F432285

General Info

Members Datasets Scaffolds Average Seq Length
392 195 784 121

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100254393|Ga0075435_1002543931
Length 121
Sequence MTQVFVSDNKLVIEMQGWDKLWALKSRLEIPIEHIKAVRADPEIAKRGRRGIRMLGTYVPGVITAGSFRQDGDRIFWNVHRPENVIVIELHDEPYAKLIIEVLEPAVTVATIHNTLSARAA

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.77
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 26.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100254393 3300007076 Bacteria 1496
2 MBSR1b_contig_5985526 2162886012 Unclassified 943
3 Ga0065715_10747599 3300005293 Unclassified 632
4 Ga0070658_10028212 3300005327 Bacteria 4505
5 Ga0070658_10354292 3300005327 Bacteria 1256
6 Ga0070658_11042774 3300005327 Unclassified 711
7 Ga0070683_100424242 3300005329 Bacteria 1269
8 Ga0070683_100872909 3300005329 Bacteria 863
9 Ga0070690_101116131 3300005330 Unclassified 626
10 Ga0070670_101070135 3300005331 Bacteria 735
11 Ga0070677_10092017 3300005333 Bacteria 1321
12 Ga0068869_100258839 3300005334 Bacteria 1392
13 Ga0070666_11514000 3300005335 Unclassified 502
14 Ga0070680_100020137 3300005336 Bacteria 5292
15 Ga0070680_100222106 3300005336 Bacteria 1595
16 Ga0070680_100404891 3300005336 Unclassified 1163
17 Ga0070682_100838803 3300005337 Bacteria 750
18 Ga0068868_100446593 3300005338 Unclassified 1124
19 Ga0070689_100035149 3300005340 Bacteria 3827
20 Ga0070689_101203186 3300005340 Bacteria 680
21 Ga0070691_10001580 3300005341 Bacteria 9842
22 Ga0070691_10139350 3300005341 Bacteria 1235
23 Ga0070687_100032607 3300005343 Bacteria 2564
24 Ga0070661_100196171 3300005344 Bacteria 1541
25 Ga0070661_100249272 3300005344 Bacteria 1370
26 Ga0070661_100257421 3300005344 Bacteria 1348
27 Ga0070661_100666350 3300005344 Unclassified 846
28 Ga0070661_100811466 3300005344 Unclassified 768
29 Ga0070668_100479156 3300005347 Unclassified 1074
30 Ga0070669_100032623 3300005353 Bacteria 3762
31 Ga0070675_100053051 3300005354 Unclassified 3334
32 Ga0070675_100362629 3300005354 Bacteria 1287
33 Ga0070671_100232183 3300005355 Bacteria 1565
34 Ga0070673_100138040 3300005364 Bacteria 2054
35 Ga0070673_100176022 3300005364 Unclassified 1829
36 Ga0070673_100637235 3300005364 Bacteria 974
37 Ga0070688_100039168 3300005365 Bacteria 2900
38 Ga0070659_100154692 3300005366 Bacteria 1872
39 Ga0070659_100627000 3300005366 Unclassified 926
40 Ga0070667_100696522 3300005367 Bacteria 940
41 Ga0070709_10298540 3300005434 Bacteria 1176
42 Ga0070709_10440876 3300005434 Bacteria 979
43 Ga0070714_100008091 3300005435 Bacteria 8194
44 Ga0070714_100065104 3300005435 Bacteria 3139
45 Ga0070713_100126025 3300005436 Unclassified 2252
46 Ga0070713_100271728 3300005436 Unclassified 1552
47 Ga0070701_10254504 3300005438 Bacteria 1062
48 Ga0070711_100006594 3300005439 Bacteria 7010
49 Ga0070711_100931500 3300005439 Bacteria 743
50 Ga0070663_100008327 3300005455 Bacteria 6372
51 Ga0070681_10026357 3300005458 Bacteria 5844
52 Ga0070681_10038912 3300005458 Unclassified 4768
53 Ga0070681_10516461 3300005458 Bacteria 1108
54 Ga0070681_10679986 3300005458 Bacteria 945
55 Ga0070681_10710973 3300005458 Unclassified 921
56 Ga0070681_10807072 3300005458 Unclassified 856
57 Ga0070681_11946963 3300005458 Unclassified 515
58 Ga0070685_11377714 3300005466 Bacteria 541
59 Ga0070699_100365689 3300005518 Bacteria 1301
60 Ga0070699_101429564 3300005518 Unclassified 634
61 Ga0070679_100051978 3300005530 Bacteria 4082
62 Ga0070679_100098732 3300005530 Bacteria 2907
63 Ga0070679_100273799 3300005530 Bacteria 1642
64 Ga0070679_100468513 3300005530 Bacteria 1204
65 Ga0070679_100647878 3300005530 Unclassified 999
66 Ga0070684_100037733 3300005535 Bacteria 4147
67 Ga0070684_100066956 3300005535 Bacteria 3153
68 Ga0070684_100214310 3300005535 Bacteria 1756
