacteria 3191
176 Ga0163162_10416576 3300013306 Bacteria 1476
177 Ga0157372_10003916 3300013307 Bacteria 15995
178 Ga0157372_10010522 3300013307 Bacteria 9845
179 Ga0157372_10026919 3300013307 Bacteria 6259
180 Ga0157372_10048240 3300013307 Bacteria 4734
181 Ga0157372_10105787 3300013307 Unclassified 3218
182 Ga0157372_10137572 3300013307 Unclassified 2814
183 Ga0157372_10139685 3300013307 Bacteria 2790
184 Ga0157372_10151939 3300013307 Bacteria 2673
185 Ga0157372_11047015 3300013307 Unclassified 944
186 Ga0157372_11898722 3300013307 Bacteria 685
187 Ga0157375_10007941 3300013308 Bacteria 9289
188 Ga0157375_10049832 3300013308 Unclassified 4105
189 Ga0157375_10056914 3300013308 Bacteria 3863
190 Ga0157375_11849115 3300013308 Bacteria 716
191 Ga0163163_10011859 3300014325 Bacteria 7924
192 Ga0163163_10031527 3300014325 Bacteria 5117
193 Ga0163163_10104774 3300014325 Bacteria 2854
194 Ga0157377_10000590 3300014745 Bacteria 15062
195 Ga0157379_10358253 3300014968 Bacteria 1337
196 Ga0157379_10825135 3300014968 Bacteria 876
197 Ga0157376_10064127 3300014969 Bacteria 3097
198 Ga0157376_10096168 3300014969 Bacteria 2577
199 Ga0157376_10283309 3300014969 Bacteria 1562
200 Ga0157376_10621783 3300014969 Bacteria 1077
201 Ga0182005_1080768 3300015265 Bacteria 897
202 Ga0154015_1301124 3300020610 Archaea 1729
203 Ga0213876_10119325 3300021384 Bacteria 1400
204 Ga0207682_10112311 3300025893 Unclassified 1201
205 Ga0207680_10031502 3300025903 Bacteria 3004
206 Ga0207699_10016307 3300025906 Bacteria 3884
207 Ga0207645_10048165 3300025907 Bacteria 2721
208 Ga0207643_10020006 3300025908 Bacteria 3671
209 Ga0207643_10020599 3300025908 Bacteria 3620
210 Ga0207705_10134425 3300025909 Bacteria 1843
211 Ga0207654_10791804 3300025911 Unclassified 684
212 Ga0207707_10007537 3300025912 Bacteria 9481
213 Ga0207707_10009754 3300025912 Bacteria 8330
214 Ga0207707_10030598 3300025912 Bacteria 4710
215 Ga0207695_10084717 3300025913 Unclassified 3200
216 Ga0207671_10532343 3300025914 Bacteria 937
217 Ga0207693_10093479 3300025915 Bacteria 2357
218 Ga0207660_10000071 3300025917 Bacteria 52971
219 Ga0207660_10029941 3300025917 Bacteria 3739
220 Ga0207660_10204797 3300025917 Unclassified 1542
221 Ga0207660_10511907 3300025917 Unclassified 974
222 Ga0207662_10004342 3300025918 Bacteria 7445
223 Ga0207662_10764978 3300025918 Bacteria 679
224 Ga0207657_10059491 3300025919 Bacteria 3282
225 Ga0207657_10315364 3300025919 Unclassified 1237
226 Ga0207649_10001498 3300025920 Bacteria 13713
227 Ga0207652_10003884 3300025921 Bacteria 12228
228 Ga0207652_10017407 3300025921 Bacteria 5881
229 Ga0207652_10038962 3300025921 Bacteria 4031
230 Ga0207652_10126084 3300025921 Bacteria 2280
231 Ga0207652_10206154 3300025921 Bacteria 1770
232 Ga0207646_10377074 3300025922 Unclassified 1281
