F434438

General Info

Members Datasets Scaffolds Average Seq Length
399 222 798 390

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0286261|Ga0501082_0286261_211_1398
Length 395
Sequence LTDELLKWRSEFPILEKTVYLISHSLGAMPKATYDSLHEYADMWATRGVRAWAEGWWDMPITIGDEVGRVIGADPGTVVMHQNVSICQSLILSCIEPTPERNKIVYSELNFPSVMYVYEAHARDGRLRIETVKSDDGITVPLERMLEAIDEQTLLVPFSHVLFKSAFLQDAKAITGRAHEVGARVVLDTYQSAGTVPFSVKDLNVDFATGGSVKWLCGGPGAGYLYVRPDLHEELTPKTTGWMAHASPFSFETELRYATGIARFLHGSPAIPALFAARPGYKIINELGVDRIRAKSVRQTGRLIQLAQEAGFKVTSPKNPEQRGGTITVWHEEAAAITRELIRREFIVDFRPGAGVRISPHFYTKDDELDLVINEMKKIRDARAYDRAEHVGAAF

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.52
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 15.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0286261 3300060353 Bacteria 1435
2 JGI24752J21851_1000638 3300001976 Bacteria 4690
3 JGI24751J29686_10000808 3300002459 Bacteria 7306
4 Ga0065715_10091370 3300005293 Bacteria 5847
5 Ga0070690_100177871 3300005330 Bacteria 1469
6 Ga0068869_100066571 3300005334 Bacteria 2655
7 Ga0068869_100232210 3300005334 Bacteria 1466
8 Ga0070680_100231078 3300005336 Unclassified 1562
9 Ga0068868_100023467 3300005338 Bacteria 4669
10 Ga0068868_100068222 3300005338 Bacteria 2832
11 Ga0068868_100180492 3300005338 Unclassified 1751
12 Ga0070660_100226473 3300005339 Bacteria 1520
13 Ga0070689_100005861 3300005340 Bacteria 8438
14 Ga0070687_100000582 3300005343 Bacteria 12165
15 Ga0070661_100138872 3300005344 Bacteria 1830
16 Ga0070668_100136174 3300005347 Bacteria 1976
17 Ga0070673_100011001 3300005364 Bacteria 6159
18 Ga0070659_100057136 3300005366 Bacteria 3076
19 Ga0070667_100087750 3300005367 Bacteria 2670
20 Ga0070709_10049410 3300005434 Bacteria 2630
21 Ga0070709_10080021 3300005434 Bacteria 2130
22 Ga0070714_100026866 3300005435 Unclassified 4761
23 Ga0070714_100074659 3300005435 Bacteria 2940
24 Ga0070714_100139882 3300005435 Bacteria 2171
25 Ga0070713_100035427 3300005436 Bacteria 4017
26 Ga0070713_100060555 3300005436 Bacteria 3165
27 Ga0070713_100073063 3300005436 Unclassified 2902
28 Ga0070713_100077505 3300005436 Bacteria 2826
29 Ga0070711_100002684 3300005439 Bacteria 10211
30 Ga0070711_100035366 3300005439 Bacteria 3339
31 Ga0070711_100125252 3300005439 Bacteria 1906
32 Ga0070708_100002291 3300005445 Bacteria 14814
33 Ga0070708_100005869 3300005445 Bacteria 9748
34 Ga0070708_100046476 3300005445 Bacteria 3830
35 Ga0070708_100057617 3300005445 Unclassified 3459
36 Ga0070708_100149853 3300005445 Bacteria 2169
37 Ga0070708_100316242 3300005445 Bacteria 1471
38 Ga0070678_100059639 3300005456 Bacteria 2805
39 Ga0070662_100156662 3300005457 Unclassified 1778
40 Ga0070662_100178541 3300005457 Bacteria 1672
41 Ga0070681_10005023 3300005458 Bacteria 12750
42 Ga0068867_100025620 3300005459 Bacteria 4233
43 Ga0070685_10006809 3300005466 Bacteria 5835
44 Ga0070706_100000434 3300005467 Bacteria 50174
45 Ga0070706_100001372 3300005467 Bacteria 25863
46 Ga0070706_100039142 3300005467 Unclassified 4378
47 Ga0070707_100001963 3300005468 Bacteria 19671
48 Ga0070707_100009400 3300005468 Bacteria 9074
49 Ga0070698_100000584 3300005471 Bacteria 39203
50 Ga0070698_100002687 3300005471 Bacteria 19596
51 Ga0070698_100009906 3300005471 Bacteria 10190
52 Ga0070699_100005233 3300005518 Bacteria 11396
53 Ga0070679_100013550 3300005530 Bacteria 7811
54 Ga0070684_100003906 3300005535 Bacteria 11288
55 Ga0070697_100000814 3300005536 Bacteria 23385
56 Ga0070697_100000951 3300005536 Bacteria 21825
57 Ga0070697_100002081 3300005536 Bacteria 15305
58 Ga0070697_100005798 3300005536 Bacteria 9524
59 Ga0070697_100007211 3300005536 Bacteria 8646
60 Ga0070697_100023293 3300005536 Bacteria 4924
61 Ga0070697_100045573 3300005536 Bacteria 3554
62 Ga0070697_100083544 3300005536 Bacteria 2633
63 Ga0070697_100127350 3300005536 Bacteria 2133
64 Ga0070697_100276591 3300005536 Bacteria 1440
65 Ga0068853_100119446 3300005539 Bacteria 2350