69 Ga0070684_100278638 3300005535 Bacteria 1532
70 Ga0070684_101402783 3300005535 Unclassified 658
71 Ga0068853_100390822 3300005539 Bacteria 1300
72 Ga0070686_101377609 3300005544 Bacteria 591
73 Ga0068855_100186519 3300005563 Bacteria 2342
74 Ga0068855_100327934 3300005563 Unclassified 1690
75 Ga0068855_100634565 3300005563 Bacteria 1149
76 Ga0068855_100867681 3300005563 Bacteria 955
77 Ga0068855_101462699 3300005563 Bacteria 702
78 Ga0070664_100056598 3300005564 Bacteria 3332
79 Ga0070664_100127366 3300005564 Bacteria 2234
80 Ga0068857_100092461 3300005577 Bacteria 2708
81 Ga0068857_101438603 3300005577 Bacteria 671
82 Ga0068854_100111463 3300005578 Bacteria 2064
83 Ga0068854_101083965 3300005578 Unclassified 713
84 Ga0068856_100053334 3300005614 Bacteria 3986
85 Ga0068856_100223151 3300005614 Unclassified 1900
86 Ga0068856_101182381 3300005614 Bacteria 781
87 Ga0068852_100284465 3300005616 Bacteria 1595
88 Ga0068852_100526493 3300005616 Bacteria 1180
89 Ga0068852_100718304 3300005616 Bacteria 1010
90 Ga0068859_100149518 3300005617 Bacteria 2411
91 Ga0068859_100235074 3300005617 Bacteria 1921
92 Ga0068859_100746183 3300005617 Bacteria 1068
93 Ga0068864_100199122 3300005618 Bacteria 1839
94 Ga0068866_10134800 3300005718 Unclassified 1410
95 Ga0068870_10060070 3300005840 Bacteria 2040
96 Ga0068863_100020571 3300005841 Bacteria 6307
97 Ga0068858_100334196 3300005842 Bacteria 1449
98 Ga0068860_101257632 3300005843 Unclassified 761
99 Ga0068862_100913701 3300005844 Bacteria 864
100 Ga0070717_10302090 3300006028 Unclassified 1423
101 Ga0070717_10621783 3300006028 Unclassified 980
102 Ga0070712_100102177 3300006175 Unclassified 2123
103 Ga0070712_100429877 3300006175 Unclassified 1096
104 Ga0070712_101607539 3300006175 Bacteria 569
105 Ga0097621_100439328 3300006237 Bacteria 1174
106 Ga0097621_100474255 3300006237 Unclassified 1130
107 Ga0097621_100903894 3300006237 Unclassified 822
108 Ga0068871_101481850 3300006358 Bacteria 641
109 Ga0075431_100569427 3300006847 Bacteria 1119
110 Ga0068865_100079996 3300006881 Bacteria 2342
111 Ga0075436_100016938 3300006914 Unclassified 4987
112 Ga0075436_100046901 3300006914 Bacteria 2980
113 Ga0097620_100149522 3300006931 Bacteria 2411
114 Ga0097620_100235082 3300006931 Bacteria 1921
115 Ga0097620_100746183 3300006931 Bacteria 1068
116 Ga0105240_10069308 3300009093 Unclassified 4366
117 Ga0105240_10095207 3300009093 Bacteria 3631
118 Ga0105240_10119827 3300009093 Bacteria 3169
119 Ga0105240_10335615 3300009093 Bacteria 1718
120 Ga0105240_10377504 3300009093 Bacteria 1601
121 Ga0105240_12094021 3300009093 Unclassified 587
122 Ga0111539_10440563 3300009094 Bacteria 1517
123 Ga0105245_10165022 3300009098 Bacteria 2105
124 Ga0105245_10418314 3300009098 Bacteria 1343
125 Ga0105245_12767145 3300009098 Unclassified 543
126 Ga0105243_10235217 3300009148 Unclassified 1627
127 Ga0105243_10248758 3300009148 Bacteria 1586
128 Ga0105241_10029265 3300009174 Bacteria 4108
129 Ga0105241_10038563 3300009174 Bacteria 3602
130 Ga0105241_10842683 3300009174 Bacteria 847
131 Ga0105242_11022174 3300009176 Bacteria 836
132 Ga0105242_12803590 3300009176 Unclassified 538
133 Ga0105248_10538246 3300009177 Bacteria 1317
134 Ga0105248_10545858 3300009177 Bacteria 1307
135 Ga0105248_10774488 3300009177 Unclassified 1083
136 Ga0105248_10872525 3300009177 Bacteria 1016
137 Ga0105237_10261471 3300009545 Bacteria 1733
138 Ga0105238_10024304 3300009551 Bacteria 6177
139 Ga0105238_10052760 3300009551 Bacteria 4087
140 Ga0105249_10761471 3300009553 Bacteria 1031
141 Ga0105246_12261788 3300011119 Unclassified 530
142 Ga0157373_10021606 3300013100 Bacteria 4672
143 Ga0157373_10051337 3300013100 Bacteria 2937
144 Ga0157371_10560131 3300013102 Bacteria 848
145 Ga0157370_10003168 3300013104 Bacteria 19467
