F430231

General Info

Members Datasets Scaffolds Average Seq Length
385 162 770 674

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10009413|Ga0265314_100094133
Length 718
Sequence MFSASLLSRQIPDDGGCNRRAMLPSMRKTARFVTLLVLLAIPVLELHAKVLRVEITSRQDVLGGQSFGDAGPYERIVGKVYYEAPVANWHDSQVVDIGNAVNESNGKVQFSADFVVVRPKVTSKANGSMLLEVPNRGSSRIVALVDGGDWDLAHNAGDAWLLRNGYTIATVGWQWDAVGDGALRLYAPTAKENGKTITGLLRGDLMPSQSMAEIPLGHLIMGKIGGSEYPVASPGDPRNVLTVRDAPDAPRTVIPRAQWQFANTVDGKLVPSDRYIHLNGDFQPGKVYEYLYVVQNPVVAGLGFIAVRDFAAWSKRSPDAIAPVKRVYGEGISQNGRWLRDYLYQAFNDDEDGFIALDGVLAHVAGAGRGSFNYEFAQPSRDAQPTSSIMFPTDLFPFTDSPENDPELASKKVKVGLLDGETNERGLPKIFFSNTSYEYWGRVAALIHVMPDPERGSAYKHLSVGGMVDARISPGVRIYHFTGLQHFSGPFPPRKGTGDLAGQQPQSPLPIKYFWRAMITNMDAWVRKGTEPPPSSYPRISEHSLVAFDDYAFPKIPGVNVPHQASSAYRLDFGTDWQKGILSRQPPIVGRPYAVLVPQVDADGNEEDGVRLPEFAAPLATYTPWNLRDPSIGAPDQRVSFEGSWIPFPKTKADRTKTGDPRQSIEERYKDRADYLARYSAALDQLIKERWILPEDRAVVLERGEQEWDLAMDGDKAN