233 Ga0207681_10042339 3300025923 Bacteria 3042
234 Ga0207650_10235708 3300025925 Bacteria 1477
235 Ga0207650_10724276 3300025925 Unclassified 841
236 Ga0207659_10031755 3300025926 Bacteria 3619
237 Ga0207687_11320625 3300025927 Unclassified 620
238 Ga0207700_10036163 3300025928 Bacteria 3563
239 Ga0207644_10339526 3300025931 Bacteria 1218
240 Ga0207644_10679976 3300025931 Bacteria 858
241 Ga0207690_10049954 3300025932 Unclassified 2790
242 Ga0207706_10084713 3300025933 Bacteria 2787
243 Ga0207686_10093082 3300025934 Unclassified 1995
244 Ga0207686_10320244 3300025934 Bacteria 1158
245 Ga0207686_11051882 3300025934 Unclassified 662
246 Ga0207709_10069263 3300025935 Bacteria 2232
247 Ga0207670_10859372 3300025936 Unclassified 758
248 Ga0207704_10242359 3300025938 Bacteria 1348
249 Ga0207665_10096944 3300025939 Unclassified 2052
250 Ga0207691_10035428 3300025940 Bacteria 4632
251 Ga0207691_10282217 3300025940 Unclassified 1429
252 Ga0207711_10074427 3300025941 Unclassified 2954
253 Ga0207711_10090233 3300025941 Bacteria 2694
254 Ga0207689_10001385 3300025942 Bacteria 23223
255 Ga0207689_10084546 3300025942 Bacteria 2608
256 Ga0207661_10000418 3300025944 Bacteria 27514
257 Ga0207661_10011743 3300025944 Bacteria 6358
258 Ga0207661_10018841 3300025944 Bacteria 5135
259 Ga0207661_10047160 3300025944 Bacteria 3419
260 Ga0207661_10079508 3300025944 Unclassified 2702
261 Ga0207661_10216849 3300025944 Unclassified 1689
262 Ga0207661_10903013 3300025944 Bacteria 814
263 Ga0207661_11426730 3300025944 Unclassified 635
264 Ga0207679_10001635 3300025945 Bacteria 13968
265 Ga0207679_10330646 3300025945 Unclassified 1322
266 Ga0207679_11746607 3300025945 Unclassified 569
267 Ga0207667_10018764 3300025949 Bacteria 7745
268 Ga0207667_10435901 3300025949 Bacteria 1333
269 Ga0207667_11884837 3300025949 Bacteria 560
270 Ga0207651_10064689 3300025960 Bacteria 2561
271 Ga0207651_10453501 3300025960 Bacteria 1101
272 Ga0207712_10039276 3300025961 Bacteria 3242
273 Ga0207668_10348237 3300025972 Bacteria 1238
274 Ga0207668_10785284 3300025972 Bacteria 842
275 Ga0207640_10501674 3300025981 Bacteria 1011
276 Ga0207658_10312352 3300025986 Unclassified 1358
277 Ga0207677_10243036 3300026023 Bacteria 1457
278 Ga0207703_10084737 3300026035 Bacteria 2651
279 Ga0207703_10926642 3300026035 Unclassified 835
280 Ga0207708_10068096 3300026075 Bacteria 2724
281 Ga0207702_10018643 3300026078 Bacteria 5741
282 Ga0207702_10449491 3300026078 Bacteria 1250
283 Ga0207641_10003299 3300026088 Bacteria 14362
284 Ga0207641_11753095 3300026088 Bacteria 623
285 Ga0207648_10035713 3300026089 Bacteria 4379
286 Ga0207676_10000769 3300026095 Bacteria 25080
287 Ga0207676_10658648 3300026095 Unclassified 1011
288 Ga0207674_10000285 3300026116 Bacteria 64094
289 Ga0207674_10103938 3300026116 Bacteria 2819