66 Ga0070695_100019863 3300005545 Bacteria 4097
67 Ga0070696_100035796 3300005546 Unclassified 3419
68 Ga0068855_100133582 3300005563 Bacteria 2832
69 Ga0070664_100016056 3300005564 Bacteria 6135
70 Ga0070664_100022499 3300005564 Bacteria 5198
71 Ga0068856_100151329 3300005614 Bacteria 2329
72 Ga0068856_100189106 3300005614 Bacteria 2073
73 Ga0068859_100035804 3300005617 Bacteria 4981
74 Ga0068866_10027378 3300005718 Bacteria 2702
75 Ga0068851_10001808 3300005834 Bacteria 9364
76 Ga0068851_10012496 3300005834 Bacteria 4004
77 Ga0068870_10079569 3300005840 Unclassified 1808
78 Ga0068858_100085681 3300005842 Bacteria 2931
79 Ga0068858_100227796 3300005842 Bacteria 1766
80 Ga0068860_100074378 3300005843 Bacteria 3231
81 Ga0070717_10001776 3300006028 Bacteria 15038
82 Ga0070717_10017160 3300006028 Bacteria 5626
83 Ga0070717_10075614 3300006028 Bacteria 2817
84 Ga0070715_10005647 3300006163 Bacteria 4190
85 Ga0070716_100000124 3300006173 Bacteria 30516
86 Ga0070716_100007839 3300006173 Bacteria 5279
87 Ga0070716_100090330 3300006173 Unclassified 1852
88 Ga0070712_100000302 3300006175 Bacteria 27828
89 Ga0070712_100250093 3300006175 Bacteria 1416
90 Ga0097621_100020148 3300006237 Bacteria 5136
91 Ga0097621_100073825 3300006237 Bacteria 2824
92 Ga0068871_100032583 3300006358 Bacteria 4118
93 Ga0068871_100059920 3300006358 Bacteria 3103
94 Ga0068871_100127676 3300006358 Bacteria 2154
95 Ga0075428_100140346 3300006844 Bacteria 2627
96 Ga0075428_100513532 3300006844 Bacteria 1282
97 Ga0075433_10080996 3300006852 Bacteria 2862
98 Ga0075433_10145736 3300006852 Bacteria 2105
99 Ga0075434_100000005 3300006871 Bacteria 104425
100 Ga0075434_100003427 3300006871 Bacteria 14182
101 Ga0075434_100010866 3300006871 Bacteria 8558
102 Ga0075434_100074243 3300006871 Bacteria 3394
103 Ga0075429_100187654 3300006880 Bacteria 1812
104 Ga0075436_100000991 3300006914 Bacteria 19044
105 Ga0075436_100003843 3300006914 Bacteria 10294
106 Ga0075436_100004864 3300006914 Bacteria 9232
107 Ga0097620_100035806 3300006931 Bacteria 4981
108 Ga0075435_100004233 3300007076 Bacteria 9857
109 Ga0075435_100024237 3300007076 Bacteria 4706
110 Ga0075435_100048309 3300007076 Bacteria 3418
111 Ga0075435_100116263 3300007076 Bacteria 2228
112 Ga0099794_10010263 3300007265 Bacteria 3969
113 Ga0099794_10038393 3300007265 Bacteria 2269
114 Ga0105250_10041594 3300009092 Unclassified 1842
115 Ga0105240_10036101 3300009093 Bacteria 6362
116 Ga0105240_10085017 3300009093 Bacteria 3878
117 Ga0105240_10103929 3300009093 Unclassified 3450
118 Ga0111539_10269338 3300009094 Bacteria 1983
119 Ga0105245_10009826 3300009098 Bacteria 8337
120 Ga0105245_10084767 3300009098 Unclassified 2903
121 Ga0105245_10271730 3300009098 Bacteria 1653
122 Ga0105247_10065062 3300009101 Bacteria 2267
123 Ga0114129_10076519 3300009147 Bacteria 4659
124 Ga0114129_10261117 3300009147 Bacteria 2321
125 Ga0114129_10484121 3300009147 Bacteria 1618
126 Ga0114129_10688478 3300009147 Unclassified 1315
127 Ga0105241_10039238 3300009174 Bacteria 3571
128 Ga0105241_10087427 3300009174 Unclassified 2454
129 Ga0105242_10073256 3300009176 Bacteria 2847
130 Ga0105248_10162596 3300009177 Bacteria 2517
131 Ga0105248_10284246 3300009177 Unclassified 1862
132 Ga0105237_10219737 3300009545 Unclassified 1900
133 Ga0105238_10062825 3300009551 Bacteria 3714
134 Ga0105238_10303336 3300009551 Bacteria 1581
135 Ga0105249_10086754 3300009553 Bacteria 2919
136 Ga0105249_10153387 3300009553 Bacteria 2220
137 Ga0105239_10050296 3300010375 Bacteria 4572
138 Ga0105246_10002297 3300011119 Bacteria 11534
139 Ga0157373_10007252 3300013100 Bacteria 8267
140 Ga0157373_10028592 3300013100 Bacteria 4022
141 Ga0157373_10194729 3300013100 Bacteria 1428
142 Ga0157371_10025443 3300013102 Unclassified 4313
143 Ga0157371_10063963 3300013102 Bacteria 2608
144 Ga0157369_10000638 3300013105 Bacteria 45239
145 Ga0157369_10042083 3300013105 Bacteria 4984
