F432111

General Info

Members Datasets Scaffolds Average Seq Length
391 210 782 54

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0390667|Ga0466968_0390667_78_269
Length 63
Sequence LGCQLKEIYVANSLRQLWSDERGQDIAEYAVMLAVILVIVIGTVRLIGTNANTVFSQVSSTIQ

Samples

Sample ID Description Type Environment
1 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
75 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
169 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.19
Metatranscriptomes 13.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.35
Rhizosphere 94.88
Stem 0
Stem Tuber 0
Unclassified 61.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466968_0390667 3300044735 Unclassified 681
2 Ga0058862_11943274 3300004803 Unclassified 587
3 Ga0065712_10006518 3300005290 Bacteria 5026
4 Ga0065715_10029856 3300005293 Unclassified 1856
5 Ga0065715_10131285 3300005293 Unclassified 2010
6 Ga0070658_10121911 3300005327 Bacteria 2167
7 Ga0070658_10179641 3300005327 Unclassified 1780
8 Ga0070676_10133892 3300005328 Unclassified 1570
9 Ga0070683_100010459 3300005329 Bacteria 7978
10 Ga0070683_100940910 3300005329 Unclassified 829
11 Ga0068869_100144364 3300005334 Unclassified 1841
12 Ga0070680_100576743 3300005336 Unclassified 965
13 Ga0070682_100236880 3300005337 Bacteria 1308
14 Ga0070682_100392967 3300005337 Unclassified 1047
15 Ga0068868_100363121 3300005338 Unclassified 1243
16 Ga0068868_100613064 3300005338 Unclassified 965
17 Ga0070660_100023846 3300005339 Bacteria 4536
18 Ga0070660_100131073 3300005339 Unclassified 2006
19 Ga0070689_101241188 3300005340 Unclassified 670
20 Ga0070691_10770663 3300005341 Unclassified 583
21 Ga0070687_100964988 3300005343 Unclassified 615
22 Ga0070687_101097788 3300005343 Unclassified 582
23 Ga0070661_100003660 3300005344 Bacteria 10587
24 Ga0070692_10890857 3300005345 Unclassified 614
25 Ga0070668_101685999 3300005347 Bacteria 582
26 Ga0070669_100197288 3300005353 Unclassified 1582
27 Ga0070675_101147309 3300005354 Unclassified 715
28 Ga0070675_101249206 3300005354 Unclassified 684
29 Ga0070671_100039961 3300005355 Bacteria 3895
30 Ga0070671_100078139 3300005355 Bacteria 2766
31 Ga0070659_100022823 3300005366 Bacteria 4780
32 Ga0070659_100061289 3300005366 Bacteria 2973
33 Ga0070667_100259996 3300005367 Unclassified 1554
34 Ga0070709_10008592 3300005434 Bacteria 5615
35 Ga0070709_10020802 3300005434 Bacteria 3815
36 Ga0070709_10029778 3300005434 Bacteria 3269
37 Ga0070709_10151131 3300005434 Unclassified 1605
38 Ga0070709_10365846 3300005434 Bacteria 1069
39 Ga0070709_10448465 3300005434 Unclassified 971
40 Ga0070714_100082129 3300005435 Unclassified 2807
41 Ga0070714_100232234 3300005435 Unclassified 1700
42 Ga0070714_100281304 3300005435 Bacteria 1546
43 Ga0070714_100411833 3300005435 Unclassified 1279
44 Ga0070714_102131926 3300005435 Unclassified 546
45 Ga0070713_100113077 3300005436 Bacteria 2370
46 Ga0070713_100120646 3300005436 Bacteria 2299
47 Ga0070713_100306429 3300005436 Unclassified 1463
48 Ga0070713_100491075 3300005436 Bacteria 1157
49 Ga0070713_100541251 3300005436 Unclassified 1102
50 Ga0070713_100708419 3300005436 Bacteria 961
51 Ga0070713_101807723 3300005436 Bacteria 593
52 Ga0070710_10006833 3300005437 Bacteria 5504
53 Ga0070710_10060677 3300005437 Bacteria 2152
54 Ga0070710_10102994 3300005437 Unclassified 1703
55 Ga0070710_10172056 3300005437 Unclassified 1350
56 Ga0070710_10395247 3300005437 Unclassified 925
57 Ga0070710_10439062 3300005437 Unclassified 882
58 Ga0070711_100006115 3300005439 Bacteria 7239
59 Ga0070681_10042935 3300005458 Bacteria 4530
60 Ga0070681_10902496 3300005458 Unclassified 802