146 Ga0157370_10045147 3300013104 Unclassified 4229
147 Ga0157370_10105667 3300013104 Unclassified 2635
148 Ga0157370_11129370 3300013104 Bacteria 708
149 Ga0157370_11966487 3300013104 Bacteria 524
150 Ga0157369_10009760 3300013105 Bacteria 10978
151 Ga0157369_10015537 3300013105 Bacteria 8580
152 Ga0157369_10043769 3300013105 Bacteria 4879
153 Ga0157369_10065275 3300013105 Bacteria 3917
154 Ga0157369_10384927 3300013105 Unclassified 1456
155 Ga0157369_10508020 3300013105 Unclassified 1247
156 Ga0157369_10625343 3300013105 Unclassified 1111
157 Ga0157374_10635273 3300013296 Bacteria 1079
158 Ga0157378_10339847 3300013297 Unclassified 1464
159 Ga0157372_10016552 3300013307 Bacteria 7913
160 Ga0157372_10023793 3300013307 Bacteria 6645
161 Ga0157372_10176076 3300013307 Unclassified 2476
162 Ga0157372_10689307 3300013307 Bacteria 1189
163 Ga0157372_12094313 3300013307 Bacteria 650
164 Ga0157375_10010012 3300013308 Bacteria 8336
165 Ga0157375_10153398 3300013308 Bacteria 2441
166 Ga0157375_10173791 3300013308 Bacteria 2303
167 Ga0157375_10247160 3300013308 Bacteria 1944
168 Ga0163163_10003105 3300014325 Bacteria 14074
169 Ga0163163_12551374 3300014325 Unclassified 569
170 Ga0157379_11606166 3300014968 Unclassified 635
171 Ga0157376_10243014 3300014969 Bacteria 1678
172 Ga0157376_10579423 3300014969 Bacteria 1114
173 Ga0157376_11994462 3300014969 Unclassified 618
174 Ga0197907_10491385 3300020069 Bacteria 784
175 Ga0206356_10432162 3300020070 Bacteria 658
176 Ga0206356_10953760 3300020070 Bacteria 799
177 Ga0206354_11396873 3300020081 Bacteria 694
178 Ga0224712_10232375 3300022467 Bacteria 847
179 Ga0207697_10063721 3300025315 Bacteria 1536
180 Ga0207642_10397447 3300025899 Bacteria 824
181 Ga0207699_10067321 3300025906 Bacteria 2177
182 Ga0207699_10566388 3300025906 Bacteria 825
183 Ga0207645_10508863 3300025907 Bacteria 816
184 Ga0207643_10065752 3300025908 Bacteria 2078
185 Ga0207705_10298273 3300025909 Bacteria 1236
186 Ga0207707_10031387 3300025912 Unclassified 4649
187 Ga0207707_10234786 3300025912 Bacteria 1595
188 Ga0207707_10490743 3300025912 Bacteria 1048
189 Ga0207707_11078406 3300025912 Unclassified 656
190 Ga0207695_10011345 3300025913 Bacteria 10801
191 Ga0207695_10014887 3300025913 Bacteria 9181
192 Ga0207695_10071258 3300025913 Bacteria 3550
193 Ga0207695_10188837 3300025913 Bacteria 1978
194 Ga0207695_10418704 3300025913 Bacteria 1224
195 Ga0207693_10207093 3300025915 Bacteria 1542
196 Ga0207693_10215812 3300025915 Bacteria 1507
197 Ga0207693_10273800 3300025915 Unclassified 1323
198 Ga0207693_10386348 3300025915 Unclassified 1094
199 Ga0207663_10087096 3300025916 Unclassified 2061
200 Ga0207663_10824635 3300025916 Bacteria 739
201 Ga0207662_10005092 3300025918 Bacteria 6969
202 Ga0207657_10303943 3300025919 Bacteria 1263
203 Ga0207649_10061125 3300025920 Bacteria 2370
204 Ga0207649_10438333 3300025920 Unclassified 984
205 Ga0207649_10577744 3300025920 Bacteria 862
206 Ga0207649_10651962 3300025920 Bacteria 813
207 Ga0207652_10034973 3300025921 Bacteria 4238
208 Ga0207652_10086888 3300025921 Bacteria 2742
209 Ga0207652_10168411 3300025921 Bacteria 1965
210 Ga0207652_10478568 3300025921 Unclassified 1122
211 Ga0207681_10396698 3300025923 Bacteria 1113
212 Ga0207694_10023778 3300025924 Bacteria 4653
213 Ga0207694_10512567 3300025924 Unclassified 1005
214 Ga0207694_11434236 3300025924 Bacteria 583
215 Ga0207659_10578175 3300025926 Bacteria 956
216 Ga0207659_10843478 3300025926 Bacteria 788
217 Ga0207687_10370674 3300025927 Unclassified 1171
218 Ga0207687_10617360 3300025927 Unclassified 915
219 Ga0207700_10020008 3300025928 Unclassified 4535
220 Ga0207664_10060656 3300025929 Bacteria 3015
221 Ga0207664_10062548 3300025929 Bacteria 2972
222 Ga0207644_10239244 3300025931 Bacteria 1445
