F430286

General Info

Members Datasets Scaffolds Average Seq Length
385 173 371 191

Family's Representative Sequence

Representative Sequence 3300046500|Ga0495596_0008903|Ga0495596_0008903_3692_4375
Length 227
Sequence MKQLFMFCQVYPIEPNIYSGLRRCFGERNQDHYRMTIMKIKHIIALLATAASSAAFAADTYTIEPNHTYPSFEADHMGGLSFWRGKFTKTAGTITLDRAARTGAVEITIDTDSIDFGNAKLNEHVMSPEMFDVVKYPKAVYKSASIQFKGDKPAIVNGDLTLHGVTRPVKLVIDHFKCMPHPMFKREVCGANAVATFNRSDFGISYGTQMGFSPEVKLAIQVEALKQ

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
7 2842711865 Duganella sp. R-73148 Isolate Unclassified
8 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
9 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
10 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
11 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
12 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
13 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
14 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
53 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
87 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
88 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
89 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
117 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
173 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 0.78
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 1.56
Rhizoplane 1.3
Rhizosphere 84.94
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000142 3300002704 Bacteria 33693
2 JGI25155J39150_1000219 3300002704 Bacteria 22984
3 JGI25156J39149_1000497 3300002705 Bacteria 23452
4 JGI25156J39149_1003054 3300002705 Bacteria 5671
5 JGI25162J39368_1005347 3300002737 Bacteria 2559
6 JGI25154J39366_1000423 3300002738 Bacteria 22650
7 JGI25154J39366_1000432 3300002738 Bacteria 22245
8 JGI25157J39369_1000158 3300002741 Bacteria 56328
9 JGI25157J39369_1000203 3300002741 Bacteria 49480
10 Ga0006758J48902_1012612 3300003300 Bacteria 707
11 Ga0006770J48903_1051480 3300003305 Bacteria 624
12 Ga0055532_1000005 3300003758 Bacteria 458107
13 Ga0055526_1015070 3300003771 Bacteria 3127
14 Ga0070670_100000002 3300005331 Bacteria 568775
15 Ga0070666_10015072 3300005335 Bacteria 4926
16 Ga0070669_100005576 3300005353 Bacteria 9091
17 Ga0070671_100000025 3300005355 Bacteria 121912
18 Ga0070688_100004285 3300005365 Bacteria 7416
19 Ga0070667_100000394 3300005367 Bacteria 47270
20 Ga0070685_10000005 3300005466 Bacteria 190119
21 Ga0070665_100150604 3300005548 Bacteria 2329
22 Ga0068855_100106549 3300005563 Bacteria 3222
23 Ga0068857_100623394 3300005577 Bacteria 1021
24 Ga0068859_100041050 3300005617 Bacteria 4648
25 Ga0068864_100000003 3300005618 Bacteria 568775
26 Ga0068861_100004915 3300005719 Bacteria 9003
27 Ga0068863_101042396 3300005841 Unclassified 821
28 Ga0068860_100000326 3300005843 Bacteria 64692
29 Ga0068862_100068501 3300005844 Bacteria 3061
30 Ga0070712_100003941 3300006175 Bacteria 9138
31 Ga0075370_10239156 3300006353 Bacteria 1075
32 Ga0097620_100041051 3300006931 Bacteria 4648
33 Ga0105251_10015285 3300009011 Bacteria 4203
34 Ga0105251_10076868 3300009011 Bacteria 1549
35 Ga0105240_10003355 3300009093 Bacteria 24916
36 Ga0105238_10035298 3300009551 Bacteria 5084
37 Ga0157373_10065917 3300013100 Bacteria 2562
38 Ga0163162_10507823 3300013306 Bacteria 1336
39 Ga0163162_10651076 3300013306 Bacteria 1177
40 Ga0163163_10000136 3300014325 Bacteria 75532
41 Ga0157380_10004535 3300014326 Bacteria 9640
42 Ga0157380_10458164 3300014326 Bacteria 1227
43 Ga0182008_10022337 3300014497 Bacteria 3241
44 Ga0182006_1003847 3300015261 Bacteria 7537
45 Ga0182007_10027096 3300015262 Bacteria 1979
46 Ga0209435_100004 3300025206 Bacteria 633417
47 Ga0209435_100214 3300025206 Bacteria 16487
48 Ga0209147_100011 3300025229 Bacteria 702140
49 Ga0209437_100084 3300025233 Bacteria 255423
50 Ga0209437_101166 3300025233 Bacteria 7812
51 Ga0209258_100560 3300025242 Bacteria 32331
52 Ga0209646_1000032 3300025246 Bacteria 375315
53 Ga0209646_1000114 3300025246 Bacteria 152958
54 Ga0209646_1000283 3300025246 Bacteria 44163
55 Ga0209026_1000062 3300025250 Bacteria 213298
56 Ga0209026_1001071 3300025250 Bacteria 13234
57 Ga0209026_1008799 3300025250 Bacteria 2060
58 Ga0209759_1000054 3300025256 Bacteria 211422
59 Ga0209759_1000548 3300025256 Bacteria 38674
60 Ga0209759_1026395 3300025256 Bacteria 1218
61 Ga0209455_1012314 3300025272 Bacteria 2054
62 Ga0209025_1004468 3300025294 Bacteria 12144
63 Ga0209564_1000006 3300025295 Bacteria 1100927
64 Ga0209051_1025547 3300025303 Bacteria 2400
65 Ga0207713_1061014 3300025735 Bacteria 1437
66 Ga0207680_10007523 3300025903 Bacteria 5318
67 Ga0207695_10001902 3300025913 Bacteria 32583
68 Ga0207693_10019007 3300025915 Bacteria 5469
69 Ga0207681_10000156 3300025923 Bacteria 56382
70 Ga0207694_10083481 3300025924 Bacteria 2512
71 Ga0207650_10000003 3300025925 Bacteria 1123235
72 Ga0207644_10000312 3300025931 Bacteria 31641
73 Ga0207711_10002080 3300025941 Bacteria 18084
74 Ga0207711_10008967 3300025941 Bacteria 8363
75 Ga0207667_10087097 3300025949 Bacteria 3231
76 Ga0207658_10000004 3300025986 Bacteria 569357
77 Ga0207641_10190748 3300026088 Bacteria 1883
78 Ga0207676_10000003 3300026095 Bacteria 1123235
79 Ga0207674_10193579 3300026116 Bacteria 1983
80 Ga0207675_100006059 3300026118 Bacteria 11506
81 Ga0207698_10002422 3300026142 Bacteria 11040
82 Ga0209282_1000063 3300027666 Bacteria 93789
83 Ga0268266_10060143 3300028379 Bacteria 3274
84 Ga0268265_10001641 3300028380 Bacteria 18332
85 Ga0268264_10000123 3300028381 Bacteria 189361
86 Ga0265314_10098343 3300031711 Bacteria 1888