146 Ga0157374_10089455 3300013296 Bacteria 2934
147 Ga0157374_10171390 3300013296 Bacteria 2117
148 Ga0157378_10044565 3300013297 Bacteria 3940
149 Ga0163162_10032008 3300013306 Bacteria 5220
150 Ga0163162_10099073 3300013306 Bacteria 3005
151 Ga0157372_10067428 3300013307 Bacteria 4021
152 Ga0157375_10065565 3300013308 Unclassified 3620
153 Ga0163163_10006273 3300014325 Bacteria 10378
154 Ga0157379_10008128 3300014968 Bacteria 9113
155 Ga0157379_10049076 3300014968 Bacteria 3768
156 Ga0157379_10160436 3300014968 Bacteria 2029
157 Ga0157379_10199119 3300014968 Bacteria 1811
158 Ga0157376_10028103 3300014969 Unclassified 4467
159 Ga0157376_10101993 3300014969 Bacteria 2509
160 Ga0157376_10170595 3300014969 Bacteria 1981
161 Ga0182007_10006669 3300015262 Bacteria 4935
162 Ga0163161_10009682 3300017792 Bacteria 6669
163 Ga0213876_10046845 3300021384 Unclassified 2286
164 Ga0228598_1000043 3300024227 Bacteria 17812
165 Ga0207697_10007820 3300025315 Bacteria 4732
166 Ga0207642_10018266 3300025899 Unclassified 2687
167 Ga0207680_10052856 3300025903 Bacteria 2436
168 Ga0207680_10095560 3300025903 Bacteria 1899
169 Ga0207647_10009445 3300025904 Bacteria 6930
170 Ga0207699_10020494 3300025906 Bacteria 3545
171 Ga0207699_10034971 3300025906 Bacteria 2855
172 Ga0207699_10036809 3300025906 Bacteria 2793
173 Ga0207699_10113379 3300025906 Unclassified 1742
174 Ga0207645_10003048 3300025907 Bacteria 12889
175 Ga0207643_10000363 3300025908 Bacteria 30460
176 Ga0207684_10000966 3300025910 Bacteria 32224
177 Ga0207684_10003721 3300025910 Bacteria 14769
178 Ga0207684_10141562 3300025910 Unclassified 2068
179 Ga0207654_10035546 3300025911 Bacteria 2777
180 Ga0207654_10042820 3300025911 Bacteria 2564
181 Ga0207707_10003557 3300025912 Bacteria 13804
182 Ga0207695_10200670 3300025913 Bacteria 1909
183 Ga0207671_10054220 3300025914 Bacteria 2971
184 Ga0207693_10000373 3300025915 Bacteria 41202
185 Ga0207693_10005083 3300025915 Bacteria 11026
186 Ga0207693_10064971 3300025915 Bacteria 2858
187 Ga0207663_10002079 3300025916 Bacteria 9538
188 Ga0207663_10007496 3300025916 Bacteria 5660
189 Ga0207663_10015835 3300025916 Bacteria 4169
190 Ga0207663_10046547 3300025916 Bacteria 2673
191 Ga0207660_10000546 3300025917 Bacteria 25285
192 Ga0207660_10154720 3300025917 Bacteria 1764
193 Ga0207662_10000664 3300025918 Bacteria 15610
194 Ga0207657_10001432 3300025919 Bacteria 25493
195 Ga0207657_10001455 3300025919 Bacteria 25319
196 Ga0207657_10006629 3300025919 Bacteria 11986
197 Ga0207649_10000794 3300025920 Bacteria 20366
198 Ga0207652_10004236 3300025921 Bacteria 11704
199 Ga0207652_10048251 3300025921 Unclassified 3639
200 Ga0207652_10324696 3300025921 Unclassified 1389
201 Ga0207646_10000020 3300025922 Bacteria 272909
202 Ga0207646_10006006 3300025922 Bacteria 12647
203 Ga0207646_10056647 3300025922 Unclassified 3503
204 Ga0207646_10073770 3300025922 Bacteria 3048
205 Ga0207646_10286435 3300025922 Bacteria 1489
206 Ga0207681_10152732 3300025923 Bacteria 1732
207 Ga0207694_10039766 3300025924 Unclassified 3620
208 Ga0207694_10045564 3300025924 Bacteria 3387
209 Ga0207694_10058027 3300025924 Bacteria 3011
210 Ga0207650_10000051 3300025925 Bacteria 168652
211 Ga0207650_10168790 3300025925 Bacteria 1738
212 Ga0207659_10202813 3300025926 Bacteria 1585
213 Ga0207687_10051976 3300025927 Unclassified 2858
214 Ga0207700_10007857 3300025928 Bacteria 6560
215 Ga0207700_10028451 3300025928 Bacteria 3930
216 Ga0207700_10228087 3300025928 Bacteria 1582
217 Ga0207664_10001175 3300025929 Bacteria 17418
218 Ga0207664_10234153 3300025929 Bacteria 1597
219 Ga0207644_10206743 3300025931 Bacteria 1550
220 Ga0207706_10000783 3300025933 Bacteria 32931
221 Ga0207706_10002653 3300025933 Bacteria 17425
222 Ga0207686_10163376 3300025934 Bacteria 1563
223 Ga0207665_10000034 3300025939 Bacteria 88735
224 Ga0207665_10000774 3300025939 Bacteria 21536