223 Ga0207644_10882360 3300025931 Unclassified 749
224 Ga0207686_10266322 3300025934 Bacteria 1259
225 Ga0207686_10374439 3300025934 Unclassified 1078
226 Ga0207670_10271918 3300025936 Bacteria 1317
227 Ga0207669_10831188 3300025937 Unclassified 768
228 Ga0207704_10252765 3300025938 Unclassified 1324
229 Ga0207704_10365038 3300025938 Bacteria 1128
230 Ga0207704_11355322 3300025938 Unclassified 609
231 Ga0207704_11859755 3300025938 Unclassified 518
232 Ga0207665_10173790 3300025939 Bacteria 1557
233 Ga0207691_10009085 3300025940 Bacteria 9540
234 Ga0207691_10075824 3300025940 Bacteria 3032
235 Ga0207691_10494334 3300025940 Bacteria 1039
236 Ga0207711_10394761 3300025941 Bacteria 1285
237 Ga0207711_11737915 3300025941 Unclassified 567
238 Ga0207689_10393663 3300025942 Bacteria 1155
239 Ga0207689_11304233 3300025942 Unclassified 610
240 Ga0207661_10137022 3300025944 Bacteria 2103
241 Ga0207661_10584056 3300025944 Bacteria 1025
242 Ga0207679_10256753 3300025945 Unclassified 1489
243 Ga0207679_10971465 3300025945 Unclassified 778
244 Ga0207667_10003969 3300025949 Bacteria 18189
245 Ga0207667_10107336 3300025949 Bacteria 2880
246 Ga0207667_10135872 3300025949 Bacteria 2532
247 Ga0207667_10152585 3300025949 Bacteria 2377
248 Ga0207667_11262807 3300025949 Unclassified 716
249 Ga0207651_10108096 3300025960 Bacteria 2081
250 Ga0207651_11860159 3300025960 Unclassified 541
251 Ga0207668_10206030 3300025972 Bacteria 1570
252 Ga0207640_10002259 3300025981 Bacteria 10379
253 Ga0207640_11390229 3300025981 Unclassified 629
254 Ga0207658_10119199 3300025986 Unclassified 2101
255 Ga0207658_10288422 3300025986 Unclassified 1410
256 Ga0207677_10842743 3300026023 Bacteria 823
257 Ga0207702_10220675 3300026078 Unclassified 1767
258 Ga0207702_10708364 3300026078 Bacteria 992
259 Ga0207702_10837238 3300026078 Bacteria 910
260 Ga0207641_10161024 3300026088 Unclassified 2040
261 Ga0207676_10268247 3300026095 Bacteria 1545
262 Ga0207676_10618691 3300026095 Unclassified 1042
263 Ga0207674_10016023 3300026116 Bacteria 8212
264 Ga0207674_11283412 3300026116 Bacteria 702
265 Ga0207698_10828291 3300026142 Bacteria 929
266 Ga0207698_11753416 3300026142 Unclassified 636
267 Ga0268266_10164227 3300028379 Bacteria 2011
268 Ga0268264_11217980 3300028381 Unclassified 762
269 Ga0265332_10025631 3300031238 Bacteria 2589
270 Ga0265328_10122659 3300031239 Bacteria 970
271 Ga0265327_10056356 3300031251 Bacteria 2025
272 Ga0265314_10017967 3300031711 Bacteria 5533
273 Ga0316576_10535748 3300031727 Bacteria 859
274 Ga0373934_0000119 3300035086 Bacteria 28366
275 Ga0373934_0005870 3300035086 Bacteria 4544
276 Ga0373934_0006925 3300035086 Bacteria 4208
277 Ga0373934_0010457 3300035086 Bacteria 3482
278 Ga0373923_0001485 3300035111 Bacteria 6751
279 Ga0373923_0427167 3300035111 Unclassified 640
280 Ga0373953_0033520 3300035117 Bacteria 2010
281 Ga0373953_0470094 3300035117 Unclassified 556
282 Ga0373954_0043061 3300035118 Bacteria 2105
283 Ga0373956_0019243 3300035119 Bacteria 2895
284 Ga0373956_0165385 3300035119 Bacteria 1043
285 Ga0373956_0197823 3300035119 Bacteria 952
286 Ga0373956_0372190 3300035119 Bacteria 681
287 Ga0373957_0115506 3300035120 Bacteria 1083
288 Ga0373943_0419659 3300035170 Unclassified 774
289 Ga0373955_0000423 3300035172 Bacteria 17853
290 Ga0373955_0003795 3300035172 Bacteria 6655
291 Ga0373955_0094192 3300035172 Bacteria 1711
292 Ga0373924_0520044 3300035410 Unclassified 535
293 Ga0373935_0466639 3300035692 Unclassified 913
294 Ga0373927_0514951 3300035695 Bacteria 791
295 Ga0373933_0000326 3300035724 Bacteria 30682
296 Ga0373933_0009513 3300035724 Bacteria 5307
297 Ga0373933_0801323 3300035724 Unclassified 620
298 Ga0373933_0824770 3300035724 Unclassified 610
299 Ga0373937_0000220 3300036401 Bacteria 55056