87 Ga0307406_10311556 3300031901 Bacteria 1214
88 Ga0395905_0000589 3300037471 Bacteria 48792
89 Ga0450904_000854 3300042139 Bacteria 5015
90 Ga0439459_0135096 3300042438 Bacteria 633
91 Ga0495617_000012 3300046452 Bacteria 295916
92 Ga0495617_008715 3300046452 Bacteria 3491
93 Ga0495627_000118 3300046453 Bacteria 99480
94 Ga0495603_0045499 3300046455 Bacteria 2617
95 Ga0495590_0000030 3300046457 Bacteria 146237
96 Ga0495590_0027219 3300046457 Bacteria 2006
97 Ga0495629_0350841 3300046459 Bacteria 1006
98 Ga0495638_0000105 3300046460 Bacteria 134384
99 Ga0495651_0156487 3300046462 Bacteria 1637
100 Ga0495653_0148065 3300046463 Bacteria 1643
101 Ga0495650_0000099 3300046471 Bacteria 215347
102 Ga0495650_0000213 3300046471 Bacteria 123910
103 Ga0495650_0003278 3300046471 Bacteria 11987
104 Ga0495580_0013872 3300046472 Bacteria 6136
105 Ga0495580_0057052 3300046472 Bacteria 2749
106 Ga0495580_0140293 3300046472 Bacteria 1675
107 Ga0495582_0188117 3300046473 Bacteria 1177
108 Ga0495605_0000040 3300046474 Bacteria 193955
109 Ga0495605_0000072 3300046474 Bacteria 133731
110 Ga0495605_0027676 3300046474 Bacteria 2935
111 Ga0495605_0118435 3300046474 Bacteria 1202
112 Ga0495605_0158535 3300046474 Bacteria 1005
113 Ga0495605_0181183 3300046474 Bacteria 926
114 Ga0495639_0034332 3300046475 Bacteria 2268
115 Ga0495584_0000381 3300046491 Bacteria 30594
116 Ga0495584_0007663 3300046491 Bacteria 5625
117 Ga0495584_0016136 3300046491 Bacteria 3810
118 Ga0495584_0018145 3300046491 Bacteria 3577
119 Ga0495584_0089558 3300046491 Bacteria 1551
120 Ga0495585_0000531 3300046492 Bacteria 36056
121 Ga0495585_0000742 3300046492 Bacteria 29008
122 Ga0495585_0051712 3300046492 Bacteria 2276
123 Ga0495585_0074964 3300046492 Bacteria 1840
124 Ga0495585_0123889 3300046492 Bacteria 1365
125 Ga0495585_0169984 3300046492 Bacteria 1126
126 Ga0495585_0240977 3300046492 Bacteria 905
127 Ga0495594_0009587 3300046499 Bacteria 5005
128 Ga0495594_0137793 3300046499 Bacteria 1383
129 Ga0495594_0274684 3300046499 Bacteria 960
130 Ga0495596_0000029 3300046500 Bacteria 103615
131 Ga0495596_0000243 3300046500 Bacteria 36829
132 Ga0495596_0001487 3300046500 Bacteria 13398
133 Ga0495596_0003835 3300046500 Bacteria 7475
134 Ga0495596_0004139 3300046500 Bacteria 7133
135 Ga0495596_0008897 3300046500 Bacteria 4441
136 Ga0495596_0008903 3300046500 Bacteria 4440
137 Ga0495596_0017721 3300046500 Bacteria 2944
138 Ga0495596_0034377 3300046500 Bacteria 2013
139 Ga0495607_0001726 3300046501 Bacteria 18722
140 Ga0495607_0003190 3300046501 Bacteria 12670
141 Ga0495607_0005992 3300046501 Bacteria 8618
142 Ga0495607_0015552 3300046501 Bacteria 4929
143 Ga0495607_0292840 3300046501 Bacteria 768
144 Ga0495607_0352359 3300046501 Bacteria 679
145 Ga0495583_0000202 3300046506 Bacteria 100020
146 Ga0495583_0070195 3300046506 Bacteria 1541
147 Ga0495583_0093194 3300046506 Bacteria 1294
148 Ga0495583_0190658 3300046506 Bacteria 836
149 Ga0495606_0000316 3300046507 Bacteria 83307
150 Ga0495606_0002713 3300046507 Bacteria 19956
151 Ga0495606_0058502 3300046507 Bacteria 2477
152 Ga0495606_0158039 3300046507 Bacteria 1325
153 Ga0495606_0167586 3300046507 Bacteria 1277
154 Ga0495606_0181806 3300046507 Bacteria 1212
155 Ga0495610_0160590 3300046512 Bacteria 950
156 Ga0495616_0000034 3300046513 Bacteria 129394
157 Ga0495616_0000195 3300046513 Bacteria 50559
158 Ga0495616_0000388 3300046513 Bacteria 34173
159 Ga0495616_0005661 3300046513 Bacteria 7652
160 Ga0495616_0012532 3300046513 Bacteria 4810
161 Ga0495616_0019800 3300046513 Bacteria 3669
162 Ga0495616_0230667 3300046513 Bacteria 802
163 Ga0495616_0269061 3300046513 Bacteria 727
164 Ga0495628_0006086 3300046516 Bacteria 10550
165 Ga0495631_0004538 3300046518 Bacteria 7376
166 Ga0495631_0004913 3300046518 Bacteria 7044
167 Ga0495631_0020774 3300046518 Bacteria 3063
168 Ga0495631_0053700 3300046518 Bacteria 1758
169 Ga0495631_0082686 3300046518 Bacteria 1384
170 Ga0495632_0000033 3300046519 Bacteria 164240
171 Ga0495632_0000086 3300046519 Bacteria 95327
172 Ga0495632_0000156 3300046519 Bacteria 70702
173 Ga0495632_0000853 3300046519 Bacteria 26790
174 Ga0495637_0015198 3300046520 Bacteria 3614
175 Ga0495637_0027323 3300046520 Bacteria 2555
176 Ga0495637_0063924 3300046520 Bacteria 1502
177 Ga0495643_0000181 3300046522 Bacteria 100368
178 Ga0495643_0000742 3300046522 Bacteria 37024
179 Ga0495643_0000937 3300046522 Bacteria 30281
180 Ga0495643_0006199 3300046522 Bacteria 7936
181 Ga0495643_0006905 3300046522 Bacteria 7391
182 Ga0495643_0079419 3300046522 Bacteria 1710
183 Ga0495643_0267024 3300046522 Bacteria 792
184 Ga0495644_0002270 3300046523 Bacteria 7688
185 Ga0495644_0033422 3300046523 Bacteria 1943
186 Ga0495644_0046599 3300046523 Bacteria 1629
187 Ga0495644_0102851 3300046523 Bacteria 1081
188 Ga0495648_0000008 3300046524 Bacteria 336584
189 Ga0495648_0000116 3300046524 Bacteria 98123
190 Ga0495648_0000505 3300046524 Bacteria 41982
191 Ga0495648_0003863 3300046524 Bacteria 12994
192 Ga0495648_0005481 3300046524 Bacteria 10528
193 Ga0495648_0007837 3300046524 Bacteria 8495
194 Ga0495648_0019819 3300046524 Bacteria 4712
195 Ga0495648_0037553 3300046524 Bacteria 3110
196 Ga0495648_0064574 3300046524 Bacteria 2156
197 Ga0495663_0001491 3300046525 Bacteria 7361
198 Ga0495666_0000508 3300046526 Bacteria 17311
199 Ga0495666_0019873 3300046526 Bacteria 3331
200 Ga0495642_0000010 3300046528 Bacteria 136557
201 Ga0495642_0000218 3300046528 Bacteria 33005
202 Ga0495642_0000459 3300046528 Bacteria 21479
203 Ga0495642_0002734 3300046528 Bacteria 7077
204 Ga0495642_0004046 3300046528 Bacteria 5722