61 Ga0070681_11415141 3300005458 Unclassified 619
62 Ga0070681_11570157 3300005458 Bacteria 583
63 Ga0070699_100070724 3300005518 Bacteria 3034
64 Ga0070699_100199234 3300005518 Unclassified 1780
65 Ga0070699_101606216 3300005518 Bacteria 596
66 Ga0070679_100038954 3300005530 Bacteria 4726
67 Ga0070679_101220283 3300005530 Unclassified 697
68 Ga0070679_102132511 3300005530 Unclassified 510
69 Ga0070684_100235373 3300005535 Unclassified 1673
70 Ga0070684_100966794 3300005535 Unclassified 799
71 Ga0070697_101298867 3300005536 Unclassified 649
72 Ga0068853_100095367 3300005539 Bacteria 2623
73 Ga0068853_100175172 3300005539 Unclassified 1943
74 Ga0070696_100216506 3300005546 Bacteria 1435
75 Ga0068855_100018119 3300005563 Bacteria 8462
76 Ga0068855_100122947 3300005563 Unclassified 2969
77 Ga0068855_101835339 3300005563 Unclassified 615
78 Ga0070664_100003986 3300005564 Bacteria 11876
79 Ga0070664_100007580 3300005564 Bacteria 8761
80 Ga0070664_101923839 3300005564 Unclassified 561
81 Ga0068857_100349561 3300005577 Unclassified 1369
82 Ga0068857_100460871 3300005577 Unclassified 1189
83 Ga0068854_100022083 3300005578 Bacteria 4328
84 Ga0068854_100070297 3300005578 Unclassified 2558
85 Ga0068856_100054959 3300005614 Unclassified 3929
86 Ga0068852_100028521 3300005616 Bacteria 4571
87 Ga0068852_100047841 3300005616 Bacteria 3652
88 Ga0068859_101443426 3300005617 Unclassified 759
89 Ga0068864_100084879 3300005618 Unclassified 2783
90 Ga0068864_100176190 3300005618 Bacteria 1952
91 Ga0068851_10003462 3300005834 Bacteria 7024
92 Ga0068863_100382281 3300005841 Unclassified 1375
93 Ga0068862_100732552 3300005844 Unclassified 960
94 Ga0070717_10174490 3300006028 Bacteria 1871
95 Ga0070717_10398502 3300006028 Unclassified 1236
96 Ga0070717_10733807 3300006028 Unclassified 898
97 Ga0070717_10750767 3300006028 Bacteria 887
98 Ga0070715_10016701 3300006163 Bacteria 2764
99 Ga0070715_10017210 3300006163 Unclassified 2733
100 Ga0070715_10049611 3300006163 Bacteria 1799
101 Ga0070715_10256860 3300006163 Unclassified 916
102 Ga0070715_10335068 3300006163 Unclassified 821
103 Ga0070716_100000047 3300006173 Bacteria 48702
104 Ga0070716_100001980 3300006173 Bacteria 9327
105 Ga0070716_100051519 3300006173 Bacteria 2340
106 Ga0070716_100158114 3300006173 Bacteria 1465
107 Ga0070716_100207684 3300006173 Unclassified 1306
108 Ga0070716_100318811 3300006173 Bacteria 1088
109 Ga0070716_100321340 3300006173 Unclassified 1085
110 Ga0070716_101460651 3300006173 Unclassified 558
111 Ga0070712_100003373 3300006175 Bacteria 9823
112 Ga0070712_100012562 3300006175 Bacteria 5385
113 Ga0070712_100127277 3300006175 Unclassified 1926
114 Ga0070712_100841220 3300006175 Unclassified 789
115 Ga0070712_101429186 3300006175 Unclassified 604
116 Ga0097621_101934563 3300006237 Unclassified 563
117 Ga0075433_10030700 3300006852 Bacteria 4587
118 Ga0075433_10092117 3300006852 Bacteria 2680
119 Ga0075434_100007404 3300006871 Bacteria 10162
120 Ga0075434_100118732 3300006871 Bacteria 2659
121 Ga0075434_100723988 3300006871 Bacteria 1012
122 Ga0075436_100000180 3300006914 Bacteria 39663
123 Ga0075436_100002470 3300006914 Bacteria 12724
124 Ga0075436_100007254 3300006914 Bacteria 7587
125 Ga0075436_100218304 3300006914 Unclassified 1353
126 Ga0097620_101443520 3300006931 Unclassified 759
127 Ga0075435_100123309 3300007076 Bacteria 2164
128 Ga0075435_100230291 3300007076 Bacteria 1574
129 Ga0075435_100306231 3300007076 Bacteria 1359
130 Ga0075435_101662269 3300007076 Unclassified 560
131 Ga0105240_10014933 3300009093 Bacteria 10580
132 Ga0105240_10032575 3300009093 Bacteria 6747
133 Ga0105240_10035217 3300009093 Bacteria 6453