225 Ga0207665_10096800 3300025939 Bacteria 2053
226 Ga0207691_10002900 3300025940 Bacteria 16716
227 Ga0207711_10002266 3300025941 Bacteria 17271
228 Ga0207711_10009607 3300025941 Bacteria 8062
229 Ga0207711_10191931 3300025941 Unclassified 1862
230 Ga0207689_10000860 3300025942 Bacteria 29295
231 Ga0207689_10025762 3300025942 Bacteria 4928
232 Ga0207661_10000969 3300025944 Bacteria 18902
233 Ga0207661_10065645 3300025944 Bacteria 2947
234 Ga0207679_10000203 3300025945 Bacteria 47291
235 Ga0207679_10116747 3300025945 Unclassified 2116
236 Ga0207667_10028798 3300025949 Bacteria 6030
237 Ga0207667_10035271 3300025949 Bacteria 5366
238 Ga0207667_10375707 3300025949 Unclassified 1448
239 Ga0207651_10216760 3300025960 Unclassified 1544
240 Ga0207712_10027192 3300025961 Bacteria 3819
241 Ga0207658_10002771 3300025986 Bacteria 12627
242 Ga0207658_10127984 3300025986 Bacteria 2035
243 Ga0207677_10068238 3300026023 Bacteria 2494
244 Ga0207677_10081221 3300026023 Bacteria 2325
245 Ga0207639_10025861 3300026041 Bacteria 4259
246 Ga0207639_10044425 3300026041 Bacteria 3341
247 Ga0207678_10001066 3300026067 Bacteria 25100
248 Ga0207678_10078153 3300026067 Bacteria 2834
249 Ga0207702_10010773 3300026078 Bacteria 7633
250 Ga0207641_10000025 3300026088 Bacteria 247727
251 Ga0207641_10000673 3300026088 Bacteria 37086
252 Ga0207641_10164866 3300026088 Unclassified 2017
253 Ga0207648_10000966 3300026089 Bacteria 32474
254 Ga0207648_10126832 3300026089 Bacteria 2245
255 Ga0207676_10007622 3300026095 Bacteria 7685
256 Ga0207674_10001451 3300026116 Bacteria 30625
257 Ga0207683_10000742 3300026121 Bacteria 29663
258 Ga0207698_10156965 3300026142 Bacteria 1984
259 Ga0209588_1002403 3300027671 Bacteria 5071
260 Ga0207428_10115114 3300027907 Unclassified 2066
261 Ga0268266_10110925 3300028379 Unclassified 2430
262 Ga0268265_10048950 3300028380 Bacteria 3176
263 Ga0265338_10001594 3300028800 Bacteria 36404
264 Ga0265760_10000004 3300031090 Bacteria 149429
265 Ga0265328_10018666 3300031239 Unclassified 2671
266 Ga0265325_10001997 3300031241 Bacteria 14019
267 Ga0265340_10032621 3300031247 Bacteria 2599
268 Ga0265339_10002485 3300031249 Bacteria 13174
269 Ga0265331_10025146 3300031250 Bacteria 3007
270 Ga0265316_10021295 3300031344 Bacteria 5496
271 Ga0307408_100102317 3300031548 Bacteria 2185
272 Ga0265313_10018209 3300031595 Bacteria 3953
273 Ga0265314_10018014 3300031711 Bacteria 5523
274 Ga0265314_10038305 3300031711 Unclassified 3465
275 Ga0316212_1000774 3300033547 Bacteria 4078
276 Ga0373926_0005094 3300035083 Bacteria 4314
277 Ga0373926_0006273 3300035083 Bacteria 3946
278 Ga0373936_0022483 3300035113 Bacteria 2455
279 Ga0373945_0001300 3300035116 Bacteria 7577
280 Ga0373943_0094942 3300035170 Bacteria 1550
281 Ga0373946_0013990 3300035171 Bacteria 3021
282 Ga0373955_0014183 3300035172 Unclassified 3871
283 Ga0373924_0003090 3300035410 Bacteria 5681
284 Ga0373931_0007267 3300035691 Bacteria 5212
285 Ga0373931_0081574 3300035691 Unclassified 1786
286 Ga0373935_0026882 3300035692 Bacteria 3555
287 Ga0373927_0000357 3300035695 Bacteria 35562
288 Ga0373927_0012132 3300035695 Bacteria 5733
289 Ga0373933_0016913 3300035724 Unclassified 4087
290 Ga0373933_0038510 3300035724 Bacteria 2809
291 Ga0373947_0015095 3300035725 Bacteria 4434
292 Ga0373947_0030526 3300035725 Bacteria 3167
293 Ga0373947_0043281 3300035725 Unclassified 2690
294 Ga0373937_0000437 3300036401 Bacteria 38580
295 Ga0373937_0007462 3300036401 Bacteria 9461
296 Ga0373937_0034816 3300036401 Bacteria 4581
297 Ga0373937_0176727 3300036401 Unclassified 2004
298 Ga0373925_0001733 3300037068 Bacteria 18312
299 Ga0373925_0029998 3300037068 Bacteria 3989
300 Ga0373925_0249716 3300037068 Bacteria 1422
301 Ga0436365_0639242 3300039437 Bacteria 2379
302 Ga0436363_1080746 3300039450 Bacteria 3028
303 Ga0436362_0509378 3300039453 Bacteria 3394
304 Ga0453683_0178527 3300044673 Bacteria 1346