205 Ga0495642_0014391 3300046528 Bacteria 3065
206 Ga0495652_0014252 3300046529 Bacteria 7138
207 Ga0495652_0060251 3300046529 Bacteria 3208
208 Ga0495654_0005595 3300046530 Bacteria 7271
209 Ga0495654_0031129 3300046530 Bacteria 2709
210 Ga0495654_0102061 3300046530 Bacteria 1319
211 Ga0495665_0018745 3300046531 Bacteria 3717
212 Ga0495587_0096906 3300046536 Bacteria 1701
213 Ga0495609_0000044 3300046538 Bacteria 161642
214 Ga0495609_0000760 3300046538 Bacteria 24241
215 Ga0495609_0003410 3300046538 Bacteria 9117
216 Ga0495609_0006742 3300046538 Bacteria 5818
217 Ga0495609_0008303 3300046538 Bacteria 5092
218 Ga0495609_0008565 3300046538 Bacteria 5001
219 Ga0495609_0031688 3300046538 Bacteria 2402
220 Ga0495609_0031751 3300046538 Bacteria 2399
221 Ga0495609_0229239 3300046538 Bacteria 769
222 Ga0495621_0248984 3300046539 Bacteria 725
223 Ga0495597_0000310 3300046542 Bacteria 43852
224 Ga0495597_0000532 3300046542 Bacteria 31535
225 Ga0495597_0002234 3300046542 Bacteria 12647
226 Ga0495597_0003418 3300046542 Bacteria 9274
227 Ga0495597_0012024 3300046542 Bacteria 4183
228 Ga0495597_0014564 3300046542 Bacteria 3741
229 Ga0495597_0055426 3300046542 Bacteria 1738
230 Ga0495645_0013862 3300046543 Bacteria 5714
231 Ga0495645_0026559 3300046543 Bacteria 4204
232 Ga0495622_0000129 3300046557 Bacteria 65178
233 Ga0495622_0000188 3300046557 Bacteria 49618
234 Ga0495622_0015182 3300046557 Bacteria 3580
235 Ga0495633_0000810 3300046558 Bacteria 27687
236 Ga0495633_0033213 3300046558 Bacteria 2489
237 Ga0495633_0088160 3300046558 Bacteria 1443
238 Ga0495656_0002173 3300046615 Bacteria 6485
239 Ga0495656_0088622 3300046615 Bacteria 1411
240 Ga0495668_0000532 3300046616 Bacteria 47353
241 Ga0495668_0001032 3300046616 Bacteria 29505
242 Ga0495668_0002189 3300046616 Bacteria 16712
243 Ga0495668_0018421 3300046616 Bacteria 4034
244 Ga0495668_0084823 3300046616 Bacteria 1737
245 Ga0495611_0009078 3300046648 Bacteria 4205
246 Ga0495611_0074015 3300046648 Bacteria 1559
247 Ga0495625_0000278 3300046660 Bacteria 79607
248 Ga0495625_0004513 3300046660 Bacteria 13131
249 Ga0495625_0010704 3300046660 Bacteria 7554
250 Ga0495625_0065254 3300046660 Bacteria 2567
251 Ga0495625_0070132 3300046660 Bacteria 2461
252 Ga0495625_0130141 3300046660 Bacteria 1705
253 Ga0495625_0196589 3300046660 Bacteria 1333
254 Ga0495625_0620226 3300046660 Bacteria 647
255 Ga0495659_0015081 3300046664 Bacteria 2537
256 Ga0495659_0063114 3300046664 Bacteria 1373
257 Ga0495661_0000426 3300046665 Bacteria 44529
258 Ga0495661_0002490 3300046665 Bacteria 14173
259 Ga0495661_0003899 3300046665 Bacteria 10894
260 Ga0495661_0014844 3300046665 Bacteria 5211
261 Ga0495661_0018907 3300046665 Bacteria 4522
262 Ga0495661_0020199 3300046665 Bacteria 4352
263 Ga0495661_0021810 3300046665 Bacteria 4170
264 Ga0495661_0094194 3300046665 Bacteria 1698
265 Ga0495661_0171847 3300046665 Bacteria 1155
266 Ga0495661_0218289 3300046665 Bacteria 989
267 Ga0495588_0007145 3300046674 Bacteria 5066
268 Ga0495588_0096258 3300046674 Bacteria 1553
269 Ga0495588_0116899 3300046674 Bacteria 1405
270 Ga0495588_0241704 3300046674 Bacteria 952
271 Ga0495646_0041520 3300046680 Bacteria 2826
272 Ga0495669_0000203 3300046684 Bacteria 36277
273 Ga0495669_0005584 3300046684 Bacteria 5246
274 Ga0495624_0423041 3300046690 Bacteria 799
275 Ga0495670_0007699 3300046691 Bacteria 5296
276 Ga0495670_0046029 3300046691 Bacteria 2179
277 Ga0495670_0054588 3300046691 Bacteria 2002
278 Ga0495670_0124454 3300046691 Bacteria 1341
279 Ga0495670_0183464 3300046691 Bacteria 1105
280 Ga0495671_0000092 3300046692 Bacteria 85232
281 Ga0495671_0000484 3300046692 Bacteria 30964
282 Ga0495671_0008571 3300046692 Bacteria 5742
283 Ga0495671_0229364 3300046692 Bacteria 898
284 Ga0495649_0004095 3300046694 Bacteria 9587
285 Ga0495589_0000035 3300046794 Bacteria 161642
286 Ga0495589_0000115 3300046794 Bacteria 75796
287 Ga0495589_0004233 3300046794 Bacteria 7673
288 Ga0495589_0025674 3300046794 Bacteria 2989
289 Ga0495589_0070164 3300046794 Bacteria 1713
290 Ga0495589_0083746 3300046794 Bacteria 1550
291 Ga0495660_0000218 3300046810 Bacteria 57673
292 Ga0495660_0005717 3300046810 Bacteria 7425
293 Ga0495660_0071518 3300046810 Bacteria 1839
294 Ga0495660_0125431 3300046810 Bacteria 1293
295 Ga0495604_0036542 3300047317 Bacteria 3872
296 Ga0495604_0182836 3300047317 Bacteria 1465
297 Ga0495636_0035897 3300047318 Bacteria 2042
298 Ga0495636_0037369 3300047318 Bacteria 2005
299 Ga0495636_0045189 3300047318 Bacteria 1835
300 Ga0495636_0049026 3300047318 Bacteria 1766
301 Ga0495636_0077999 3300047318 Bacteria 1422
302 Ga0495636_0204239 3300047318 Bacteria 903
303 Ga0495672_0000285 3300047320 Bacteria 70145
304 Ga0495672_0000322 3300047320 Bacteria 63657
305 Ga0495672_0001570 3300047320 Bacteria 22373
306 Ga0495676_0038304 3300047321 Bacteria 3982
307 Ga0495676_0040419 3300047321 Bacteria 3849
308 Ga0495683_0005791 3300047323 Bacteria 6807
309 Ga0495683_0038507 3300047323 Bacteria 2421
310 Ga0495683_0071384 3300047323 Bacteria 1704
311 Ga0495683_0103550 3300047323 Bacteria 1366
312 Ga0495683_0151052 3300047323 Bacteria 1081
313 Ga0495687_000002 3300047443 Bacteria 1085770
314 Ga0495687_000066 3300047443 Bacteria 161642
315 Ga0495687_000086 3300047443 Bacteria 143855
316 Ga0495687_007981 3300047443 Bacteria 6138
317 Ga0495677_0000013 3300047445 Bacteria 138372
318 Ga0495677_0000985 3300047445 Bacteria 11464
319 Ga0495677_0004324 3300047445 Bacteria 5459
320 Ga0495677_0011948 3300047445 Bacteria 3169
321 Ga0495677_0014205 3300047445 Bacteria 2900