290 Ga0207674_10896395 3300026116 Unclassified 855
291 Ga0207674_11163566 3300026116 Bacteria 741
292 Ga0207683_10060093 3300026121 Unclassified 3340
293 Ga0207683_10398431 3300026121 Bacteria 1266
294 Ga0207698_10020520 3300026142 Bacteria 4550
295 Ga0207698_10036834 3300026142 Bacteria 3596
296 Ga0207428_10834951 3300027907 Unclassified 653
297 Ga0268266_10171799 3300028379 Bacteria 1968
298 Ga0268265_11595638 3300028380 Unclassified 657
299 Ga0307410_10519655 3300031852 Bacteria 982
300 Ga0307409_100392632 3300031995 Bacteria 1323
301 Ga0373926_0107668 3300035083 Bacteria 1046
302 Ga0373934_0000789 3300035086 Bacteria 11392
303 Ga0373936_0353245 3300035113 Bacteria 670
304 Ga0373945_0024027 3300035116 Bacteria 2109
305 Ga0373953_0045477 3300035117 Unclassified 1759
306 Ga0373954_0046454 3300035118 Unclassified 2030
307 Ga0373956_0161638 3300035119 Unclassified 1055
308 Ga0373943_0029006 3300035170 Bacteria 2612
309 Ga0373946_0380298 3300035171 Bacteria 710
310 Ga0373955_0006568 3300035172 Bacteria 5304
311 Ga0373931_0330292 3300035691 Unclassified 949
312 Ga0373935_0165897 3300035692 Bacteria 1508
313 Ga0373927_0328633 3300035695 Bacteria 1007
314 Ga0373933_0037324 3300035724 Bacteria 2849
315 Ga0373947_0143574 3300035725 Bacteria 1533
316 Ga0373937_0001449 3300036401 Bacteria 19832
317 Ga0373925_0217208 3300037068 Bacteria 1525
318 Ga0436365_0788196 3300039437 Unclassified 603
319 Ga0436365_1012535 3300039437 Bacteria 1580
320 Ga0436365_1688845 3300039437 Bacteria 2353
321 Ga0451577_0675979 3300042876 Unclassified 936
322 Ga0453683_0863153 3300044673 Unclassified 597
323 Ga0466963_0200437 3300044694 Bacteria 1396
324 Ga0466957_0712933 3300044842 Unclassified 709
325 Ga0451576_0341517 3300045051 Bacteria 1568
326 Ga0451576_0423267 3300045051 Unclassified 1397
327 Ga0466967_0034360 3300045976 Bacteria 4303
328 Ga0495629_0021657 3300046459 Bacteria 4587
329 Ga0495651_0051534 3300046462 Bacteria 3172
330 Ga0495582_0064274 3300046473 Bacteria 2026
331 Ga0495639_0087626 3300046475 Bacteria 1457
332 Ga0495594_0005649 3300046499 Bacteria 6432
333 Ga0495594_0165577 3300046499 Bacteria 1257
334 Ga0495594_0167517 3300046499 Unclassified 1249
335 Ga0495594_0202885 3300046499 Bacteria 1130
336 Ga0495628_0087705 3300046516 Unclassified 2412
337 Ga0495630_0273914 3300046517 Bacteria 1289
338 Ga0495630_0710826 3300046517 Unclassified 769
339 Ga0495666_0055749 3300046526 Bacteria 1894
340 Ga0495665_0047257 3300046531 Bacteria 2283
341 Ga0495665_0164853 3300046531 Unclassified 1154
342 Ga0495665_0289052 3300046531 Bacteria 840
343 Ga0495586_0015512 3300046535 Bacteria 4053
344 Ga0495587_0001658 3300046536 Bacteria 14860
345 Ga0495645_0000127 3300046543 Bacteria 51432
346 Ga0495645_0117027 3300046543 Bacteria 1881
347 Ga0495622_0405431 3300046557 Unclassified 587