300 Ga0373937_0003048 3300036401 Bacteria 14027
301 Ga0373937_0020413 3300036401 Bacteria 5940
302 Ga0373937_1032879 3300036401 Unclassified 771
303 Ga0373937_1872844 3300036401 Unclassified 546
304 Ga0373925_0789022 3300037068 Unclassified 783
305 Ga0451576_0409645 3300045051 Bacteria 1422
306 Ga0466967_0179914 3300045976 Unclassified 1994
307 Ga0466967_1384060 3300045976 Bacteria 701
308 Ga0495592_0000603 3300046454 Bacteria 25336
309 Ga0495629_0003832 3300046459 Bacteria 11345
310 Ga0495651_0013684 3300046462 Bacteria 6270
311 Ga0495651_0024303 3300046462 Bacteria 4715
312 Ga0495651_0076726 3300046462 Bacteria 2531
313 Ga0495653_0000148 3300046463 Bacteria 58325
314 Ga0495653_0012365 3300046463 Bacteria 6967
315 Ga0495653_0395683 3300046463 Bacteria 879
316 Ga0495639_0066657 3300046475 Bacteria 1658
317 Ga0495594_0067881 3300046499 Unclassified 1979
318 Ga0495594_0089762 3300046499 Bacteria 1721
319 Ga0495594_0352505 3300046499 Unclassified 838
320 Ga0495608_0001043 3300046511 Bacteria 19489
321 Ga0495618_0119667 3300046514 Bacteria 1687
322 Ga0495618_0265845 3300046514 Bacteria 1073
323 Ga0495628_0000148 3300046516 Bacteria 60692
324 Ga0495628_0059472 3300046516 Bacteria 3000
325 Ga0495628_0937088 3300046516 Bacteria 599
326 Ga0495630_0157613 3300046517 Bacteria 1728
327 Ga0495630_0199347 3300046517 Bacteria 1527
328 Ga0495663_0062234 3300046525 Unclassified 1175
329 Ga0495666_0136070 3300046526 Bacteria 1147
330 Ga0495652_0000364 3300046529 Bacteria 53798
331 Ga0495652_0021309 3300046529 Bacteria 5762
332 Ga0495652_0304142 3300046529 Bacteria 1158
333 Ga0495665_0015247 3300046531 Bacteria 4141
334 Ga0495665_0019241 3300046531 Bacteria 3671
335 Ga0495665_0260923 3300046531 Bacteria 891
336 Ga0495587_0005374 3300046536 Bacteria 8377
337 Ga0495587_0107058 3300046536 Bacteria 1608
338 Ga0495621_0099325 3300046539 Unclassified 1106
339 Ga0495645_0000649 3300046543 Bacteria 23971
340 Ga0495645_0000833 3300046543 Bacteria 20988
341 Ga0495645_0020527 3300046543 Bacteria 4768
342 Ga0495645_0138996 3300046543 Bacteria 1696
343 Ga0495622_0075919 3300046557 Bacteria 1549
344 Ga0495667_0000332 3300046559 Bacteria 29868
345 Ga0495667_0042198 3300046559 Bacteria 3025
346 Ga0495667_0069174 3300046559 Bacteria 2304
347 Ga0495635_0000156 3300046663 Bacteria 41746
348 Ga0495657_0000732 3300046675 Bacteria 29430
349 Ga0495599_0009813 3300046678 Bacteria 5860
350 Ga0495599_0020610 3300046678 Bacteria 4106
351 Ga0495599_0020678 3300046678 Bacteria 4101
352 Ga0495623_0000027 3300046679 Bacteria 90239
353 Ga0495623_0004466 3300046679 Bacteria 9187
354 Ga0495623_0044234 3300046679 Bacteria 2830
355 Ga0495646_0001449 3300046680 Bacteria 14087
356 Ga0495646_0324814 3300046680 Unclassified 810
357 Ga0495600_0000091 3300046809 Bacteria 48962
358 Ga0495600_0009877 3300046809 Bacteria 5908
359 Ga0495581_0029241 3300047315 Bacteria 3194
360 Ga0495581_0601773 3300047315 Bacteria 637
361 Ga0495604_0000535 3300047317 Bacteria 33495
362 Ga0495604_0063290 3300047317 Bacteria 2822
363 Ga0495680_0006410 3300047322 Bacteria 10942
364 Ga0495680_0167367 3300047322 Bacteria 1593
365 Ga0495675_0005482 3300047444 Bacteria 7743
366 Ga0495675_0024685 3300047444 Bacteria 3833
367 Ga0495675_0027791 3300047444 Bacteria 3605
368 Ga0495684_0000876 3300047471 Bacteria 24425
369 Ga0495684_0018138 3300047471 Bacteria 5424
370 Ga0495684_0364392 3300047471 Unclassified 1023
371 Ga0495593_0034191 3300047673 Bacteria 2766
372 Ga0495602_0000864 3300048088 Bacteria 29249
373 Ga0495602_0048313 3300048088 Bacteria 3825
374 Ga0495602_0399097 3300048088 Bacteria 981
375 Ga0496104_1227611 3300048907 Bacteria 653
376 Ga0496105_0706702 3300048908 Bacteria 773
377 Ga0496112_1290197 3300048915 Unclassified 646
378 Ga0501034_0557328 3300049571 Bacteria 1055