322 Ga0495677_0022951 3300047445 Bacteria 2265
323 Ga0495677_0025590 3300047445 Bacteria 2141
324 Ga0495677_0048132 3300047445 Bacteria 1566
325 Ga0495685_020792 3300047447 Bacteria 2256
326 Ga0495685_115529 3300047447 Bacteria 882
327 Ga0495673_0005766 3300047469 Bacteria 7422
328 Ga0495681_0000016 3300047470 Bacteria 181322
329 Ga0495681_0010130 3300047470 Bacteria 5732
330 Ga0495681_0030386 3300047470 Bacteria 2751
331 Ga0495681_0035504 3300047470 Bacteria 2474
332 Ga0495686_0000054 3300047472 Bacteria 259400
333 Ga0495686_0000464 3300047472 Bacteria 60897
334 Ga0495602_0192540 3300048088 Bacteria 1562
335 Ga0495615_0008848 3300048090 Bacteria 1959
336 Ga0495615_0044623 3300048090 Bacteria 1120
337 Ga0495615_0109375 3300048090 Bacteria 789
338 Ga0495626_0000011 3300048091 Bacteria 260928
339 Ga0495626_0000071 3300048091 Bacteria 136767
340 Ga0495626_0000974 3300048091 Bacteria 24662
341 Ga0495626_0001290 3300048091 Bacteria 20449
342 Ga0495626_0004939 3300048091 Bacteria 8002
343 Ga0495626_0006446 3300048091 Bacteria 6683
344 Ga0495626_0007720 3300048091 Bacteria 5962
345 Ga0495626_0010381 3300048091 Bacteria 4971
346 Ga0495626_0014101 3300048091 Bacteria 4134
347 Ga0495626_0028622 3300048091 Bacteria 2699
348 Ga0495626_0036488 3300048091 Bacteria 2341
349 Ga0495626_0156070 3300048091 Bacteria 959
350 Ga0496102_0000279 3300048905 Bacteria 65185
351 Ga0496103_0001678 3300048906 Bacteria 14484
352 Ga0496104_0428969 3300048907 Bacteria 1234
353 Ga0496104_0656401 3300048907 Bacteria 958
354 Ga0496105_1001154 3300048908 Bacteria 625
355 Ga0496116_0010763 3300048919 Bacteria 7634
356 Ga0496116_0038637 3300048919 Bacteria 3311
357 Ga0496118_0089671 3300048921 Bacteria 2122
358 Ga0496122_0000513 3300048925 Bacteria 80013
359 Ga0496123_0000145 3300048926 Bacteria 144475
360 Ga0496125_0001481 3300048928 Bacteria 33868
361 Ga0496125_0032436 3300048928 Bacteria 4640
362 Ga0495678_000035 3300049459 Bacteria 200957
363 Ga0495678_000780 3300049459 Bacteria 28573
364 Ga0495678_007909 3300049459 Bacteria 5452
365 Ga0495678_014909 3300049459 Bacteria 3598
366 Ga0495682_0000365 3300049460 Bacteria 32900
367 Ga0495682_0000677 3300049460 Bacteria 22419
368 Ga0495682_0138824 3300049460 Bacteria 868
369 Ga0501315_045732 3300049531 Bacteria 675
370 nmdc:mga0qj67_694188_c1 3300050509 Bacteria 810
371 Ga0500618_001616 3300053125 Bacteria 9759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0160590 Ga0495610_0160590_243_809 165
2 3300046522 Ga0495643_0000181 Ga0495643_0000181_45724_46290 165
3 3300046524 Ga0495648_0037553 Ga0495648_0037553_1909_2475 165
4 3300046538 Ga0495609_0008303 Ga0495609_0008303_1845_2411 165
5 3300047320 Ga0495672_0000285 Ga0495672_0000285_1809_2375 165
6 3300049459 Ga0495678_000780 Ga0495678_000780_21768_22334 165
7 3300009011 Ga0105251_10076868 Ga0105251_100768682 176
8 3300025735 Ga0207713_1061014 Ga0207713_10610142 176
9 3300027666 Ga0209282_1000063 Ga0209282_100006338 176
10 3300048928 Ga0496125_0001481 Ga0496125_0001481_13142_13711 176
11 3300046452 Ga0495617_008715 Ga0495617_008715_1270_1836 178
12 3300046513 Ga0495616_0230667 Ga0495616_0230667_181_750 178
13 3300046660 Ga0495625_0196589 Ga0495625_0196589_689_1258 178
14 3300046674 Ga0495588_0116899 Ga0495588_0116899_352_921 178
15 3300048919 Ga0496116_0038637 Ga0496116_0038637_2546_3169 178
16 3300013306 Ga0163162_10651076 Ga0163162_106510762 181
17 3300042438 Ga0439459_0135096 Ga0439459_0135096_33_611 183
18 3300046472 Ga0495580_0140293 Ga0495580_0140293_255_845 184
19 3300047317 Ga0495604_0182836 Ga0495604_0182836_820_1410 184
20 iso_pu_bacteria 2842711865 2842714023 184
21 iso_pu_bacteria 2511231003 2511249159 185
22 iso_pu_bacteria 2513237150 2513954338 185
23 iso_pu_bacteria 2513237165 2514040938 185
24 iso_pu_bacteria 2548876994 2550692418 185
25 iso_pu_bacteria 2818991445 2819592562 185
26 iso_pu_bacteria 2858688981 2858689478 185
27 iso_pu_bacteria 2884811622 2884812349 185
28 iso_pu_bacteria 2884836552 2884838949 185
29 iso_pu_bacteria 2884852848 2884855241 185
30 iso_pu_bacteria 2896154374 2896156090 185
31 iso_pu_bacteria 2901300506 2901312288 185
32 iso_pu_bacteria 644736347 644748913 185
33 3300014326 Ga0157380_10458164 Ga0157380_104581642 186
34 3300025256 Ga0209759_1026395 Ga0209759_10263952 186
35 3300046463 Ga0495653_0148065 Ga0495653_0148065_246_815 186
36 3300046474 Ga0495605_0027676 Ga0495605_0027676_840_1409 186
37 3300046492 Ga0495585_0123889 Ga0495585_0123889_34_603 186
38 3300046501 Ga0495607_0005992 Ga0495607_0005992_2791_3360 186
39 3300046513 Ga0495616_0000388 Ga0495616_0000388_26277_26846 186
40 3300046519 Ga0495632_0000853 Ga0495632_0000853_14656_15225 186
41 3300047470 Ga0495681_0000016 Ga0495681_0000016_36142_36711 186
42 3300046455 Ga0495603_0045499 Ga0495603_0045499_111_677 187
43 3300046459 Ga0495629_0350841 Ga0495629_0350841_308_874 187
44 3300046472 Ga0495580_0013872 Ga0495580_0013872_3423_4004 187
45 3300046472 Ga0495580_0057052 Ga0495580_0057052_1971_2537 187
46 3300046473 Ga0495582_0188117 Ga0495582_0188117_181_747 187
47 3300046491 Ga0495584_0007663 Ga0495584_0007663_3368_3934 187
48 3300046491 Ga0495584_0018145 Ga0495584_0018145_1163_1729 187
49 3300046492 Ga0495585_0169984 Ga0495585_0169984_330_896 187
50 3300046492 Ga0495585_0240977 Ga0495585_0240977_136_702 187
51 3300046499 Ga0495594_0009587 Ga0495594_0009587_1143_1724 187
52 3300046499 Ga0495594_0137793 Ga0495594_0137793_373_939 187
53 3300046507 Ga0495606_0158039 Ga0495606_0158039_656_1222 187
54 3300046518 Ga0495631_0020774 Ga0495631_0020774_1051_1617 187
55 3300046526 Ga0495666_0000508 Ga0495666_0000508_3824_4405 187