305 Ga0466963_0001758 3300044694 Bacteria 11808
306 Ga0466957_0004769 3300044842 Bacteria 7589
307 Ga0466959_0070703 3300045049 Bacteria 2528
308 Ga0466958_0090759 3300045836 Bacteria 1891
309 Ga0466967_0052715 3300045976 Unclassified 3572
310 Ga0466967_0094727 3300045976 Bacteria 2719
311 Ga0466967_0110385 3300045976 Bacteria 2526
312 Ga0495603_0035110 3300046455 Bacteria 3013
313 Ga0495603_0077010 3300046455 Bacteria 1957
314 Ga0495629_0063245 3300046459 Bacteria 2584
315 Ga0495580_0017762 3300046472 Bacteria 5309
316 Ga0495580_0025417 3300046472 Bacteria 4328
317 Ga0495580_0035513 3300046472 Unclassified 3585
318 Ga0495580_0055297 3300046472 Bacteria 2797
319 Ga0495580_0069932 3300046472 Unclassified 2452
320 Ga0495580_0184402 3300046472 Bacteria 1440
321 Ga0495639_0018162 3300046475 Bacteria 3059
322 Ga0495639_0023273 3300046475 Unclassified 2722
323 Ga0495664_0117536 3300046477 Bacteria 1607
324 Ga0495584_0054324 3300046491 Bacteria 2016
325 Ga0495628_0065819 3300046516 Bacteria 2834
326 Ga0495630_0000659 3300046517 Bacteria 24979
327 Ga0495630_0032747 3300046517 Bacteria 3875
328 Ga0495630_0174689 3300046517 Bacteria 1637
329 Ga0495666_0029428 3300046526 Bacteria 2702
330 Ga0495652_0087189 3300046529 Bacteria 2561
331 Ga0495665_0025910 3300046531 Bacteria 3149
332 Ga0495665_0044922 3300046531 Unclassified 2347
333 Ga0495640_0029025 3300046533 Unclassified 3976
334 Ga0495586_0011377 3300046535 Bacteria 4733
335 Ga0495645_0006585 3300046543 Bacteria 8068
336 Ga0495622_0057495 3300046557 Bacteria 1803
337 Ga0495635_0074618 3300046663 Bacteria 2324
338 Ga0495635_0103476 3300046663 Bacteria 1946
339 Ga0495658_0083644 3300046683 Bacteria 1877
340 Ga0495581_0062127 3300047315 Bacteria 2158
341 Ga0495676_0073073 3300047321 Bacteria 2631
342 Ga0495680_0055063 3300047322 Bacteria 3086
343 Ga0495614_0018551 3300048089 Bacteria 3014
344 Ga0496100_0040425 3300048903 Bacteria 2967
345 Ga0496102_0065906 3300048905 Bacteria 3320
346 Ga0496102_0119784 3300048905 Unclassified 2458
347 Ga0496102_0144020 3300048905 Bacteria 2235
348 Ga0496102_0149775 3300048905 Bacteria 2192
349 Ga0496102_0188331 3300048905 Unclassified 1944
350 Ga0496102_0242992 3300048905 Unclassified 1697
351 Ga0496103_0040135 3300048906 Bacteria 2876
352 Ga0496103_0055838 3300048906 Bacteria 2450
353 Ga0496104_0058617 3300048907 Unclassified 3645
354 Ga0496104_0131047 3300048907 Bacteria 2408
355 Ga0496105_0001474 3300048908 Bacteria 16594
356 Ga0496105_0054121 3300048908 Bacteria 3314
357 Ga0496105_0059384 3300048908 Bacteria 3156
358 Ga0496106_0040558 3300048909 Unclassified 3487
359 Ga0496106_0203247 3300048909 Bacteria 1577
360 Ga0496107_0054202 3300048910 Bacteria 2894
361 Ga0496108_0000169 3300048911 Bacteria 61406
362 Ga0496109_0000072 3300048912 Bacteria 107549
363 Ga0496109_0155443 3300048912 Bacteria 2142
364 Ga0496109_0279661 3300048912 Unclassified 1573
365 Ga0496110_0001865 3300048913 Bacteria 15574
366 Ga0496111_0005773 3300048914 Bacteria 7985
367 Ga0496111_0058229 3300048914 Bacteria 2797
368 Ga0496112_0000064 3300048915 Bacteria 72159
369 Ga0496112_0011741 3300048915 Bacteria 8020
370 Ga0496112_0047008 3300048915 Bacteria 4233
371 Ga0496112_0055168 3300048915 Bacteria 3906
372 Ga0496112_0093212 3300048915 Unclassified 2982
373 Ga0496113_0000253 3300048916 Bacteria 25196
374 Ga0496113_0002474 3300048916 Bacteria 10759
375 Ga0496113_0040955 3300048916 Bacteria 3416
376 Ga0496113_0086159 3300048916 Bacteria 2413
377 Ga0496115_0015307 3300048918 Bacteria 5816
378 Ga0501040_0223524 3300049576 Unclassified 1340
379 Ga0501076_0376463 3300049592 Unclassified 1167
380 nmdc:mga05p37_192067_c1 3300050507 Bacteria 2478
381 nmdc:mga05p37_336749_c1 3300050507 Bacteria 1780
382 nmdc:mga08y16_41250_c1 3300050511 Bacteria 4836
383 nmdc:mga0n895_1582_c1 3300050512 Bacteria 17128
384 nmdc:mga0n895_24203_c1 3300050512 Bacteria 5721
385 nmdc:mga0n895_603_c1 3300050512 Bacteria 24849