348 Ga0495667_0010244 3300046559 Bacteria 6342
349 Ga0495659_0133429 3300046664 Bacteria 986
350 Ga0495659_0139188 3300046664 Bacteria 968
351 Ga0495588_0357285 3300046674 Bacteria 768
352 Ga0495657_0116299 3300046675 Bacteria 1689
353 Ga0495599_0028562 3300046678 Bacteria 3497
354 Ga0495623_0004128 3300046679 Bacteria 9574
355 Ga0495658_0062349 3300046683 Bacteria 2143
356 Ga0495658_0071076 3300046683 Bacteria 2021
357 Ga0495613_0122247 3300046689 Bacteria 1869
358 Ga0495613_0130129 3300046689 Bacteria 1803
359 Ga0495613_0311504 3300046689 Bacteria 1088
360 Ga0495600_0020764 3300046809 Bacteria 4202
361 Ga0495600_0158456 3300046809 Bacteria 1464
362 Ga0495581_0028052 3300047315 Bacteria 3263
363 Ga0495581_0124111 3300047315 Bacteria 1503
364 Ga0495581_0736947 3300047315 Unclassified 567
365 Ga0495604_0144470 3300047317 Unclassified 1697
366 Ga0495674_0129434 3300047319 Bacteria 2127
367 Ga0495672_0008107 3300047320 Bacteria 7801
368 Ga0495680_0267646 3300047322 Unclassified 1207
369 Ga0495675_0005477 3300047444 Bacteria 7745
370 Ga0495684_0026048 3300047471 Unclassified 4495
371 Ga0495602_0655601 3300048088 Bacteria 716
372 Ga0496108_0061641 3300048911 Unclassified 3157
373 Ga0496109_0049851 3300048912 Bacteria 3813
374 Ga0496110_0584930 3300048913 Bacteria 1013
375 Ga0496112_0005755 3300048915 Bacteria 10779
376 Ga0496113_0012500 3300048916 Bacteria 5708
377 Ga0501032_0345134 3300049569 Bacteria 959
378 Ga0501033_0356259 3300049570 Bacteria 1024
379 Ga0501034_0112944 3300049571 Bacteria 2707
380 Ga0501034_0705273 3300049571 Bacteria 907
381 Ga0501034_0970470 3300049571 Bacteria 735
382 Ga0501038_0025333 3300049574 Bacteria 5289
383 Ga0501039_0921174 3300049575 Bacteria 680
384 Ga0501040_0031090 3300049576 Bacteria 3607
385 Ga0501043_0102869 3300049579 Bacteria 2244
386 Ga0501043_0172340 3300049579 Bacteria 1688
387 Ga0501047_0074288 3300049581 Bacteria 3273
388 Ga0501047_0495967 3300049581 Bacteria 1048
389 Ga0501047_0864667 3300049581 Unclassified 718
390 Ga0501067_0137659 3300049583 Bacteria 1359
391 Ga0501070_0070513 3300049586 Bacteria 2894
392 Ga0501070_0486152 3300049586 Bacteria 993
393 Ga0501073_0035367 3300049589 Bacteria 3552
394 Ga0501073_0451263 3300049589 Unclassified 889
395 Ga0501035_0072921 3300049822 Bacteria 3038
396 Ga0501035_0208742 3300049822 Bacteria 1672
397 Ga0501035_0497325 3300049822 Bacteria 1004
398 Ga0501044_0086765 3300049823 Bacteria 3161
399 Ga0501044_0825752 3300049823 Bacteria 805
400 nmdc:mga08y16_1290645_c1 3300050511 Unclassified 697
401 nmdc:mga0rr50_1146818_c1 3300050513 Unclassified 661
402 nmdc:mga08x19_146533_c1 3300050514 Bacteria 1597
403 Ga0495601_0091922 3300053077 Bacteria 1954
404 Ga0495595_0053616 3300053084 Unclassified 1874
405 Ga0500641_0383316 3300053096 Bacteria 557