134 Ga0105240_10137346 3300009093 Bacteria 2927
135 Ga0105241_10052934 3300009174 Unclassified 3102
136 Ga0105248_10005748 3300009177 Bacteria 13625
137 Ga0105248_10041023 3300009177 Bacteria 5189
138 Ga0105237_10028431 3300009545 Bacteria 5695
139 Ga0105238_10045974 3300009551 Bacteria 4408
140 Ga0105249_11727110 3300009553 Unclassified 698
141 Ga0105239_10294191 3300010375 Unclassified 1828
142 Ga0157373_10072246 3300013100 Unclassified 2435
143 Ga0157373_10116810 3300013100 Unclassified 1875
144 Ga0157373_10346972 3300013100 Bacteria 1059
145 Ga0157373_10936087 3300013100 Unclassified 644
146 Ga0157373_10989465 3300013100 Unclassified 627
147 Ga0157373_11521429 3300013100 Unclassified 511
148 Ga0157370_10125452 3300013104 Bacteria 2396
149 Ga0157370_10892920 3300013104 Unclassified 807
150 Ga0157370_11031495 3300013104 Unclassified 744
151 Ga0157369_10635318 3300013105 Unclassified 1101
152 Ga0157374_10019303 3300013296 Bacteria 6031
153 Ga0157378_10148532 3300013297 Unclassified 2182
154 Ga0157372_10031775 3300013307 Bacteria 5783
155 Ga0157372_10323619 3300013307 Unclassified 1795
156 Ga0157372_10459676 3300013307 Bacteria 1484
157 Ga0163163_10041801 3300014325 Unclassified 4485
158 Ga0163163_10058925 3300014325 Bacteria 3797
159 Ga0163163_10102682 3300014325 Unclassified 2883
160 Ga0163163_10204087 3300014325 Bacteria 2025
161 Ga0182008_10016077 3300014497 Bacteria 3893
162 Ga0157377_11562838 3300014745 Unclassified 527
163 Ga0157376_10276118 3300014969 Bacteria 1581
164 Ga0157376_10281375 3300014969 Bacteria 1567
165 Ga0182007_10002600 3300015262 Bacteria 8891
166 Ga0182005_1018007 3300015265 Unclassified 1954
167 Ga0213871_10072700 3300021441 Unclassified 974
168 Ga0207656_10010882 3300025321 Bacteria 3421
169 Ga0207692_10003548 3300025898 Bacteria 6099
170 Ga0207692_10170563 3300025898 Bacteria 1261
171 Ga0207692_10327817 3300025898 Unclassified 939
172 Ga0207692_10903468 3300025898 Unclassified 581
173 Ga0207685_10008492 3300025905 Bacteria 2928
174 Ga0207685_10009866 3300025905 Bacteria 2791
175 Ga0207685_10152032 3300025905 Bacteria 1048
176 Ga0207685_10220641 3300025905 Unclassified 901
177 Ga0207699_10012702 3300025906 Bacteria 4288
178 Ga0207699_10118347 3300025906 Bacteria 1709
179 Ga0207699_10191968 3300025906 Bacteria 1379
180 Ga0207645_10054544 3300025907 Bacteria 2552
181 Ga0207705_10421971 3300025909 Unclassified 1033
182 Ga0207654_10450466 3300025911 Unclassified 902
183 Ga0207654_10499914 3300025911 Unclassified 858
184 Ga0207707_10123973 3300025912 Unclassified 2259
185 Ga0207707_10203521 3300025912 Unclassified 1726
186 Ga0207707_10610965 3300025912 Unclassified 922
187 Ga0207695_10086527 3300025913 Bacteria 3161
188 Ga0207695_10195614 3300025913 Unclassified 1938
189 Ga0207695_10983377 3300025913 Unclassified 724
190 Ga0207695_11055143 3300025913 Bacteria 692
191 Ga0207671_10021628 3300025914 Bacteria 4876
192 Ga0207693_10081056 3300025915 Unclassified 2540
193 Ga0207693_10245453 3300025915 Bacteria 1405
194 Ga0207693_10246462 3300025915 Unclassified 1402
195 Ga0207693_10389294 3300025915 Unclassified 1090
196 Ga0207693_10430706 3300025915 Unclassified 1031
197 Ga0207693_11416423 3300025915 Unclassified 515
198 Ga0207663_10089865 3300025916 Unclassified 2035
199 Ga0207663_10174651 3300025916 Bacteria 1529
200 Ga0207663_10184405 3300025916 Bacteria 1493
201 Ga0207663_10382791 3300025916 Unclassified 1072
202 Ga0207660_10779835 3300025917 Unclassified 780
203 Ga0207657_10001448 3300025919 Bacteria 25392
204 Ga0207657_10008218 3300025919 Bacteria 10626
205 Ga0207649_10039176 3300025920 Unclassified 2871
206 Ga0207652_10281213 3300025921 Bacteria 1501