56 3300046526 Ga0495666_0019873 Ga0495666_0019873_1294_1860 187
57 3300046531 Ga0495665_0018745 Ga0495665_0018745_1262_1843 187
58 3300046538 Ga0495609_0006742 Ga0495609_0006742_3792_4361 187
59 3300046542 Ga0495597_0003418 Ga0495597_0003418_3766_4332 187
60 3300046542 Ga0495597_0012024 Ga0495597_0012024_3440_4009 187
61 3300046557 Ga0495622_0015182 Ga0495622_0015182_1477_2043 187
62 3300046558 Ga0495633_0033213 Ga0495633_0033213_212_778 187
63 3300046648 Ga0495611_0074015 Ga0495611_0074015_326_892 187
64 3300046665 Ga0495661_0014844 Ga0495661_0014844_3226_3795 187
65 3300046665 Ga0495661_0218289 Ga0495661_0218289_397_963 187
66 3300046674 Ga0495588_0096258 Ga0495588_0096258_732_1313 187
67 3300046674 Ga0495588_0241704 Ga0495588_0241704_61_627 187
68 3300046690 Ga0495624_0423041 Ga0495624_0423041_92_658 187
69 3300046691 Ga0495670_0007699 Ga0495670_0007699_2046_2612 187
70 3300046691 Ga0495670_0183464 Ga0495670_0183464_245_811 187
71 3300046794 Ga0495589_0083746 Ga0495589_0083746_311_877 187
72 3300047317 Ga0495604_0036542 Ga0495604_0036542_2446_3027 187
73 3300047318 Ga0495636_0037369 Ga0495636_0037369_62_628 187
74 3300047318 Ga0495636_0077999 Ga0495636_0077999_690_1280 187
75 3300047321 Ga0495676_0040419 Ga0495676_0040419_2771_3337 187
76 3300047445 Ga0495677_0048132 Ga0495677_0048132_938_1504 187
77 3300047470 Ga0495681_0030386 Ga0495681_0030386_1144_1710 187
78 3300047470 Ga0495681_0035504 Ga0495681_0035504_1597_2166 187
79 3300048088 Ga0495602_0192540 Ga0495602_0192540_859_1440 187
80 3300048091 Ga0495626_0001290 Ga0495626_0001290_19326_19892 187
81 3300048091 Ga0495626_0010381 Ga0495626_0010381_3752_4321 187
82 3300003300 Ga0006758J48902_1012612 Ga0006758J48902_10126121 188
83 3300003305 Ga0006770J48903_1051480 Ga0006770J48903_10514801 188
84 3300003771 Ga0055526_1015070 Ga0055526_10150702 188
85 3300005331 Ga0070670_100000002 Ga0070670_100000002534 188
86 3300005335 Ga0070666_10015072 Ga0070666_100150725 188
87 3300005353 Ga0070669_100005576 Ga0070669_1000055769 188
88 3300005355 Ga0070671_100000025 Ga0070671_1000000255 188
89 3300005365 Ga0070688_100004285 Ga0070688_1000042858 188
90 3300005367 Ga0070667_100000394 Ga0070667_1000003947 188
91 3300005466 Ga0070685_10000005 Ga0070685_1000000598 188
92 3300005548 Ga0070665_100150604 Ga0070665_1001506044 188
93 3300005617 Ga0068859_100041050 Ga0068859_1000410505 188
94 3300005618 Ga0068864_100000003 Ga0068864_100000003547 188
95 3300005841 Ga0068863_101042396 Ga0068863_1010423962 188
96 3300005843 Ga0068860_100000326 Ga0068860_10000032630 188
97 3300005844 Ga0068862_100068501 Ga0068862_1000685012 188
98 3300006175 Ga0070712_100003941 Ga0070712_1000039415 188
99 3300006353 Ga0075370_10239156 Ga0075370_102391562 188
100 3300006931 Ga0097620_100041051 Ga0097620_1000410515 188
101 3300013306 Ga0163162_10507823 Ga0163162_105078232 188
102 3300014325 Ga0163163_10000136 Ga0163163_1000013613 188
103 3300025233 Ga0209437_101166 Ga0209437_1011667 188
104 3300025246 Ga0209646_1000114 Ga0209646_100011472 188
105 3300025250 Ga0209026_1008799 Ga0209026_10087993 188
106 3300025295 Ga0209564_1000006 Ga0209564_1000006944 188
107 3300025903 Ga0207680_10007523 Ga0207680_100075233 188
108 3300025915 Ga0207693_10019007 Ga0207693_100190075 188
109 3300025923 Ga0207681_10000156 Ga0207681_1000015639 188
110 3300025925 Ga0207650_10000003 Ga0207650_100000031081 188
111 3300025931 Ga0207644_10000312 Ga0207644_1000031213 188
112 3300025941 Ga0207711_10002080 Ga0207711_100020805 188
113 3300025941 Ga0207711_10008967 Ga0207711_100089673 188
114 3300025986 Ga0207658_10000004 Ga0207658_10000004528 188
115 3300026088 Ga0207641_10190748 Ga0207641_101907482 188
116 3300026095 Ga0207676_10000003 Ga0207676_1000000313 188
117 3300028379 Ga0268266_10060143 Ga0268266_100601434 188
118 3300028380 Ga0268265_10001641 Ga0268265_100016415 188
119 3300028381 Ga0268264_10000123 Ga0268264_1000012384 188
120 3300031711 Ga0265314_10098343 Ga0265314_100983432 188
121 3300031901 Ga0307406_10311556 Ga0307406_103115562 188
122 3300037471 Ga0395905_0000589 Ga0395905_0000589_34955_35521 188
123 3300042139 Ga0450904_000854 Ga0450904_000854_3321_3890 188
124 3300046452 Ga0495617_000012 Ga0495617_000012_171166_171738 188
125 3300046453 Ga0495627_000118 Ga0495627_000118_15582_16154 188
126 3300046457 Ga0495590_0000030 Ga0495590_0000030_74548_75114 188
127 3300046457 Ga0495590_0027219 Ga0495590_0027219_418_996 188
128 3300046460 Ga0495638_0000105 Ga0495638_0000105_89772_90338 188
129 3300046471 Ga0495650_0000099 Ga0495650_0000099_82609_83175 188
130 3300046471 Ga0495650_0000213 Ga0495650_0000213_50703_51371 188
131 3300046471 Ga0495650_0003278 Ga0495650_0003278_9903_10469 188
132 3300046474 Ga0495605_0000040 Ga0495605_0000040_107728_108306 188
133 3300046474 Ga0495605_0000072 Ga0495605_0000072_35924_36496 188
134 3300046474 Ga0495605_0118435 Ga0495605_0118435_380_964 188
135 3300046474 Ga0495605_0158535 Ga0495605_0158535_299_877 188
136 3300046474 Ga0495605_0181183 Ga0495605_0181183_275_847 188
137 3300046475 Ga0495639_0034332 Ga0495639_0034332_413_979 188
138 3300046491 Ga0495584_0000381 Ga0495584_0000381_15654_16229 188
139 3300046491 Ga0495584_0016136 Ga0495584_0016136_437_1021 188
140 3300046491 Ga0495584_0089558 Ga0495584_0089558_719_1297 188
141 3300046492 Ga0495585_0000531 Ga0495585_0000531_23009_23581 188
142 3300046492 Ga0495585_0000742 Ga0495585_0000742_22697_23272 188
143 3300046492 Ga0495585_0051712 Ga0495585_0051712_1542_2114 188
144 3300046492 Ga0495585_0074964 Ga0495585_0074964_206_778 188
145 3300046499 Ga0495594_0274684 Ga0495594_0274684_373_945 188