406 Ga0070669_100283052
407 Ga0058863_10169688
408 Ga0058861_11888633
409 Ga0058862_12855174
410 Ga0065712_10132096
411 Ga0065715_10848970
412 Ga0070658_10002687
413 Ga0070658_10079835
414 Ga0070658_10479803
415 Ga0070676_10083463
416 Ga0070676_10113503
417 Ga0070683_100012314
418 Ga0070683_100025502
419 Ga0070683_100027485
420 Ga0070683_100038849
421 Ga0070683_100064767
422 Ga0070683_100122531
423 Ga0070683_100493863
424 Ga0070683_100706334
425 Ga0070690_100007982
426 Ga0070690_100058314
427 Ga0070690_100555725
428 Ga0070670_100252491
429 Ga0070670_100949926
430 Ga0070677_10183894
431 Ga0068869_100000533
432 Ga0068869_100354552
433 Ga0070680_100000187
434 Ga0070680_100002251
435 Ga0070680_100026642
436 Ga0070682_100003385
437 Ga0068868_100006275
438 Ga0068868_100738960
439 Ga0070660_100077494
440 Ga0070689_100009138
441 Ga0070687_100008380
442 Ga0070687_100827263
443 Ga0070661_100000707
444 Ga0070661_100797412
445 Ga0070692_10011137
446 Ga0070668_100341538
447 Ga0070669_100114711
448 Ga0070675_100007124
449 Ga0070675_100022944
450 Ga0070671_100251876
451 Ga0070671_101220547
452 Ga0070674_100123349
453 Ga0070673_100108968
454 Ga0070673_100331975
455 Ga0070688_100005772
456 Ga0070688_100898664
457 Ga0070688_100947628
458 Ga0070659_100296089
459 Ga0070667_100133340
460 Ga0070667_100968423
461 Ga0070714_100126910
462 Ga0070713_100046289
463 Ga0070713_100264225
464 Ga0070701_10117639
465 Ga0070711_100289751
466 Ga0070708_100000036
467 Ga0070708_100743910
468 Ga0070678_100380579
469 Ga0070678_100805752
470 Ga0070678_101271251
471 Ga0070662_100124635
472 Ga0070681_10007193
473 Ga0070681_10012965
474 Ga0070681_10048565
475 Ga0068867_100145862
476 Ga0070685_10006893
477 Ga0070707_100687364
478 Ga0070679_100001041
479 Ga0070679_100007683
480 Ga0070679_100040979
481 Ga0070679_100712570
482 Ga0070684_100005777
483 Ga0070684_100009260
484 Ga0070684_100016885
485 Ga0070684_100062146
486 Ga0070684_100068552
487 Ga0070684_100643132
488 Ga0070672_100007363
489 Ga0070686_100227610
490 Ga0070695_100008722
491 Ga0070693_100007810
492 Ga0070665_100100365
493 Ga0070665_100344628
494 Ga0068855_100016401
495 Ga0068855_100023066
496 Ga0068855_100676750
497 Ga0070664_100001891
498 Ga0070664_100025047
499 Ga0070664_100224956
500 Ga0070664_101114377
501 Ga0070664_101292126
502 Ga0068857_100001744
503 Ga0068857_100374998
504 Ga0068856_100001046
505 Ga0068856_100169122
506 Ga0070702_100000266
507 Ga0070702_100783864
508 Ga0068852_100010900
509 Ga0068852_100032085
510 Ga0068852_100657340
511 Ga0068859_100006639
512 Ga0068859_100046406
513 Ga0068859_100108583
514 Ga0068864_100113433
515 Ga0068864_100638393
516 Ga0068861_100409014
517 Ga0068870_10009484
518 Ga0068870_10037510
519 Ga0068863_100005740
520 Ga0068863_102019046
521 Ga0068858_100054311
522 Ga0068858_100645027