207 Ga0207652_10370071 3300025921 Unclassified 1293
208 Ga0207652_11546981 3300025921 Unclassified 567
209 Ga0207681_10107344 3300025923 Unclassified 2025
210 Ga0207694_10099864 3300025924 Unclassified 2299
211 Ga0207694_10102686 3300025924 Unclassified 2267
212 Ga0207700_10179563 3300025928 Bacteria 1772
213 Ga0207700_10180859 3300025928 Bacteria 1765
214 Ga0207700_10345219 3300025928 Unclassified 1295
215 Ga0207700_10472693 3300025928 Unclassified 1107
216 Ga0207700_12035771 3300025928 Unclassified 501
217 Ga0207664_10033777 3300025929 Bacteria 3935
218 Ga0207664_10096851 3300025929 Bacteria 2430
219 Ga0207664_10148492 3300025929 Unclassified 1989
220 Ga0207664_10532631 3300025929 Bacteria 1053
221 Ga0207644_10023722 3300025931 Unclassified 4206
222 Ga0207644_10259408 3300025931 Bacteria 1389
223 Ga0207690_10318843 3300025932 Unclassified 1221
224 Ga0207665_10000050 3300025939 Bacteria 76268
225 Ga0207665_10000125 3300025939 Bacteria 50974
226 Ga0207665_10011891 3300025939 Bacteria 5716
227 Ga0207665_10054530 3300025939 Bacteria 2696
228 Ga0207665_10123182 3300025939 Bacteria 1833
229 Ga0207665_10201034 3300025939 Bacteria 1452
230 Ga0207665_10258042 3300025939 Unclassified 1290
231 Ga0207665_10298113 3300025939 Unclassified 1204
232 Ga0207661_10324318 3300025944 Unclassified 1385
233 Ga0207661_10967423 3300025944 Unclassified 784
234 Ga0207679_10331804 3300025945 Unclassified 1320
235 Ga0207667_10030686 3300025949 Bacteria 5811
236 Ga0207667_10221902 3300025949 Unclassified 1936
237 Ga0207667_11623207 3300025949 Unclassified 615
238 Ga0207712_10803785 3300025961 Unclassified 827
239 Ga0207668_11260816 3300025972 Bacteria 665
240 Ga0207640_10383633 3300025981 Unclassified 1139
241 Ga0207640_11637789 3300025981 Unclassified 580
242 Ga0207658_10178002 3300025986 Unclassified 1758
243 Ga0207677_10778088 3300026023 Unclassified 855
244 Ga0207639_10042053 3300026041 Unclassified 3423
245 Ga0207639_10132929 3300026041 Bacteria 2062
246 Ga0207678_10032851 3300026067 Bacteria 4522
247 Ga0207678_10316500 3300026067 Unclassified 1342
248 Ga0207702_10257631 3300026078 Unclassified 1641
249 Ga0207702_11437815 3300026078 Unclassified 683
250 Ga0207641_10756410 3300026088 Unclassified 959
251 Ga0207676_10082077 3300026095 Unclassified 2621
252 Ga0207676_10251892 3300026095 Unclassified 1590
253 Ga0207674_10207778 3300026116 Unclassified 1907
254 Ga0207698_10273611 3300026142 Unclassified 1558
255 Ga0207698_10837655 3300026142 Unclassified 924
256 Ga0265338_10848121 3300028800 Unclassified 624
257 Ga0265762_1187668 3300030760 Unclassified 512
258 Ga0265767_120045 3300030836 Unclassified 503
259 Ga0265760_10073191 3300031090 Unclassified 1053
260 Ga0265760_10332732 3300031090 Unclassified 542
261 Ga0373926_0038272 3300035083 Bacteria 1708
262 Ga0373936_0003399 3300035113 Bacteria 5967
263 Ga0373945_0071015 3300035116 Unclassified 1318
264 Ga0373945_0278879 3300035116 Unclassified 712
265 Ga0373943_0115048 3300035170 Bacteria 1423
266 Ga0373943_0628948 3300035170 Unclassified 633
267 Ga0373946_0643100 3300035171 Unclassified 552
268 Ga0373931_0616439 3300035691 Unclassified 710
269 Ga0373931_1049559 3300035691 Bacteria 553
270 Ga0373935_0041645 3300035692 Unclassified 2886
271 Ga0373935_0897022 3300035692 Bacteria 657
272 Ga0373935_1242429 3300035692 Unclassified 556
273 Ga0373927_0077232 3300035695 Bacteria 2157
274 Ga0373927_0136599 3300035695 Bacteria 1603
275 Ga0373947_0124054 3300035725 Unclassified 1643
276 Ga0373925_0015996 3300037068 Bacteria 5432
277 Ga0373925_0775122 3300037068 Unclassified 791
278 Ga0373925_0884597 3300037068 Unclassified 736
279 Ga0373925_1168705 3300037068 Unclassified 633