379 Ga0501047_1003973 3300049581 Bacteria 648
380 nmdc:mga0qj67_960898_c1 3300050509 Unclassified 671
381 nmdc:mga06r32_1219402_c1 3300050510 Unclassified 698
382 nmdc:mga08x19_134498_c1 3300050514 Bacteria 1666
383 nmdc:mga08x19_31591_c1 3300050514 Bacteria 3332
384 Ga0495601_0278041 3300053077 Bacteria 1092
385 Ga0495612_0001548 3300053078 Bacteria 9477
386 Ga0495612_0008905 3300053078 Bacteria 4068
387 Ga0495595_0019646 3300053084 Bacteria 2934
388 Ga0495595_0033041 3300053084 Bacteria 2333
389 Ga0495595_0313235 3300053084 Bacteria 790
390 Ga0495619_0000578 3300053085 Bacteria 24364
391 Ga0495619_0042839 3300053085 Bacteria 2966
392 Ga0495619_0266197 3300053085 Unclassified 1188
393 Ga0075435_100254393
394 MBSR1b_contig_5985526
395 Ga0065715_10747599
396 Ga0070658_10028212
397 Ga0070658_10354292
398 Ga0070658_11042774
399 Ga0070683_100424242
400 Ga0070683_100872909
401 Ga0070690_101116131
402 Ga0070670_101070135
403 Ga0070677_10092017
404 Ga0068869_100258839
405 Ga0070666_11514000
406 Ga0070680_100020137
407 Ga0070680_100222106
408 Ga0070680_100404891
409 Ga0070682_100838803
410 Ga0068868_100446593
411 Ga0070689_100035149
412 Ga0070689_101203186
413 Ga0070691_10001580
414 Ga0070691_10139350
415 Ga0070687_100032607
416 Ga0070661_100196171
417 Ga0070661_100249272
418 Ga0070661_100257421
419 Ga0070661_100666350
420 Ga0070661_100811466
421 Ga0070668_100479156
422 Ga0070669_100032623
423 Ga0070675_100053051
424 Ga0070675_100362629
425 Ga0070671_100232183
426 Ga0070673_100138040
427 Ga0070673_100176022
428 Ga0070673_100637235
429 Ga0070688_100039168
430 Ga0070659_100154692
431 Ga0070659_100627000
432 Ga0070667_100696522
433 Ga0070709_10298540
434 Ga0070709_10440876
435 Ga0070714_100008091
436 Ga0070714_100065104
437 Ga0070713_100126025
438 Ga0070713_100271728
439 Ga0070701_10254504
440 Ga0070711_100006594
441 Ga0070711_100931500
442 Ga0070663_100008327
443 Ga0070681_10026357
444 Ga0070681_10038912
445 Ga0070681_10516461
446 Ga0070681_10679986
447 Ga0070681_10710973
448 Ga0070681_10807072
449 Ga0070681_11946963
450 Ga0070685_11377714
451 Ga0070699_100365689
452 Ga0070699_101429564
453 Ga0070679_100051978
454 Ga0070679_100098732
455 Ga0070679_100273799
456 Ga0070679_100468513
457 Ga0070679_100647878
458 Ga0070684_100037733
459 Ga0070684_100066956
460 Ga0070684_100214310
461 Ga0070684_100278638
462 Ga0070684_101402783
463 Ga0068853_100390822
464 Ga0070686_101377609
465 Ga0068855_100186519
466 Ga0068855_100327934
467 Ga0068855_100634565
468 Ga0068855_100867681
469 Ga0068855_101462699
470 Ga0070664_100056598
471 Ga0070664_100127366
472 Ga0068857_100092461
473 Ga0068857_101438603
474 Ga0068854_100111463
475 Ga0068854_101083965
476 Ga0068856_100053334
477 Ga0068856_100223151
478 Ga0068856_101182381
479 Ga0068852_100284465
480 Ga0068852_100526493
481 Ga0068852_100718304
482 Ga0068859_100149518
483 Ga0068859_100235074
484 Ga0068859_100746183
485 Ga0068864_100199122
486 Ga0068866_10134800
487 Ga0068870_10060070
488 Ga0068863_100020571
489 Ga0068858_100334196
490 Ga0068860_101257632
491 Ga0068862_100913701
492 Ga0070717_10302090
493 Ga0070717_10621783
494 Ga0070712_100102177
495 Ga0070712_100429877
496 Ga0070712_101607539
497 Ga0097621_100439328
498 Ga0097621_100474255
499 Ga0097621_100903894
500 Ga0068871_101481850
501 Ga0075431_100569427
502 Ga0068865_100079996
503 Ga0075436_100016938
504 Ga0075436_100046901
505 Ga0097620_100149522
506 Ga0097620_100235082
507 Ga0097620_100746183
508 Ga0105240_10069308
509 Ga0105240_10095207
510 Ga0105240_10119827
511 Ga0105240_10335615
512 Ga0105240_10377504
513 Ga0105240_12094021
514 Ga0111539_10440563
515 Ga0105245_10165022
516 Ga0105245_10418314
517 Ga0105245_12767145
518 Ga0105243_10235217
519 Ga0105243_10248758
520 Ga0105241_10029265
521 Ga0105241_10038563