523 Ga0068860_100016481
524 Ga0068862_100147573
525 Ga0081455_10187438
526 Ga0070712_100209435
527 Ga0097621_100001310
528 Ga0068871_100040147
529 Ga0068871_100127573
530 Ga0075434_100516946
531 Ga0075434_101057804
532 Ga0068865_100182250
533 Ga0068865_101022698
534 Ga0075436_100161593
535 Ga0097620_100006639
536 Ga0097620_100046406
537 Ga0097620_100108579
538 Ga0075435_100333153
539 Ga0075435_100749179
540 Ga0105240_11375778
541 Ga0111539_10263220
542 Ga0105245_10006776
543 Ga0105245_10024397
544 Ga0105245_10242557
545 Ga0105245_11652890
546 Ga0105243_10027649
547 Ga0105243_11989950
548 Ga0105241_10011130
549 Ga0105241_10835531
550 Ga0105241_11227412
551 Ga0105242_10004781
552 Ga0105242_10070590
553 Ga0105242_11396861
554 Ga0105248_10000565
555 Ga0105248_10016696
556 Ga0105248_10058309
557 Ga0105248_10086711
558 Ga0105248_10207067
559 Ga0105248_10477035
560 Ga0105237_10164387
561 Ga0105238_10188883
562 Ga0105238_10466926
563 Ga0105249_11020166
564 Ga0105239_10203511
565 Ga0105239_10566004
566 Ga0157373_10001620
567 Ga0157373_10427072
568 Ga0157370_10000540
569 Ga0157370_11239734
570 Ga0157369_10051703
571 Ga0157369_10211971
572 Ga0157369_10352272
573 Ga0157369_10406029
574 Ga0157369_11110752
575 Ga0157374_10338435
576 Ga0157374_10391165
577 Ga0157374_10430809
578 Ga0157378_10093018
579 Ga0157378_12190403
580 Ga0163162_10087669
581 Ga0163162_10416576
582 Ga0157372_10003916
583 Ga0157372_10010522
584 Ga0157372_10026919
585 Ga0157372_10048240
586 Ga0157372_10105787
587 Ga0157372_10137572
588 Ga0157372_10139685
589 Ga0157372_10151939
590 Ga0157372_11047015
591 Ga0157372_11898722
592 Ga0157375_10007941
593 Ga0157375_10049832
594 Ga0157375_10056914
595 Ga0157375_11849115
596 Ga0163163_10011859
597 Ga0163163_10031527
598 Ga0163163_10104774
599 Ga0157377_10000590
600 Ga0157379_10358253
601 Ga0157379_10825135
602 Ga0157376_10064127
603 Ga0157376_10096168
604 Ga0157376_10283309
605 Ga0157376_10621783
606 Ga0182005_1080768
607 Ga0154015_1301124
608 Ga0213876_10119325
609 Ga0207682_10112311
610 Ga0207680_10031502
611 Ga0207699_10016307
612 Ga0207645_10048165
613 Ga0207643_10020006
614 Ga0207643_10020599
615 Ga0207705_10134425
616 Ga0207654_10791804
617 Ga0207707_10007537
618 Ga0207707_10009754
619 Ga0207707_10030598
620 Ga0207695_10084717
621 Ga0207671_10532343
622 Ga0207693_10093479
623 Ga0207660_10000071
624 Ga0207660_10029941
625 Ga0207660_10204797
626 Ga0207660_10511907
627 Ga0207662_10004342
628 Ga0207662_10764978
629 Ga0207657_10059491
630 Ga0207657_10315364
631 Ga0207649_10001498
632 Ga0207652_10003884
633 Ga0207652_10017407
634 Ga0207652_10038962
635 Ga0207652_10126084
636 Ga0207652_10206154
637 Ga0207646_10377074
638 Ga0207681_10042339
639 Ga0207650_10235708
640 Ga0207650_10724276
641 Ga0207659_10031755
642 Ga0207687_11320625
643 Ga0207700_10036163