280 Ga0373925_1278297 3300037068 Unclassified 602
281 Ga0436360_1110040 3300039438 Bacteria 985
282 Ga0436360_1362638 3300039438 Bacteria 2156
283 Ga0436363_0725747 3300039450 Bacteria 1920
284 Ga0436363_0922815 3300039450 Unclassified 902
285 Ga0436363_1333250 3300039450 Unclassified 1803
286 Ga0436362_1006131 3300039453 Bacteria 839
287 Ga0436362_1104477 3300039453 Unclassified 739
288 Ga0466957_0550691 3300044842 Unclassified 804
289 Ga0451576_0970166 3300045051 Unclassified 891
290 Ga0495629_0019340 3300046459 Bacteria 4867
291 Ga0495580_0000647 3300046472 Bacteria 29570
292 Ga0495580_0049155 3300046472 Bacteria 2984
293 Ga0495580_0089621 3300046472 Bacteria 2141
294 Ga0495580_0537225 3300046472 Unclassified 777
295 Ga0495580_0927487 3300046472 Unclassified 558
296 Ga0495582_0540531 3300046473 Unclassified 674
297 Ga0495639_0153169 3300046475 Unclassified 1113
298 Ga0495639_0505575 3300046475 Unclassified 617
299 Ga0495584_0018575 3300046491 Unclassified 3534
300 Ga0495584_0709496 3300046491 Unclassified 513
301 Ga0495594_0746339 3300046499 Unclassified 553
302 Ga0495630_0828162 3300046517 Unclassified 706
303 Ga0495666_0198656 3300046526 Unclassified 922
304 Ga0495652_0182465 3300046529 Bacteria 1609
305 Ga0495665_0007946 3300046531 Bacteria 5752
306 Ga0495665_0445559 3300046531 Unclassified 655
307 Ga0495665_0519112 3300046531 Unclassified 599
308 Ga0495645_0114666 3300046543 Bacteria 1904
309 Ga0495659_0188089 3300046664 Unclassified 843
310 Ga0495599_0329130 3300046678 Unclassified 918
311 Ga0495646_0270128 3300046680 Unclassified 906
312 Ga0495624_0086345 3300046690 Bacteria 1938
313 Ga0495674_0399130 3300047319 Unclassified 1110
314 Ga0495684_0437307 3300047471 Unclassified 912
315 Ga0496100_0147542 3300048903 Bacteria 1674
316 Ga0496102_0008861 3300048905 Bacteria 8634
317 Ga0496102_0052074 3300048905 Bacteria 3729
318 Ga0496103_0048137 3300048906 Unclassified 2634
319 Ga0496104_0038336 3300048907 Bacteria 4484
320 Ga0496104_1400378 3300048907 Unclassified 602
321 Ga0496105_0986664 3300048908 Unclassified 631
322 Ga0496106_0120182 3300048909 Unclassified 2053
323 Ga0496106_0588332 3300048909 Unclassified 892
324 Ga0496107_0071438 3300048910 Unclassified 2522
325 Ga0496108_0001985 3300048911 Bacteria 16372
326 Ga0496109_0513103 3300048912 Unclassified 1131
327 Ga0496111_0035803 3300048914 Bacteria 3549
328 Ga0496112_0928679 3300048915 Unclassified 791
329 Ga0496112_1463506 3300048915 Unclassified 597
330 Ga0496113_0498690 3300048916 Unclassified 977
331 Ga0496114_1347088 3300048917 Unclassified 601
332 nmdc:mga0n895_1979_c1 3300050512 Bacteria 15715
333 nmdc:mga0n895_2930_c1 3300050512 Bacteria 13536
334 nmdc:mga0rr50_313807_c1 3300050513 Bacteria 1313
335 nmdc:mga0rr50_82413_c1 3300050513 Bacteria 2484
336 nmdc:mga08x19_1108948_c1 3300050514 Unclassified 561
337 nmdc:mga08x19_1257_c1 3300050514 Bacteria 15738
338 nmdc:mga08x19_18718_c1 3300050514 Bacteria 4245
339 nmdc:mga08x19_89083_c1 3300050514 Bacteria 2035
340 nmdc:mga0a205_10880_c2 3300050515 Bacteria 5661
341 nmdc:mga0a205_55582_c2 3300050515 Bacteria 2726
342 Ga0495619_0526691 3300053085 Unclassified 812
343 Ga0587084_045384 3300059477 Unclassified 761
344 Ga0587084_118607 3300059477 Unclassified 554
345 Ga0587093_040548 3300059478 Unclassified 705
346 Ga0587066_063600 3300059490 Unclassified 759
347 Ga0587066_114839 3300059490 Unclassified 629
348 Ga0587070_033221 3300059491 Unclassified 948
349 Ga0587070_067424 3300059491 Unclassified 755
350 Ga0587073_0131511 3300059492 Unclassified 687
351 Ga0587077_083527 3300059493 Unclassified 738
352 Ga0587080_048998 3300059503 Unclassified 792