522 Ga0105241_10842683
523 Ga0105242_11022174
524 Ga0105242_12803590
525 Ga0105248_10538246
526 Ga0105248_10545858
527 Ga0105248_10774488
528 Ga0105248_10872525
529 Ga0105237_10261471
530 Ga0105238_10024304
531 Ga0105238_10052760
532 Ga0105249_10761471
533 Ga0105246_12261788
534 Ga0157373_10021606
535 Ga0157373_10051337
536 Ga0157371_10560131
537 Ga0157370_10003168
538 Ga0157370_10045147
539 Ga0157370_10105667
540 Ga0157370_11129370
541 Ga0157370_11966487
542 Ga0157369_10009760
543 Ga0157369_10015537
544 Ga0157369_10043769
545 Ga0157369_10065275
546 Ga0157369_10384927
547 Ga0157369_10508020
548 Ga0157369_10625343
549 Ga0157374_10635273
550 Ga0157378_10339847
551 Ga0157372_10016552
552 Ga0157372_10023793
553 Ga0157372_10176076
554 Ga0157372_10689307
555 Ga0157372_12094313
556 Ga0157375_10010012
557 Ga0157375_10153398
558 Ga0157375_10173791
559 Ga0157375_10247160
560 Ga0163163_10003105
561 Ga0163163_12551374
562 Ga0157379_11606166
563 Ga0157376_10243014
564 Ga0157376_10579423
565 Ga0157376_11994462
566 Ga0197907_10491385
567 Ga0206356_10432162
568 Ga0206356_10953760
569 Ga0206354_11396873
570 Ga0224712_10232375
571 Ga0207697_10063721
572 Ga0207642_10397447
573 Ga0207699_10067321
574 Ga0207699_10566388
575 Ga0207645_10508863
576 Ga0207643_10065752
577 Ga0207705_10298273
578 Ga0207707_10031387
579 Ga0207707_10234786
580 Ga0207707_10490743
581 Ga0207707_11078406
582 Ga0207695_10011345
583 Ga0207695_10014887
584 Ga0207695_10071258
585 Ga0207695_10188837
586 Ga0207695_10418704
587 Ga0207693_10207093
588 Ga0207693_10215812
589 Ga0207693_10273800
590 Ga0207693_10386348
591 Ga0207663_10087096
592 Ga0207663_10824635
593 Ga0207662_10005092
594 Ga0207657_10303943
595 Ga0207649_10061125
596 Ga0207649_10438333
597 Ga0207649_10577744
598 Ga0207649_10651962
599 Ga0207652_10034973
600 Ga0207652_10086888
601 Ga0207652_10168411
602 Ga0207652_10478568
603 Ga0207681_10396698
604 Ga0207694_10023778
605 Ga0207694_10512567
606 Ga0207694_11434236
607 Ga0207659_10578175
608 Ga0207659_10843478
609 Ga0207687_10370674
610 Ga0207687_10617360
611 Ga0207700_10020008
612 Ga0207664_10060656
613 Ga0207664_10062548
614 Ga0207644_10239244
615 Ga0207644_10882360
616 Ga0207686_10266322
617 Ga0207686_10374439
618 Ga0207670_10271918
619 Ga0207669_10831188
620 Ga0207704_10252765
621 Ga0207704_10365038
622 Ga0207704_11355322
623 Ga0207704_11859755
624 Ga0207665_10173790
625 Ga0207691_10009085
626 Ga0207691_10075824
627 Ga0207691_10494334
628 Ga0207711_10394761
629 Ga0207711_11737915
630 Ga0207689_10393663
631 Ga0207689_11304233
632 Ga0207661_10137022
633 Ga0207661_10584056
634 Ga0207679_10256753
635 Ga0207679_10971465
636 Ga0207667_10003969
637 Ga0207667_10107336
638 Ga0207667_10135872
639 Ga0207667_10152585
640 Ga0207667_11262807
641 Ga0207651_10108096
642 Ga0207651_11860159
643 Ga0207668_10206030
644 Ga0207640_10002259
645 Ga0207640_11390229
646 Ga0207658_10119199
647 Ga0207658_10288422
648 Ga0207677_10842743
649 Ga0207702_10220675
650 Ga0207702_10708364
651 Ga0207702_10837238
652 Ga0207641_10161024
653 Ga0207676_10268247
654 Ga0207676_10618691
655 Ga0207674_10016023
656 Ga0207674_11283412
657 Ga0207698_10828291
658 Ga0207698_11753416
659 Ga0268266_10164227
660 Ga0268264_11217980
661 Ga0265332_10025631
662 Ga0265328_10122659
663 Ga0265327_10056356
664 Ga0265314_10017967
665 Ga0316576_10535748
666 Ga0373934_0000119
667 Ga0373934_0005870
668 Ga0373934_0006925
669 Ga0373934_0010457
670 Ga0373923_0001485
671 Ga0373923_0427167
672 Ga0373953_0033520
673 Ga0373953_0470094
674 Ga0373954_0043061
675 Ga0373956_0019243
676 Ga0373956_0165385
677 Ga0373956_0197823
678 Ga0373956_0372190
679 Ga0373957_0115506
680 Ga0373943_0419659
681 Ga0373955_0000423
682 Ga0373955_0003795
683 Ga0373955_0094192
684 Ga0373924_0520044
685 Ga0373935_0466639
686 Ga0373927_0514951