146 3300046500 Ga0495596_0000029 Ga0495596_0000029_52612_53184 188
147 3300046500 Ga0495596_0000243 Ga0495596_0000243_14096_14668 188
148 3300046500 Ga0495596_0001487 Ga0495596_0001487_5807_6379 188
149 3300046500 Ga0495596_0003835 Ga0495596_0003835_668_1252 188
150 3300046500 Ga0495596_0004139 Ga0495596_0004139_3225_3797 188
151 3300046500 Ga0495596_0008897 Ga0495596_0008897_3693_4361 188
152 3300046500 Ga0495596_0008903 Ga0495596_0008903_3692_4375 188
153 3300046500 Ga0495596_0017721 Ga0495596_0017721_2237_2809 188
154 3300046500 Ga0495596_0034377 Ga0495596_0034377_303_881 188
155 3300046501 Ga0495607_0001726 Ga0495607_0001726_5714_6286 188
156 3300046501 Ga0495607_0003190 Ga0495607_0003190_2186_2752 188
157 3300046501 Ga0495607_0015552 Ga0495607_0015552_932_1510 188
158 3300046501 Ga0495607_0292840 Ga0495607_0292840_110_688 188
159 3300046501 Ga0495607_0352359 Ga0495607_0352359_27_596 188
160 3300046506 Ga0495583_0000202 Ga0495583_0000202_83974_84540 188
161 3300046506 Ga0495583_0070195 Ga0495583_0070195_33_605 188
162 3300046506 Ga0495583_0093194 Ga0495583_0093194_254_838 188
163 3300046506 Ga0495583_0190658 Ga0495583_0190658_209_781 188
164 3300046507 Ga0495606_0000316 Ga0495606_0000316_81229_81795 188
165 3300046507 Ga0495606_0002713 Ga0495606_0002713_273_839 188
166 3300046507 Ga0495606_0058502 Ga0495606_0058502_1849_2415 188
167 3300046507 Ga0495606_0167586 Ga0495606_0167586_317_901 188
168 3300046507 Ga0495606_0181806 Ga0495606_0181806_246_821 188
169 3300046513 Ga0495616_0000034 Ga0495616_0000034_118497_119069 188
170 3300046513 Ga0495616_0000195 Ga0495616_0000195_10455_11033 188
171 3300046513 Ga0495616_0005661 Ga0495616_0005661_6225_6797 188
172 3300046513 Ga0495616_0012532 Ga0495616_0012532_391_969 188
173 3300046513 Ga0495616_0019800 Ga0495616_0019800_177_749 188
174 3300046513 Ga0495616_0269061 Ga0495616_0269061_116_691 188
175 3300046518 Ga0495631_0004538 Ga0495631_0004538_5218_5790 188
176 3300046518 Ga0495631_0004913 Ga0495631_0004913_156_728 188
177 3300046518 Ga0495631_0053700 Ga0495631_0053700_379_951 188
178 3300046518 Ga0495631_0082686 Ga0495631_0082686_220_798 188
179 3300046519 Ga0495632_0000033 Ga0495632_0000033_114585_115169 188
180 3300046519 Ga0495632_0000086 Ga0495632_0000086_92451_93023 188
181 3300046519 Ga0495632_0000156 Ga0495632_0000156_57676_58248 188
182 3300046520 Ga0495637_0015198 Ga0495637_0015198_2804_3373 188
183 3300046520 Ga0495637_0063924 Ga0495637_0063924_380_958 188
184 3300046522 Ga0495643_0000742 Ga0495643_0000742_11503_12075 188
185 3300046522 Ga0495643_0000937 Ga0495643_0000937_1638_2204 188
186 3300046522 Ga0495643_0006199 Ga0495643_0006199_1625_2203 188
187 3300046522 Ga0495643_0006905 Ga0495643_0006905_2688_3260 188
188 3300046522 Ga0495643_0079419 Ga0495643_0079419_826_1410 188
189 3300046522 Ga0495643_0267024 Ga0495643_0267024_88_666 188
190 3300046523 Ga0495644_0002270 Ga0495644_0002270_2220_2792 188
191 3300046523 Ga0495644_0033422 Ga0495644_0033422_54_626 188
192 3300046523 Ga0495644_0102851 Ga0495644_0102851_101_721 188
193 3300046524 Ga0495648_0000008 Ga0495648_0000008_322251_322817 188
194 3300046524 Ga0495648_0000116 Ga0495648_0000116_16954_17526 188
195 3300046524 Ga0495648_0000505 Ga0495648_0000505_38471_39154 188
196 3300046524 Ga0495648_0003863 Ga0495648_0003863_10978_11562 188
197 3300046524 Ga0495648_0005481 Ga0495648_0005481_129_707 188
198 3300046524 Ga0495648_0007837 Ga0495648_0007837_3761_4345 188
199 3300046524 Ga0495648_0019819 Ga0495648_0019819_2074_2640 188
200 3300046524 Ga0495648_0064574 Ga0495648_0064574_991_1563 188
201 3300046525 Ga0495663_0001491 Ga0495663_0001491_1539_2105 188
202 3300046528 Ga0495642_0000010 Ga0495642_0000010_17732_18304 188
203 3300046528 Ga0495642_0000218 Ga0495642_0000218_2274_2846 188
204 3300046528 Ga0495642_0000459 Ga0495642_0000459_10236_10820 188
205 3300046528 Ga0495642_0002734 Ga0495642_0002734_1493_2059 188
206 3300046528 Ga0495642_0014391 Ga0495642_0014391_2466_3038 188
207 3300046530 Ga0495654_0005595 Ga0495654_0005595_1135_1713 188
208 3300046530 Ga0495654_0031129 Ga0495654_0031129_1684_2256 188
209 3300046530 Ga0495654_0102061 Ga0495654_0102061_582_1154 188
210 3300046536 Ga0495587_0096906 Ga0495587_0096906_852_1424 188
211 3300046538 Ga0495609_0000044 Ga0495609_0000044_61697_62275 188
212 3300046538 Ga0495609_0000760 Ga0495609_0000760_9949_10521 188
213 3300046538 Ga0495609_0003410 Ga0495609_0003410_4967_5635 188
214 3300046538 Ga0495609_0008565 Ga0495609_0008565_866_1444 188
215 3300046538 Ga0495609_0031688 Ga0495609_0031688_1013_1585 188
216 3300046538 Ga0495609_0031751 Ga0495609_0031751_1122_1688 188
217 3300046538 Ga0495609_0229239 Ga0495609_0229239_163_735 188
218 3300046542 Ga0495597_0000310 Ga0495597_0000310_41649_42215 188
219 3300046542 Ga0495597_0000532 Ga0495597_0000532_15394_15960 188
220 3300046542 Ga0495597_0002234 Ga0495597_0002234_9283_9867 188
221 3300046542 Ga0495597_0014564 Ga0495597_0014564_1375_1941 188
222 3300046542 Ga0495597_0055426 Ga0495597_0055426_1137_1715 188
223 3300046543 Ga0495645_0013862 Ga0495645_0013862_1885_2457 188
224 3300046557 Ga0495622_0000129 Ga0495622_0000129_19967_20533 188
225 3300046557 Ga0495622_0000188 Ga0495622_0000188_1727_2293 188
226 3300046558 Ga0495633_0000810 Ga0495633_0000810_1673_2239 188
227 3300046558 Ga0495633_0088160 Ga0495633_0088160_854_1432 188
228 3300046615 Ga0495656_0002173 Ga0495656_0002173_508_1074 188
229 3300046615 Ga0495656_0088622 Ga0495656_0088622_14_586 188
230 3300046616 Ga0495668_0000532 Ga0495668_0000532_16751_17323 188