386 nmdc:mga0rr50_105602_c1 3300050513 Bacteria 2221
387 nmdc:mga0rr50_132213_c1 3300050513 Bacteria 1999
388 nmdc:mga0rr50_260_c1 3300050513 Bacteria 28597
389 nmdc:mga0rr50_6220_c1 3300050513 Bacteria 7237
390 nmdc:mga08x19_129749_c1 3300050514 Bacteria 1695
391 nmdc:mga08x19_1446_c1 3300050514 Bacteria 14687
392 nmdc:mga08x19_14588_c1 3300050514 Bacteria 4767
393 nmdc:mga08x19_35364_c1 3300050514 Bacteria 3160
394 nmdc:mga08x19_978_c1 3300050514 Bacteria 17873
395 nmdc:mga0a205_136_c1 3300050515 Bacteria 46162
396 nmdc:mga0a205_143043_c1 3300050515 Bacteria 2292
397 nmdc:mga0a205_329744_c1 3300050515 Unclassified 1396
398 Ga0495601_0026187 3300053077 Unclassified 3599
399 Ga0501084_0128756 3300054114 Bacteria 2131
400 Ga0501082_0286261
401 JGI24752J21851_1000638
402 JGI24751J29686_10000808
403 Ga0065715_10091370
404 Ga0070690_100177871
405 Ga0068869_100066571
406 Ga0068869_100232210
407 Ga0070680_100231078
408 Ga0068868_100023467
409 Ga0068868_100068222
410 Ga0068868_100180492
411 Ga0070660_100226473
412 Ga0070689_100005861
413 Ga0070687_100000582
414 Ga0070661_100138872
415 Ga0070668_100136174
416 Ga0070673_100011001
417 Ga0070659_100057136
418 Ga0070667_100087750
419 Ga0070709_10049410
420 Ga0070709_10080021
421 Ga0070714_100026866
422 Ga0070714_100074659
423 Ga0070714_100139882
424 Ga0070713_100035427
425 Ga0070713_100060555
426 Ga0070713_100073063
427 Ga0070713_100077505
428 Ga0070711_100002684
429 Ga0070711_100035366
430 Ga0070711_100125252
431 Ga0070708_100002291
432 Ga0070708_100005869
433 Ga0070708_100046476
434 Ga0070708_100057617
435 Ga0070708_100149853
436 Ga0070708_100316242
437 Ga0070678_100059639
438 Ga0070662_100156662
439 Ga0070662_100178541
440 Ga0070681_10005023
441 Ga0068867_100025620
442 Ga0070685_10006809
443 Ga0070706_100000434
444 Ga0070706_100001372
445 Ga0070706_100039142
446 Ga0070707_100001963
447 Ga0070707_100009400
448 Ga0070698_100000584
449 Ga0070698_100002687
450 Ga0070698_100009906
451 Ga0070699_100005233
452 Ga0070679_100013550
453 Ga0070684_100003906
454 Ga0070697_100000814
455 Ga0070697_100000951
456 Ga0070697_100002081
457 Ga0070697_100005798
458 Ga0070697_100007211
459 Ga0070697_100023293
460 Ga0070697_100045573
461 Ga0070697_100083544
462 Ga0070697_100127350
463 Ga0070697_100276591
464 Ga0068853_100119446
465 Ga0070695_100019863
466 Ga0070696_100035796
467 Ga0068855_100133582
468 Ga0070664_100016056
469 Ga0070664_100022499
470 Ga0068856_100151329
471 Ga0068856_100189106
472 Ga0068859_100035804
473 Ga0068866_10027378
474 Ga0068851_10001808
475 Ga0068851_10012496
476 Ga0068870_10079569
477 Ga0068858_100085681
478 Ga0068858_100227796
479 Ga0068860_100074378
480 Ga0070717_10001776
481 Ga0070717_10017160
482 Ga0070717_10075614
483 Ga0070715_10005647
484 Ga0070716_100000124
485 Ga0070716_100007839
486 Ga0070716_100090330
487 Ga0070712_100000302
488 Ga0070712_100250093
489 Ga0097621_100020148
490 Ga0097621_100073825
491 Ga0068871_100032583
492 Ga0068871_100059920
493 Ga0068871_100127676
494 Ga0075428_100140346
495 Ga0075428_100513532
496 Ga0075433_10080996
497 Ga0075433_10145736
498 Ga0075434_100000005
499 Ga0075434_100003427
500 Ga0075434_100010866
501 Ga0075434_100074243
502 Ga0075429_100187654
503 Ga0075436_100000991
504 Ga0075436_100003843
505 Ga0075436_100004864
506 Ga0097620_100035806
507 Ga0075435_100004233
508 Ga0075435_100024237
509 Ga0075435_100048309
510 Ga0075435_100116263
511 Ga0099794_10010263
512 Ga0099794_10038393
513 Ga0105250_10041594
514 Ga0105240_10036101
515 Ga0105240_10085017
516 Ga0105240_10103929
517 Ga0111539_10269338
518 Ga0105245_10009826
519 Ga0105245_10084767
520 Ga0105245_10271730
521 Ga0105247_10065062
522 Ga0114129_10076519
523 Ga0114129_10261117
524 Ga0114129_10484121
525 Ga0114129_10688478
526 Ga0105241_10039238
527 Ga0105241_10087427
528 Ga0105242_10073256
529 Ga0105248_10162596
530 Ga0105248_10284246
531 Ga0105237_10219737
532 Ga0105238_10062825