353 Ga0587082_070613 3300059504 Unclassified 709
354 Ga0587083_0011626 3300059505 Unclassified 1458
355 Ga0587085_062437 3300059506 Unclassified 708
356 Ga0587085_092707 3300059506 Unclassified 626
357 Ga0587085_173147 3300059506 Unclassified 513
358 Ga0587086_100962 3300059507 Unclassified 532
359 Ga0587088_072624 3300059508 Unclassified 720
360 Ga0587089_054698 3300059509 Unclassified 648
361 Ga0587090_042278 3300059510 Unclassified 807
362 Ga0587091_072890 3300059511 Unclassified 755
363 Ga0587092_043229 3300059512 Unclassified 792
364 Ga0587092_051339 3300059512 Unclassified 748
365 Ga0587094_016856 3300059513 Unclassified 1022
366 Ga0587094_050797 3300059513 Unclassified 702
367 Ga0587106_059236 3300059605 Unclassified 699
368 Ga0587125_032531 3300059607 Unclassified 672
369 Ga0587099_062772 3300059622 Unclassified 516
370 Ga0587101_068274 3300059623 Unclassified 649
371 Ga0587109_159982 3300059624 Unclassified 563
372 Ga0587113_052440 3300059625 Unclassified 512
373 Ga0587115_048773 3300059626 Unclassified 682
374 Ga0587117_053942 3300059627 Unclassified 674
375 Ga0587127_019618 3300059629 Unclassified 592
376 Ga0587128_114160 3300059630 Unclassified 581
377 Ga0587067_080639 3300059640 Unclassified 720
378 Ga0587068_065388 3300059641 Unclassified 708
379 Ga0587069_051684 3300059642 Unclassified 733
380 Ga0587072_114802 3300059643 Unclassified 618
381 Ga0587075_049420 3300059644 Unclassified 729
382 Ga0587076_075351 3300059645 Unclassified 709
383 Ga0587079_080537 3300059647 Unclassified 744
384 Ga0587100_030660 3300059648 Unclassified 569
385 Ga0587102_022472 3300059649 Unclassified 722
386 Ga0587107_041773 3300059652 Unclassified 744
387 Ga0587110_020320 3300059654 Unclassified 748
388 Ga0587114_092788 3300059655 Unclassified 578
389 Ga0587060_025442 3300060243 Unclassified 582
390 Ga0587071_076845 3300060344 Unclassified 737
391 Ga0587111_0108929 3300060346 Unclassified 700
392 Ga0466968_0390667
393 Ga0058862_11943274
394 Ga0065712_10006518
395 Ga0065715_10029856
396 Ga0065715_10131285
397 Ga0070658_10121911
398 Ga0070658_10179641
399 Ga0070676_10133892
400 Ga0070683_100010459
401 Ga0070683_100940910
402 Ga0068869_100144364
403 Ga0070680_100576743
404 Ga0070682_100236880
405 Ga0070682_100392967
406 Ga0068868_100363121
407 Ga0068868_100613064
408 Ga0070660_100023846
409 Ga0070660_100131073
410 Ga0070689_101241188
411 Ga0070691_10770663
412 Ga0070687_100964988
413 Ga0070687_101097788
414 Ga0070661_100003660
415 Ga0070692_10890857
416 Ga0070668_101685999
417 Ga0070669_100197288
418 Ga0070675_101147309
419 Ga0070675_101249206
420 Ga0070671_100039961
421 Ga0070671_100078139
422 Ga0070659_100022823
423 Ga0070659_100061289
424 Ga0070667_100259996
425 Ga0070709_10008592
426 Ga0070709_10020802
427 Ga0070709_10029778
428 Ga0070709_10151131
429 Ga0070709_10365846
430 Ga0070709_10448465
431 Ga0070714_100082129
432 Ga0070714_100232234
433 Ga0070714_100281304
434 Ga0070714_100411833
435 Ga0070714_102131926
436 Ga0070713_100113077
437 Ga0070713_100120646
438 Ga0070713_100306429
439 Ga0070713_100491075
440 Ga0070713_100541251
441 Ga0070713_100708419
442 Ga0070713_101807723
443 Ga0070710_10006833
444 Ga0070710_10060677
445 Ga0070710_10102994
446 Ga0070710_10172056
447 Ga0070710_10395247
448 Ga0070710_10439062
449 Ga0070711_100006115
450 Ga0070681_10042935
451 Ga0070681_10902496
452 Ga0070681_11415141
453 Ga0070681_11570157
454 Ga0070699_100070724
455 Ga0070699_100199234
456 Ga0070699_101606216
457 Ga0070679_100038954
458 Ga0070679_101220283
459 Ga0070679_102132511
460 Ga0070684_100235373
461 Ga0070684_100966794
462 Ga0070697_101298867
463 Ga0068853_100095367
464 Ga0068853_100175172