231 3300046616 Ga0495668_0001032 Ga0495668_0001032_27308_27874 188
232 3300046616 Ga0495668_0002189 Ga0495668_0002189_5559_6137 188
233 3300046616 Ga0495668_0018421 Ga0495668_0018421_388_960 188
234 3300046616 Ga0495668_0084823 Ga0495668_0084823_499_1077 188
235 3300046648 Ga0495611_0009078 Ga0495611_0009078_993_1565 188
236 3300046660 Ga0495625_0000278 Ga0495625_0000278_20996_21562 188
237 3300046660 Ga0495625_0010704 Ga0495625_0010704_2787_3365 188
238 3300046660 Ga0495625_0065254 Ga0495625_0065254_21_587 188
239 3300046660 Ga0495625_0070132 Ga0495625_0070132_188_760 188
240 3300046660 Ga0495625_0130141 Ga0495625_0130141_1080_1652 188
241 3300046660 Ga0495625_0620226 Ga0495625_0620226_22_606 188
242 3300046664 Ga0495659_0015081 Ga0495659_0015081_787_1353 188
243 3300046664 Ga0495659_0063114 Ga0495659_0063114_306_881 188
244 3300046665 Ga0495661_0000426 Ga0495661_0000426_9066_9644 188
245 3300046665 Ga0495661_0002490 Ga0495661_0002490_9236_9808 188
246 3300046665 Ga0495661_0003899 Ga0495661_0003899_9836_10414 188
247 3300046665 Ga0495661_0018907 Ga0495661_0018907_129_707 188
248 3300046665 Ga0495661_0020199 Ga0495661_0020199_1824_2396 188
249 3300046665 Ga0495661_0021810 Ga0495661_0021810_763_1335 188
250 3300046665 Ga0495661_0171847 Ga0495661_0171847_520_1104 188
251 3300046674 Ga0495588_0007145 Ga0495588_0007145_296_874 188
252 3300046684 Ga0495669_0000203 Ga0495669_0000203_2305_2877 188
253 3300046684 Ga0495669_0005584 Ga0495669_0005584_3369_3941 188
254 3300046691 Ga0495670_0046029 Ga0495670_0046029_222_788 188
255 3300046691 Ga0495670_0054588 Ga0495670_0054588_773_1345 188
256 3300046691 Ga0495670_0124454 Ga0495670_0124454_100_675 188
257 3300046692 Ga0495671_0000092 Ga0495671_0000092_71655_72227 188
258 3300046692 Ga0495671_0000484 Ga0495671_0000484_11903_12487 188
259 3300046692 Ga0495671_0008571 Ga0495671_0008571_2272_2850 188
260 3300046692 Ga0495671_0229364 Ga0495671_0229364_31_597 188
261 3300046694 Ga0495649_0004095 Ga0495649_0004095_965_1549 188
262 3300046794 Ga0495589_0000035 Ga0495589_0000035_61697_62275 188
263 3300046794 Ga0495589_0000115 Ga0495589_0000115_3440_4018 188
264 3300046794 Ga0495589_0004233 Ga0495589_0004233_6627_7199 188
265 3300046794 Ga0495589_0025674 Ga0495589_0025674_757_1329 188
266 3300046794 Ga0495589_0070164 Ga0495589_0070164_193_777 188
267 3300046810 Ga0495660_0000218 Ga0495660_0000218_37610_38188 188
268 3300046810 Ga0495660_0005717 Ga0495660_0005717_3207_3779 188
269 3300046810 Ga0495660_0071518 Ga0495660_0071518_216_800 188
270 3300046810 Ga0495660_0125431 Ga0495660_0125431_129_707 188
271 3300047318 Ga0495636_0049026 Ga0495636_0049026_64_639 188
272 3300047318 Ga0495636_0204239 Ga0495636_0204239_323_889 188
273 3300047320 Ga0495672_0000322 Ga0495672_0000322_61612_62295 188
274 3300047320 Ga0495672_0001570 Ga0495672_0001570_9024_9602 188
275 3300047321 Ga0495676_0038304 Ga0495676_0038304_1646_2218 188
276 3300047323 Ga0495683_0005791 Ga0495683_0005791_3457_4029 188
277 3300047323 Ga0495683_0038507 Ga0495683_0038507_563_1141 188
278 3300047323 Ga0495683_0071384 Ga0495683_0071384_239_907 188
279 3300047323 Ga0495683_0103550 Ga0495683_0103550_623_1195 188
280 3300047323 Ga0495683_0151052 Ga0495683_0151052_308_886 188
281 3300047443 Ga0495687_000002 Ga0495687_000002_491470_492042 188
282 3300047443 Ga0495687_000066 Ga0495687_000066_61697_62275 188
283 3300047443 Ga0495687_000086 Ga0495687_000086_111666_112244 188
284 3300047443 Ga0495687_007981 Ga0495687_007981_581_1147 188
285 3300047445 Ga0495677_0000013 Ga0495677_0000013_99368_99946 188
286 3300047445 Ga0495677_0000985 Ga0495677_0000985_8108_8686 188
287 3300047445 Ga0495677_0004324 Ga0495677_0004324_1152_1724 188
288 3300047445 Ga0495677_0011948 Ga0495677_0011948_1661_2245 188
289 3300047445 Ga0495677_0014205 Ga0495677_0014205_841_1413 188
290 3300047445 Ga0495677_0022951 Ga0495677_0022951_637_1209 188
291 3300047445 Ga0495677_0025590 Ga0495677_0025590_1544_2110 188
292 3300047447 Ga0495685_020792 Ga0495685_020792_1550_2128 188
293 3300047469 Ga0495673_0005766 Ga0495673_0005766_2818_3390 188
294 3300047470 Ga0495681_0010130 Ga0495681_0010130_1159_1737 188
295 3300047472 Ga0495686_0000054 Ga0495686_0000054_20855_21427 188
296 3300047472 Ga0495686_0000464 Ga0495686_0000464_6324_6896 188
297 3300048090 Ga0495615_0008848 Ga0495615_0008848_718_1284 188
298 3300048090 Ga0495615_0109375 Ga0495615_0109375_200_778 188
299 3300048091 Ga0495626_0000011 Ga0495626_0000011_91982_92560 188
300 3300048091 Ga0495626_0000071 Ga0495626_0000071_33204_33782 188
301 3300048091 Ga0495626_0000974 Ga0495626_0000974_1360_1929 188
302 3300048091 Ga0495626_0004939 Ga0495626_0004939_437_1021 188
303 3300048091 Ga0495626_0006446 Ga0495626_0006446_1697_2269 188
304 3300048091 Ga0495626_0007720 Ga0495626_0007720_4589_5161 188
305 3300048091 Ga0495626_0014101 Ga0495626_0014101_649_1221 188
306 3300048091 Ga0495626_0028622 Ga0495626_0028622_129_707 188
307 3300048091 Ga0495626_0036488 Ga0495626_0036488_114_683 188
308 3300048091 Ga0495626_0156070 Ga0495626_0156070_107_679 188
309 3300049459 Ga0495678_000035 Ga0495678_000035_8664_9242 188
310 3300049459 Ga0495678_007909 Ga0495678_007909_1497_2063 188
311 3300049459 Ga0495678_014909 Ga0495678_014909_1064_1636 188
312 3300049460 Ga0495682_0000365 Ga0495682_0000365_16651_17223 188
313 3300049460 Ga0495682_0000677 Ga0495682_0000677_598_1170 188
314 3300049460 Ga0495682_0138824 Ga0495682_0138824_130_708 188
315 3300049531 Ga0501315_045732 Ga0501315_045732_21_587 188
316 3300050509 nmdc:mga0qj67_694188_c1 nmdc:mga0qj67_694188_c1_141_722 188
317 iso_pu_bacteria 2643221603 2644027962 188