533 Ga0105238_10303336
534 Ga0105249_10086754
535 Ga0105249_10153387
536 Ga0105239_10050296
537 Ga0105246_10002297
538 Ga0157373_10007252
539 Ga0157373_10028592
540 Ga0157373_10194729
541 Ga0157371_10025443
542 Ga0157371_10063963
543 Ga0157369_10000638
544 Ga0157369_10042083
545 Ga0157374_10089455
546 Ga0157374_10171390
547 Ga0157378_10044565
548 Ga0163162_10032008
549 Ga0163162_10099073
550 Ga0157372_10067428
551 Ga0157375_10065565
552 Ga0163163_10006273
553 Ga0157379_10008128
554 Ga0157379_10049076
555 Ga0157379_10160436
556 Ga0157379_10199119
557 Ga0157376_10028103
558 Ga0157376_10101993
559 Ga0157376_10170595
560 Ga0182007_10006669
561 Ga0163161_10009682
562 Ga0213876_10046845
563 Ga0228598_1000043
564 Ga0207697_10007820
565 Ga0207642_10018266
566 Ga0207680_10052856
567 Ga0207680_10095560
568 Ga0207647_10009445
569 Ga0207699_10020494
570 Ga0207699_10034971
571 Ga0207699_10036809
572 Ga0207699_10113379
573 Ga0207645_10003048
574 Ga0207643_10000363
575 Ga0207684_10000966
576 Ga0207684_10003721
577 Ga0207684_10141562
578 Ga0207654_10035546
579 Ga0207654_10042820
580 Ga0207707_10003557
581 Ga0207695_10200670
582 Ga0207671_10054220
583 Ga0207693_10000373
584 Ga0207693_10005083
585 Ga0207693_10064971
586 Ga0207663_10002079
587 Ga0207663_10007496
588 Ga0207663_10015835
589 Ga0207663_10046547
590 Ga0207660_10000546
591 Ga0207660_10154720
592 Ga0207662_10000664
593 Ga0207657_10001432
594 Ga0207657_10001455
595 Ga0207657_10006629
596 Ga0207649_10000794
597 Ga0207652_10004236
598 Ga0207652_10048251
599 Ga0207652_10324696
600 Ga0207646_10000020
601 Ga0207646_10006006
602 Ga0207646_10056647
603 Ga0207646_10073770
604 Ga0207646_10286435
605 Ga0207681_10152732
606 Ga0207694_10039766
607 Ga0207694_10045564
608 Ga0207694_10058027
609 Ga0207650_10000051
610 Ga0207650_10168790
611 Ga0207659_10202813
612 Ga0207687_10051976
613 Ga0207700_10007857
614 Ga0207700_10028451
615 Ga0207700_10228087
616 Ga0207664_10001175
617 Ga0207664_10234153
618 Ga0207644_10206743
619 Ga0207706_10000783
620 Ga0207706_10002653
621 Ga0207686_10163376
622 Ga0207665_10000034
623 Ga0207665_10000774
624 Ga0207665_10096800
625 Ga0207691_10002900
626 Ga0207711_10002266
627 Ga0207711_10009607
628 Ga0207711_10191931
629 Ga0207689_10000860
630 Ga0207689_10025762
631 Ga0207661_10000969
632 Ga0207661_10065645
633 Ga0207679_10000203
634 Ga0207679_10116747
635 Ga0207667_10028798
636 Ga0207667_10035271
637 Ga0207667_10375707
638 Ga0207651_10216760
639 Ga0207712_10027192
640 Ga0207658_10002771
641 Ga0207658_10127984
642 Ga0207677_10068238
643 Ga0207677_10081221
644 Ga0207639_10025861
645 Ga0207639_10044425
646 Ga0207678_10001066
647 Ga0207678_10078153
648 Ga0207702_10010773
649 Ga0207641_10000025
650 Ga0207641_10000673
651 Ga0207641_10164866
652 Ga0207648_10000966
653 Ga0207648_10126832
654 Ga0207676_10007622
655 Ga0207674_10001451
656 Ga0207683_10000742
657 Ga0207698_10156965
658 Ga0209588_1002403
659 Ga0207428_10115114
660 Ga0268266_10110925
661 Ga0268265_10048950
662 Ga0265338_10001594
663 Ga0265760_10000004
664 Ga0265328_10018666
665 Ga0265325_10001997
666 Ga0265340_10032621
667 Ga0265339_10002485
668 Ga0265331_10025146
669 Ga0265316_10021295
670 Ga0307408_100102317
671 Ga0265313_10018209
672 Ga0265314_10018014
673 Ga0265314_10038305
674 Ga0316212_1000774
675 Ga0373926_0005094
676 Ga0373926_0006273
677 Ga0373936_0022483
678 Ga0373945_0001300
679 Ga0373943_0094942
680 Ga0373946_0013990
681 Ga0373955_0014183
682 Ga0373924_0003090
683 Ga0373931_0007267
684 Ga0373931_0081574
685 Ga0373935_0026882
686 Ga0373927_0000357
687 Ga0373927_0012132
688 Ga0373933_0016913
689 Ga0373933_0038510
690 Ga0373947_0015095
691 Ga0373947_0030526
692 Ga0373947_0043281
693 Ga0373937_0000437
694 Ga0373937_0007462
695 Ga0373937_0034816
696 Ga0373937_0176727
697 Ga0373925_0001733
698 Ga0373925_0029998
699 Ga0373925_0249716
700 Ga0436365_0639242
701 Ga0436363_1080746
702 Ga0436362_0509378
703 Ga0453683_0178527