465 Ga0070696_100216506
466 Ga0068855_100018119
467 Ga0068855_100122947
468 Ga0068855_101835339
469 Ga0070664_100003986
470 Ga0070664_100007580
471 Ga0070664_101923839
472 Ga0068857_100349561
473 Ga0068857_100460871
474 Ga0068854_100022083
475 Ga0068854_100070297
476 Ga0068856_100054959
477 Ga0068852_100028521
478 Ga0068852_100047841
479 Ga0068859_101443426
480 Ga0068864_100084879
481 Ga0068864_100176190
482 Ga0068851_10003462
483 Ga0068863_100382281
484 Ga0068862_100732552
485 Ga0070717_10174490
486 Ga0070717_10398502
487 Ga0070717_10733807
488 Ga0070717_10750767
489 Ga0070715_10016701
490 Ga0070715_10017210
491 Ga0070715_10049611
492 Ga0070715_10256860
493 Ga0070715_10335068
494 Ga0070716_100000047
495 Ga0070716_100001980
496 Ga0070716_100051519
497 Ga0070716_100158114
498 Ga0070716_100207684
499 Ga0070716_100318811
500 Ga0070716_100321340
501 Ga0070716_101460651
502 Ga0070712_100003373
503 Ga0070712_100012562
504 Ga0070712_100127277
505 Ga0070712_100841220
506 Ga0070712_101429186
507 Ga0097621_101934563
508 Ga0075433_10030700
509 Ga0075433_10092117
510 Ga0075434_100007404
511 Ga0075434_100118732
512 Ga0075434_100723988
513 Ga0075436_100000180
514 Ga0075436_100002470
515 Ga0075436_100007254
516 Ga0075436_100218304
517 Ga0097620_101443520
518 Ga0075435_100123309
519 Ga0075435_100230291
520 Ga0075435_100306231
521 Ga0075435_101662269
522 Ga0105240_10014933
523 Ga0105240_10032575
524 Ga0105240_10035217
525 Ga0105240_10137346
526 Ga0105241_10052934
527 Ga0105248_10005748
528 Ga0105248_10041023
529 Ga0105237_10028431
530 Ga0105238_10045974
531 Ga0105249_11727110
532 Ga0105239_10294191
533 Ga0157373_10072246
534 Ga0157373_10116810
535 Ga0157373_10346972
536 Ga0157373_10936087
537 Ga0157373_10989465
538 Ga0157373_11521429
539 Ga0157370_10125452
540 Ga0157370_10892920
541 Ga0157370_11031495
542 Ga0157369_10635318
543 Ga0157374_10019303
544 Ga0157378_10148532
545 Ga0157372_10031775
546 Ga0157372_10323619
547 Ga0157372_10459676
548 Ga0163163_10041801
549 Ga0163163_10058925
550 Ga0163163_10102682
551 Ga0163163_10204087
552 Ga0182008_10016077
553 Ga0157377_11562838
554 Ga0157376_10276118
555 Ga0157376_10281375
556 Ga0182007_10002600
557 Ga0182005_1018007
558 Ga0213871_10072700
559 Ga0207656_10010882
560 Ga0207692_10003548
561 Ga0207692_10170563
562 Ga0207692_10327817
563 Ga0207692_10903468
564 Ga0207685_10008492
565 Ga0207685_10009866
566 Ga0207685_10152032
567 Ga0207685_10220641
568 Ga0207699_10012702
569 Ga0207699_10118347
570 Ga0207699_10191968
571 Ga0207645_10054544
572 Ga0207705_10421971
573 Ga0207654_10450466
574 Ga0207654_10499914
575 Ga0207707_10123973
576 Ga0207707_10203521
577 Ga0207707_10610965
578 Ga0207695_10086527
579 Ga0207695_10195614
580 Ga0207695_10983377
581 Ga0207695_11055143
582 Ga0207671_10021628
583 Ga0207693_10081056
584 Ga0207693_10245453
585 Ga0207693_10246462
586 Ga0207693_10389294
587 Ga0207693_10430706
588 Ga0207693_11416423
589 Ga0207663_10089865
590 Ga0207663_10174651
591 Ga0207663_10184405
592 Ga0207663_10382791
593 Ga0207660_10779835
594 Ga0207657_10001448
595 Ga0207657_10008218
596 Ga0207649_10039176
597 Ga0207652_10281213
598 Ga0207652_10370071
599 Ga0207652_11546981
600 Ga0207681_10107344
601 Ga0207694_10099864
602 Ga0207694_10102686
603 Ga0207700_10179563
604 Ga0207700_10180859
605 Ga0207700_10345219
606 Ga0207700_10472693
607 Ga0207700_12035771
608 Ga0207664_10033777
609 Ga0207664_10096851
610 Ga0207664_10148492
611 Ga0207664_10532631
612 Ga0207644_10023722
613 Ga0207644_10259408
614 Ga0207690_10318843
615 Ga0207665_10000050
616 Ga0207665_10000125
617 Ga0207665_10011891
618 Ga0207665_10054530
619 Ga0207665_10123182
620 Ga0207665_10201034
621 Ga0207665_10258042