318 3300002704 JGI25155J39150_1000142 JGI25155J39150_100014219 189
319 3300002704 JGI25155J39150_1000219 JGI25155J39150_100021919 189
320 3300002705 JGI25156J39149_1000497 JGI25156J39149_100049712 189
321 3300002705 JGI25156J39149_1003054 JGI25156J39149_10030545 189
322 3300002737 JGI25162J39368_1005347 JGI25162J39368_10053471 189
323 3300002738 JGI25154J39366_1000423 JGI25154J39366_100042319 189
324 3300002738 JGI25154J39366_1000432 JGI25154J39366_100043211 189
325 3300002741 JGI25157J39369_1000158 JGI25157J39369_100015812 189
326 3300002741 JGI25157J39369_1000203 JGI25157J39369_100020327 189
327 3300003758 Ga0055532_1000005 Ga0055532_1000005140 189
328 3300005563 Ga0068855_100106549 Ga0068855_1001065495 189
329 3300005577 Ga0068857_100623394 Ga0068857_1006233942 189
330 3300005719 Ga0068861_100004915 Ga0068861_1000049152 189
331 3300009011 Ga0105251_10015285 Ga0105251_100152854 189
332 3300009093 Ga0105240_10003355 Ga0105240_1000335524 189
333 3300009551 Ga0105238_10035298 Ga0105238_100352986 189
334 3300013100 Ga0157373_10065917 Ga0157373_100659174 189
335 3300014326 Ga0157380_10004535 Ga0157380_100045353 189
336 3300014497 Ga0182008_10022337 Ga0182008_100223374 189
337 3300015261 Ga0182006_1003847 Ga0182006_10038474 189
338 3300015262 Ga0182007_10027096 Ga0182007_100270963 189
339 3300025206 Ga0209435_100004 Ga0209435_100004195 189
340 3300025206 Ga0209435_100214 Ga0209435_10021410 189
341 3300025229 Ga0209147_100011 Ga0209147_100011293 189
342 3300025233 Ga0209437_100084 Ga0209437_100084135 189
343 3300025242 Ga0209258_100560 Ga0209258_10056020 189
344 3300025246 Ga0209646_1000032 Ga0209646_1000032167 189
345 3300025246 Ga0209646_1000283 Ga0209646_100028337 189
346 3300025250 Ga0209026_1000062 Ga0209026_100006227 189
347 3300025250 Ga0209026_1001071 Ga0209026_100107111 189
348 3300025256 Ga0209759_1000054 Ga0209759_100005412 189
349 3300025256 Ga0209759_1000548 Ga0209759_100054811 189
350 3300025272 Ga0209455_1012314 Ga0209455_10123142 189
351 3300025294 Ga0209025_1004468 Ga0209025_10044685 189
352 3300025303 Ga0209051_1025547 Ga0209051_10255474 189
353 3300025913 Ga0207695_10001902 Ga0207695_1000190213 189
354 3300025924 Ga0207694_10083481 Ga0207694_100834813 189
355 3300025949 Ga0207667_10087097 Ga0207667_100870972 189
356 3300026116 Ga0207674_10193579 Ga0207674_101935793 189
357 3300026118 Ga0207675_100006059 Ga0207675_1000060591 189
358 3300026142 Ga0207698_10002422 Ga0207698_100024229 189
359 3300046462 Ga0495651_0156487 Ga0495651_0156487_921_1493 189
360 3300046516 Ga0495628_0006086 Ga0495628_0006086_8659_9231 189
361 3300046520 Ga0495637_0027323 Ga0495637_0027323_357_1016 189
362 3300046523 Ga0495644_0046599 Ga0495644_0046599_46_624 189
363 3300046528 Ga0495642_0004046 Ga0495642_0004046_4925_5497 189
364 3300046529 Ga0495652_0014252 Ga0495652_0014252_3376_3948 189
365 3300046529 Ga0495652_0060251 Ga0495652_0060251_374_946 189
366 3300046539 Ga0495621_0248984 Ga0495621_0248984_75_650 189
367 3300046543 Ga0495645_0026559 Ga0495645_0026559_3212_3784 189
368 3300046660 Ga0495625_0004513 Ga0495625_0004513_10146_10715 189
369 3300046665 Ga0495661_0094194 Ga0495661_0094194_11_670 189
370 3300046680 Ga0495646_0041520 Ga0495646_0041520_510_1082 189
371 3300047318 Ga0495636_0035897 Ga0495636_0035897_1258_1830 189
372 3300047318 Ga0495636_0045189 Ga0495636_0045189_653_1222 189
373 3300047447 Ga0495685_115529 Ga0495685_115529_99_677 189
374 3300048090 Ga0495615_0044623 Ga0495615_0044623_43_615 189
375 3300048905 Ga0496102_0000279 Ga0496102_0000279_1879_2451 189
376 3300048906 Ga0496103_0001678 Ga0496103_0001678_1900_2472 189
377 3300048907 Ga0496104_0428969 Ga0496104_0428969_490_1080 189
378 3300048907 Ga0496104_0656401 Ga0496104_0656401_301_873 189
379 3300048908 Ga0496105_1001154 Ga0496105_1001154_24_596 189
380 3300048919 Ga0496116_0010763 Ga0496116_0010763_3504_4073 189
381 3300048921 Ga0496118_0089671 Ga0496118_0089671_798_1367 189
382 3300048925 Ga0496122_0000513 Ga0496122_0000513_10204_10773 189
383 3300048926 Ga0496123_0000145 Ga0496123_0000145_69257_69826 189
384 3300048928 Ga0496125_0032436 Ga0496125_0032436_3265_3834 189
385 3300053125 Ga0500618_001616 Ga0500618_001616_7218_7790 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

61

224

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixg-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcnb 0.9679 23 188
5ixg-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcnb 0.9511 23 188
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9205 23 188
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9164 23 189
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9049 23 188
ID Description Score Start End Superfamily
5ixgA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9679 23 188 2.40.128.110
5ixgA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9511 23 188 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9218 23 189 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9062 23 189 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8996 23 186 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A7S1HC48-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9802 56 170
AF-A0A257DAK4-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9802 80 188
AF-A0A522S201-F1-model_v4 Polyisoprenoid-binding protein 0.9795 19 188
AF-A0A2I8EWK9-F1-model_v4 Polyisoprenoid-binding protein 0.9784 19 189
AF-A0A2M8DSP7-F1-model_v4 Polyisoprenoid-binding protein 0.9781 27 188

Feature Viewer

pLDDT pTM Quality
91.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map