704 Ga0466963_0001758
705 Ga0466957_0004769
706 Ga0466959_0070703
707 Ga0466958_0090759
708 Ga0466967_0052715
709 Ga0466967_0094727
710 Ga0466967_0110385
711 Ga0495603_0035110
712 Ga0495603_0077010
713 Ga0495629_0063245
714 Ga0495580_0017762
715 Ga0495580_0025417
716 Ga0495580_0035513
717 Ga0495580_0055297
718 Ga0495580_0069932
719 Ga0495580_0184402
720 Ga0495639_0018162
721 Ga0495639_0023273
722 Ga0495664_0117536
723 Ga0495584_0054324
724 Ga0495628_0065819
725 Ga0495630_0000659
726 Ga0495630_0032747
727 Ga0495630_0174689
728 Ga0495666_0029428
729 Ga0495652_0087189
730 Ga0495665_0025910
731 Ga0495665_0044922
732 Ga0495640_0029025
733 Ga0495586_0011377
734 Ga0495645_0006585
735 Ga0495622_0057495
736 Ga0495635_0074618
737 Ga0495635_0103476
738 Ga0495658_0083644
739 Ga0495581_0062127
740 Ga0495676_0073073
741 Ga0495680_0055063
742 Ga0495614_0018551
743 Ga0496100_0040425
744 Ga0496102_0065906
745 Ga0496102_0119784
746 Ga0496102_0144020
747 Ga0496102_0149775
748 Ga0496102_0188331
749 Ga0496102_0242992
750 Ga0496103_0040135
751 Ga0496103_0055838
752 Ga0496104_0058617
753 Ga0496104_0131047
754 Ga0496105_0001474
755 Ga0496105_0054121
756 Ga0496105_0059384
757 Ga0496106_0040558
758 Ga0496106_0203247
759 Ga0496107_0054202
760 Ga0496108_0000169
761 Ga0496109_0000072
762 Ga0496109_0155443
763 Ga0496109_0279661
764 Ga0496110_0001865
765 Ga0496111_0005773
766 Ga0496111_0058229
767 Ga0496112_0000064
768 Ga0496112_0011741
769 Ga0496112_0047008
770 Ga0496112_0055168
771 Ga0496112_0093212
772 Ga0496113_0000253
773 Ga0496113_0002474
774 Ga0496113_0040955
775 Ga0496113_0086159
776 Ga0496115_0015307
777 Ga0501040_0223524
778 Ga0501076_0376463
779 nmdc:mga05p37_192067_c1
780 nmdc:mga05p37_336749_c1
781 nmdc:mga08y16_41250_c1
782 nmdc:mga0n895_1582_c1
783 nmdc:mga0n895_24203_c1
784 nmdc:mga0n895_603_c1
785 nmdc:mga0rr50_105602_c1
786 nmdc:mga0rr50_132213_c1
787 nmdc:mga0rr50_260_c1
788 nmdc:mga0rr50_6220_c1
789 nmdc:mga08x19_129749_c1
790 nmdc:mga08x19_1446_c1
791 nmdc:mga08x19_14588_c1
792 nmdc:mga08x19_35364_c1
793 nmdc:mga08x19_978_c1
794 nmdc:mga0a205_136_c1
795 nmdc:mga0a205_143043_c1
796 nmdc:mga0a205_329744_c1
797 Ga0495601_0026187
798 Ga0501084_0128756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22580

KYNU_C

Kynureninase C-terminal domain

292

376

0.93

PF00266

Aminotran_5

Aminotransferase class-V

19

371

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9214 3 384
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9077 3 384
2hzp-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase 0.8973 3 381
7s3v-assembly1.cif.gz_A structure of hskynase_66, an evolved variant of human kynureninase with greatly increased activity towards kynurenine 0.891 2 381
1n2t-assembly1.cif.gz_B c-des mutant k223a with gly covalenty linked to the plp-cofactor 0.8909 9 376
ID Description Score Start End Superfamily
1qz9A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9061 290 384 3.90.1150.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9009 30 286 3.40.640.10
af_P70712_80_352_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8885 30 286 3.40.640.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8843 30 286 3.40.640.10
af_Q10089_37_288_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8825 33 279 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A831WSC0-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9785 2 384 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7R7Y6N2-F1-model_v4 deleted 0.9772 1 379
AF-E6PIA1-F1-model_v4 Aminotransferase class V domain-containing protein 0.9735 9 381 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A538SAS1-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.972 29 384 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A1G0LMQ1-F1-model_v4 Aminotransferase class V domain-containing protein 0.9686 1 382 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420

Map