622 Ga0207665_10298113
623 Ga0207661_10324318
624 Ga0207661_10967423
625 Ga0207679_10331804
626 Ga0207667_10030686
627 Ga0207667_10221902
628 Ga0207667_11623207
629 Ga0207712_10803785
630 Ga0207668_11260816
631 Ga0207640_10383633
632 Ga0207640_11637789
633 Ga0207658_10178002
634 Ga0207677_10778088
635 Ga0207639_10042053
636 Ga0207639_10132929
637 Ga0207678_10032851
638 Ga0207678_10316500
639 Ga0207702_10257631
640 Ga0207702_11437815
641 Ga0207641_10756410
642 Ga0207676_10082077
643 Ga0207676_10251892
644 Ga0207674_10207778
645 Ga0207698_10273611
646 Ga0207698_10837655
647 Ga0265338_10848121
648 Ga0265762_1187668
649 Ga0265767_120045
650 Ga0265760_10073191
651 Ga0265760_10332732
652 Ga0373926_0038272
653 Ga0373936_0003399
654 Ga0373945_0071015
655 Ga0373945_0278879
656 Ga0373943_0115048
657 Ga0373943_0628948
658 Ga0373946_0643100
659 Ga0373931_0616439
660 Ga0373931_1049559
661 Ga0373935_0041645
662 Ga0373935_0897022
663 Ga0373935_1242429
664 Ga0373927_0077232
665 Ga0373927_0136599
666 Ga0373947_0124054
667 Ga0373925_0015996
668 Ga0373925_0775122
669 Ga0373925_0884597
670 Ga0373925_1168705
671 Ga0373925_1278297
672 Ga0436360_1110040
673 Ga0436360_1362638
674 Ga0436363_0725747
675 Ga0436363_0922815
676 Ga0436363_1333250
677 Ga0436362_1006131
678 Ga0436362_1104477
679 Ga0466957_0550691
680 Ga0451576_0970166
681 Ga0495629_0019340
682 Ga0495580_0000647
683 Ga0495580_0049155
684 Ga0495580_0089621
685 Ga0495580_0537225
686 Ga0495580_0927487
687 Ga0495582_0540531
688 Ga0495639_0153169
689 Ga0495639_0505575
690 Ga0495584_0018575
691 Ga0495584_0709496
692 Ga0495594_0746339
693 Ga0495630_0828162
694 Ga0495666_0198656
695 Ga0495652_0182465
696 Ga0495665_0007946
697 Ga0495665_0445559
698 Ga0495665_0519112
699 Ga0495645_0114666
700 Ga0495659_0188089
701 Ga0495599_0329130
702 Ga0495646_0270128
703 Ga0495624_0086345
704 Ga0495674_0399130
705 Ga0495684_0437307
706 Ga0496100_0147542
707 Ga0496102_0008861
708 Ga0496102_0052074
709 Ga0496103_0048137
710 Ga0496104_0038336
711 Ga0496104_1400378
712 Ga0496105_0986664
713 Ga0496106_0120182
714 Ga0496106_0588332
715 Ga0496107_0071438
716 Ga0496108_0001985
717 Ga0496109_0513103
718 Ga0496111_0035803
719 Ga0496112_0928679
720 Ga0496112_1463506
721 Ga0496113_0498690
722 Ga0496114_1347088
723 nmdc:mga0n895_1979_c1
724 nmdc:mga0n895_2930_c1
725 nmdc:mga0rr50_313807_c1
726 nmdc:mga0rr50_82413_c1
727 nmdc:mga08x19_1108948_c1
728 nmdc:mga08x19_1257_c1
729 nmdc:mga08x19_18718_c1
730 nmdc:mga08x19_89083_c1
731 nmdc:mga0a205_10880_c2
732 nmdc:mga0a205_55582_c2
733 Ga0495619_0526691
734 Ga0587084_045384
735 Ga0587084_118607
736 Ga0587093_040548
737 Ga0587066_063600
738 Ga0587066_114839
739 Ga0587070_033221
740 Ga0587070_067424
741 Ga0587073_0131511
742 Ga0587077_083527
743 Ga0587080_048998
744 Ga0587082_070613
745 Ga0587083_0011626
746 Ga0587085_062437
747 Ga0587085_092707
748 Ga0587085_173147
749 Ga0587086_100962
750 Ga0587088_072624
751 Ga0587089_054698
752 Ga0587090_042278
753 Ga0587091_072890
754 Ga0587092_043229
755 Ga0587092_051339
756 Ga0587094_016856
757 Ga0587094_050797
758 Ga0587106_059236
759 Ga0587125_032531
760 Ga0587099_062772
761 Ga0587101_068274
762 Ga0587109_159982
763 Ga0587113_052440
764 Ga0587115_048773
765 Ga0587117_053942
766 Ga0587127_019618
767 Ga0587128_114160
768 Ga0587067_080639
769 Ga0587068_065388
770 Ga0587069_051684
771 Ga0587072_114802
772 Ga0587075_049420
773 Ga0587076_075351
774 Ga0587079_080537
775 Ga0587100_030660
776 Ga0587102_022472
777 Ga0587107_041773
778 Ga0587110_020320
779 Ga0587114_092788
780 Ga0587060_025442
781 Ga0587071_076845
782 Ga0587111_0108929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map