644 Ga0207644_10339526
645 Ga0207644_10679976
646 Ga0207690_10049954
647 Ga0207706_10084713
648 Ga0207686_10093082
649 Ga0207686_10320244
650 Ga0207686_11051882
651 Ga0207709_10069263
652 Ga0207670_10859372
653 Ga0207704_10242359
654 Ga0207665_10096944
655 Ga0207691_10035428
656 Ga0207691_10282217
657 Ga0207711_10074427
658 Ga0207711_10090233
659 Ga0207689_10001385
660 Ga0207689_10084546
661 Ga0207661_10000418
662 Ga0207661_10011743
663 Ga0207661_10018841
664 Ga0207661_10047160
665 Ga0207661_10079508
666 Ga0207661_10216849
667 Ga0207661_10903013
668 Ga0207661_11426730
669 Ga0207679_10001635
670 Ga0207679_10330646
671 Ga0207679_11746607
672 Ga0207667_10018764
673 Ga0207667_10435901
674 Ga0207667_11884837
675 Ga0207651_10064689
676 Ga0207651_10453501
677 Ga0207712_10039276
678 Ga0207668_10348237
679 Ga0207668_10785284
680 Ga0207640_10501674
681 Ga0207658_10312352
682 Ga0207677_10243036
683 Ga0207703_10084737
684 Ga0207703_10926642
685 Ga0207708_10068096
686 Ga0207702_10018643
687 Ga0207702_10449491
688 Ga0207641_10003299
689 Ga0207641_11753095
690 Ga0207648_10035713
691 Ga0207676_10000769
692 Ga0207676_10658648
693 Ga0207674_10000285
694 Ga0207674_10103938
695 Ga0207674_10896395
696 Ga0207674_11163566
697 Ga0207683_10060093
698 Ga0207683_10398431
699 Ga0207698_10020520
700 Ga0207698_10036834
701 Ga0207428_10834951
702 Ga0268266_10171799
703 Ga0268265_11595638
704 Ga0307410_10519655
705 Ga0307409_100392632
706 Ga0373926_0107668
707 Ga0373934_0000789
708 Ga0373936_0353245
709 Ga0373945_0024027
710 Ga0373953_0045477
711 Ga0373954_0046454
712 Ga0373956_0161638
713 Ga0373943_0029006
714 Ga0373946_0380298
715 Ga0373955_0006568
716 Ga0373931_0330292
717 Ga0373935_0165897
718 Ga0373927_0328633
719 Ga0373933_0037324
720 Ga0373947_0143574
721 Ga0373937_0001449
722 Ga0373925_0217208
723 Ga0436365_0788196
724 Ga0436365_1012535
725 Ga0436365_1688845
726 Ga0451577_0675979
727 Ga0453683_0863153
728 Ga0466963_0200437
729 Ga0466957_0712933
730 Ga0451576_0341517
731 Ga0451576_0423267
732 Ga0466967_0034360
733 Ga0495629_0021657
734 Ga0495651_0051534
735 Ga0495582_0064274
736 Ga0495639_0087626
737 Ga0495594_0005649
738 Ga0495594_0165577
739 Ga0495594_0167517
740 Ga0495594_0202885
741 Ga0495628_0087705
742 Ga0495630_0273914
743 Ga0495630_0710826
744 Ga0495666_0055749
745 Ga0495665_0047257
746 Ga0495665_0164853
747 Ga0495665_0289052
748 Ga0495586_0015512
749 Ga0495587_0001658
750 Ga0495645_0000127
751 Ga0495645_0117027
752 Ga0495622_0405431
753 Ga0495667_0010244
754 Ga0495659_0133429
755 Ga0495659_0139188
756 Ga0495588_0357285
757 Ga0495657_0116299
758 Ga0495599_0028562
759 Ga0495623_0004128
760 Ga0495658_0062349
761 Ga0495658_0071076
762 Ga0495613_0122247
763 Ga0495613_0130129
764 Ga0495613_0311504
765 Ga0495600_0020764
766 Ga0495600_0158456