687 Ga0373933_0000326
688 Ga0373933_0009513
689 Ga0373933_0801323
690 Ga0373933_0824770
691 Ga0373937_0000220
692 Ga0373937_0003048
693 Ga0373937_0020413
694 Ga0373937_1032879
695 Ga0373937_1872844
696 Ga0373925_0789022
697 Ga0451576_0409645
698 Ga0466967_0179914
699 Ga0466967_1384060
700 Ga0495592_0000603
701 Ga0495629_0003832
702 Ga0495651_0013684
703 Ga0495651_0024303
704 Ga0495651_0076726
705 Ga0495653_0000148
706 Ga0495653_0012365
707 Ga0495653_0395683
708 Ga0495639_0066657
709 Ga0495594_0067881
710 Ga0495594_0089762
711 Ga0495594_0352505
712 Ga0495608_0001043
713 Ga0495618_0119667
714 Ga0495618_0265845
715 Ga0495628_0000148
716 Ga0495628_0059472
717 Ga0495628_0937088
718 Ga0495630_0157613
719 Ga0495630_0199347
720 Ga0495663_0062234
721 Ga0495666_0136070
722 Ga0495652_0000364
723 Ga0495652_0021309
724 Ga0495652_0304142
725 Ga0495665_0015247
726 Ga0495665_0019241
727 Ga0495665_0260923
728 Ga0495587_0005374
729 Ga0495587_0107058
730 Ga0495621_0099325
731 Ga0495645_0000649
732 Ga0495645_0000833
733 Ga0495645_0020527
734 Ga0495645_0138996
735 Ga0495622_0075919
736 Ga0495667_0000332
737 Ga0495667_0042198
738 Ga0495667_0069174
739 Ga0495635_0000156
740 Ga0495657_0000732
741 Ga0495599_0009813
742 Ga0495599_0020610
743 Ga0495599_0020678
744 Ga0495623_0000027
745 Ga0495623_0004466
746 Ga0495623_0044234
747 Ga0495646_0001449
748 Ga0495646_0324814
749 Ga0495600_0000091
750 Ga0495600_0009877
751 Ga0495581_0029241
752 Ga0495581_0601773
753 Ga0495604_0000535
754 Ga0495604_0063290
755 Ga0495680_0006410
756 Ga0495680_0167367
757 Ga0495675_0005482
758 Ga0495675_0024685
759 Ga0495675_0027791
760 Ga0495684_0000876
761 Ga0495684_0018138
762 Ga0495684_0364392
763 Ga0495593_0034191
764 Ga0495602_0000864
765 Ga0495602_0048313
766 Ga0495602_0399097
767 Ga0496104_1227611
768 Ga0496105_0706702
769 Ga0496112_1290197
770 Ga0501034_0557328
771 Ga0501047_1003973
772 nmdc:mga0qj67_960898_c1
773 nmdc:mga06r32_1219402_c1
774 nmdc:mga08x19_134498_c1
775 nmdc:mga08x19_31591_c1
776 Ga0495601_0278041
777 Ga0495612_0001548
778 Ga0495612_0008905
779 Ga0495595_0019646
780 Ga0495595_0033041
781 Ga0495595_0313235
782 Ga0495619_0000578
783 Ga0495619_0042839
784 Ga0495619_0266197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mk9-assembly2.cif.gz_B crystal structure of an integrin beta3-talin chimera 0.7356 2 118
1mk9-assembly3.cif.gz_H crystal structure of an integrin beta3-talin chimera 0.7344 2 116
7zns-assembly2.cif.gz_B inactive d62n mutant of bt1760 endo-acting levanase from bacteroides thetaiotaomicron vpi-5482 0.7139 2 31
7r04-assembly1.cif.gz_A neurofibromin in open conformation 0.6835 2 116
3ulc-assembly1.cif.gz_A-2 crystal structure of the pleckstrin homology domain of saccharomyces cerevisiae avo1, a torc2 subunit, in the p3121 crystal form 0.6822 1 117
ID Description Score Start End Superfamily
af_A0A5K1K9F0_656_851_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8412 2 31 2.60.120.560
af_A4HYN1_1_120_3.10.150.10 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.8111 2 31 3.10.150.10
af_Q8I346_1_137_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.8023 1 31 3.30.450.50
af_F6NI92_14_335_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7968 2 31 2.130.10.10
af_P61074_1_165_3.10.150.10 Alpha Beta;Roll;DNA Polymerase III; Chain A, domain 2;DNA Polymerase III, subunit A, domain 2 0.796 2 31 3.10.150.10
ID Description Score Start End GO Terms
AF-A0A0K2UWQ3-F1-model_v4 Uncharacterized protein 0.9086 1 33
AF-A0A0Q4E5N3-F1-model_v4 OTU domain-containing protein 0.8503 1 33
AF-A0A417FKP6-F1-model_v4 deleted 0.8175 1 31
AF-A0A1E7DST7-F1-model_v4 Core-binding (CB) domain-containing protein 0.817 1 30 GO:0003677
AF-A0A2W5X957-F1-model_v4 Bacterial Pleckstrin homology domain-containing protein 0.8113 1 116

Map