767 Ga0495581_0028052
768 Ga0495581_0124111
769 Ga0495581_0736947
770 Ga0495604_0144470
771 Ga0495674_0129434
772 Ga0495672_0008107
773 Ga0495680_0267646
774 Ga0495675_0005477
775 Ga0495684_0026048
776 Ga0495602_0655601
777 Ga0496108_0061641
778 Ga0496109_0049851
779 Ga0496110_0584930
780 Ga0496112_0005755
781 Ga0496113_0012500
782 Ga0501032_0345134
783 Ga0501033_0356259
784 Ga0501034_0112944
785 Ga0501034_0705273
786 Ga0501034_0970470
787 Ga0501038_0025333
788 Ga0501039_0921174
789 Ga0501040_0031090
790 Ga0501043_0102869
791 Ga0501043_0172340
792 Ga0501047_0074288
793 Ga0501047_0495967
794 Ga0501047_0864667
795 Ga0501067_0137659
796 Ga0501070_0070513
797 Ga0501070_0486152
798 Ga0501073_0035367
799 Ga0501073_0451263
800 Ga0501035_0072921
801 Ga0501035_0208742
802 Ga0501035_0497325
803 Ga0501044_0086765
804 Ga0501044_0825752
805 nmdc:mga08y16_1290645_c1
806 nmdc:mga0rr50_1146818_c1
807 nmdc:mga08x19_146533_c1
808 Ga0495601_0091922
809 Ga0495595_0053616
810 Ga0500641_0383316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07884

VKOR

Vitamin K epoxide reductase family

5

117

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wv8-assembly1.cif.gz_A takifugu rubripes vkor-like c138s mutant with vitamin k1 0.8144 3 134
3kp9-assembly1.cif.gz_A structure of a bacterial homolog of vitamin k epoxide reductase 0.8099 1 132
6wvb-assembly1.cif.gz_A takifugu rubripes vkor-like with warfarin 0.809 3 145
6wva-assembly1.cif.gz_A takifugu rubripes vkor-like with vitamin k1 epoxide at non-catalytic state 0.7954 3 147
4nv5-assembly2.cif.gz_B c50a mutant of synechococcus vkor, c2 crystal form (dehydrated) 0.7859 3 145
ID Description Score Start End Superfamily
af_Q54V87_14_188_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8652 3 135 1.20.1440.130
af_Q10S76_73_247_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8445 1 144 1.20.1440.130
af_I6X5W1_15_164_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8388 3 135 1.20.1440.130
af_A1ZAJ5_3_151_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8269 3 137 1.20.1440.130
af_Q10S76_73_247_1.20.1440.130 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);VKOR domain 0.8123 1 144 1.20.1440.130
ID Description Score Start End GO Terms
AF-A0A2V7GHQ1-F1-model_v4 Vitamin K epoxide reductase 0.9718 3 138 GO:0016020
GO:0016491
GO:0048038
AF-A0A7Y5PBN3-F1-model_v4 Vitamin K epoxide reductase family protein 0.9704 1 147 GO:0016020
GO:0016491
GO:0048038
AF-A0A7W1UIM1-F1-model_v4 Vitamin K epoxide reductase family protein 0.9681 3 141 GO:0016020
GO:0016491
GO:0048038
AF-A0A7Y5QL11-F1-model_v4 Vitamin K epoxide reductase family protein 0.968 1 136 GO:0016020
GO:0016491
GO:0048038
AF-A0A1Q7SK70-F1-model_v4 Vitamin K epoxide reductase domain-containing protein 0.9663 1 140 GO:0016020
GO:0016491
GO:0048038

Map