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 3.12
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10009413 3300031711 Bacteria 8240
2 rootH2_10040690 3300003320 Bacteria 20051
3 rootH2_10066095 3300003320 Bacteria 3024
4 rootH2_10237018 3300003320 Bacteria 6067
5 Ga0070658_10006481 3300005327 Bacteria 9484
6 Ga0070683_100001294 3300005329 Bacteria 19050
7 Ga0070683_100008478 3300005329 Bacteria 8732
8 Ga0070683_100008905 3300005329 Bacteria 8552
9 Ga0070683_100060100 3300005329 Unclassified 3531
10 Ga0070670_100002947 3300005331 Bacteria 14096
11 Ga0070670_100026775 3300005331 Bacteria 4959
12 Ga0068869_100001913 3300005334 Bacteria 12502
13 Ga0068869_100017389 3300005334 Unclassified 4871
14 Ga0068869_100022558 3300005334 Bacteria 4339
15 Ga0070666_10056953 3300005335 Bacteria 2641
16 Ga0070680_100016607 3300005336 Bacteria 5793
17 Ga0068868_100000009 3300005338 Bacteria 120604
18 Ga0068868_100001752 3300005338 Bacteria 14874
19 Ga0068868_100074449 3300005338 Unclassified 2712
20 Ga0070661_100006196 3300005344 Bacteria 8248
21 Ga0070661_100015034 3300005344 Bacteria 5460
22 Ga0070661_100020937 3300005344 Bacteria 4668
23 Ga0070668_100029433 3300005347 Unclassified 4171
24 Ga0070688_100012199 3300005365 Bacteria 4808
25 Ga0070667_100001882 3300005367 Bacteria 18639
26 Ga0070709_10000443 3300005434 Bacteria 25096
27 Ga0070709_10007268 3300005434 Bacteria 6069
28 Ga0070709_10024817 3300005434 Bacteria 3534
29 Ga0070714_100000062 3300005435 Bacteria 100209
30 Ga0070714_100012018 3300005435 Bacteria 6890
31 Ga0070713_100000068 3300005436 Bacteria 66744
32 Ga0070713_100008354 3300005436 Bacteria 7342
33 Ga0070713_100032645 3300005436 Unclassified 4161
34 Ga0070713_100039691 3300005436 Unclassified 3823
35 Ga0070713_100093872 3300005436 Bacteria 2586
36 Ga0070711_100000241 3300005439 Bacteria 28138
37 Ga0070711_100003327 3300005439 Bacteria 9364
38 Ga0070711_100069674 3300005439 Bacteria 2474
39 Ga0070705_100014761 3300005440 Bacteria 4027
40 Ga0070662_100000518 3300005457 Bacteria 23227
41 Ga0070681_10000592 3300005458 Bacteria 29787
42 Ga0070681_10118434 3300005458 Bacteria 2585
43 Ga0068867_100006655 3300005459 Bacteria 8171
44 Ga0070706_100033978 3300005467 Bacteria 4708
45 Ga0070706_100038398 3300005467 Bacteria 4419
46 Ga0070707_100038846 3300005468 Unclassified 4547
47 Ga0070698_100078358 3300005471 Bacteria 3303
48 Ga0070699_100016564 3300005518 Bacteria 6326
49 Ga0070699_100020503 3300005518 Bacteria 5703
50 Ga0070679_100027550 3300005530 Bacteria 5594
51 Ga0070684_100000031 3300005535 Bacteria 106109
52 Ga0070684_100008864 3300005535 Bacteria 7890
53 Ga0070684_100047152 3300005535 Bacteria 3734
54 Ga0070684_100060901 3300005535 Unclassified 3303
55 Ga0068853_100000914 3300005539 Bacteria 20625
56 Ga0068853_100056067 3300005539 Bacteria 3397
57 Ga0068853_100097092 3300005539 Bacteria 2600
58 Ga0070693_100039757 3300005547 Unclassified 2636
59 Ga0070665_100002460 3300005548 Bacteria 20415
60 Ga0070665_100045905 3300005548 Unclassified 4388
61 Ga0070665_100120839 3300005548 Bacteria 2621
62 Ga0068855_100000143 3300005563 Bacteria 91719
63 Ga0068855_100002586 3300005563 Bacteria 22304
64 Ga0068855_100005167 3300005563 Bacteria 15921
65 Ga0068855_100015529 3300005563 Bacteria 9168
66 Ga0068855_100068545 3300005563 Bacteria 4130
67 Ga0068855_100143237 3300005563 Unclassified 2722
68 Ga0068857_100000269 3300005577 Bacteria 35388
69 Ga0068857_100001151 3300005577 Bacteria 20633
70 Ga0068854_100012656 3300005578 Bacteria 5527
71 Ga0068854_100019603 3300005578 Unclassified 4560
72 Ga0068854_100023053 3300005578 Bacteria 4249
73 Ga0068856_100000148 3300005614 Bacteria 71173
74 Ga0068856_100000273 3300005614 Bacteria 56215
75 Ga0068856_100000809 3300005614 Bacteria 33774
76 Ga0068856_100007671 3300005614 Bacteria 10530
77 Ga0068856_100009031 3300005614 Bacteria 9699
78 Ga0068856_100026595 3300005614 Bacteria 5642
79 Ga0068856_100052453 3300005614 Bacteria 4022
80 Ga0068852_100000199 3300005616 Bacteria 40929
81 Ga0068852_100000887 3300005616 Bacteria 19805
82 Ga0068852_100014888 3300005616 Bacteria 6011
83 Ga0068859_100029557 3300005617 Bacteria 5499
84 Ga0068859_100123788 3300005617 Unclassified 2653
85 Ga0068864_100001951 3300005618 Bacteria 16955
86 Ga0068864_100025987 3300005618 Bacteria 4935
87 Ga0068866_10020570 3300005718 Bacteria 3026
88 Ga0068861_100042830 3300005719 Bacteria 3395
89 Ga0068863_100000273 3300005841 Bacteria 53827
90 Ga0068863_100004406 3300005841 Bacteria 13884
91 Ga0068863_100008959 3300005841 Bacteria 9771
92 Ga0068863_100011845 3300005841 Bacteria 8429
93 Ga0068858_100010001 3300005842 Bacteria 9010
94 Ga0068858_100047180 3300005842 Bacteria 3994
95 Ga0068860_100000031 3300005843 Bacteria 255068
96 Ga0068860_100011277 3300005843 Bacteria 8805
97 Ga0068860_100115160 3300005843 Bacteria 2571
98 Ga0070717_10003280 3300006028 Bacteria 11575
99 Ga0070717_10012783 3300006028 Bacteria 6409
100 Ga0070717_10024927 3300006028 Unclassified 4752
101 Ga0070715_10007242 3300006163 Bacteria 3814
102 Ga0070716_100000198 3300006173 Bacteria 23729
103 Ga0070712_100000076 3300006175 Bacteria 50960
104 Ga0070712_100000162 3300006175 Bacteria 36151
105 Ga0070712_100001388 3300006175 Bacteria 14704
106 Ga0070712_100005749 3300006175 Bacteria 7665
107 Ga0097621_100000136 3300006237 Bacteria 43536
108 Ga0097621_100003104 3300006237 Bacteria 11393
109 Ga0097621_100005630 3300006237 Bacteria 8835
110 Ga0097621_100022197 3300006237 Unclassified 4924
111 Ga0097621_100067888 3300006237 Unclassified 2939
112 Ga0068871_100000057 3300006358 Bacteria 59839
113 Ga0068871_100001083 3300006358 Bacteria 18267
114 Ga0068871_100002198 3300006358 Bacteria 13257
115 Ga0068871_100002330 3300006358 Bacteria 12936
116 Ga0068871_100032505 3300006358 Bacteria 4123
117 Ga0068871_100036595 3300006358 Unclassified 3909
118 Ga0075434_100003012 3300006871 Bacteria 14985
119 Ga0075434_100015418 3300006871 Bacteria 7326
120 Ga0075434_100034874 3300006871 Unclassified 4972
121 Ga0068865_100016581 3300006881 Unclassified 4717
122 Ga0097620_100029555 3300006931 Bacteria 5499
123 Ga0097620_100123801 3300006931 Unclassified 2653
124 Ga0075435_100062280 3300007076 Unclassified 3027
125 Ga0105240_10000451 3300009093 Bacteria 75544
126 Ga0105240_10000758 3300009093 Bacteria 58931
127 Ga0105240_10001070 3300009093 Bacteria 48381
128 Ga0105240_10001619 3300009093 Bacteria 38195
129 Ga0105240_10008294 3300009093 Bacteria 14868
130 Ga0105240_10043986 3300009093 Bacteria 5678
131 Ga0105240_10044583 3300009093 Bacteria 5635
132 Ga0105240_10060855 3300009093 Bacteria 4707
133 Ga0105240_10061145 3300009093 Unclassified 4694
134 Ga0105245_10000523 3300009098 Bacteria 35137
135 Ga0105245_10003181 3300009098 Bacteria 14677
136 Ga0105245_10021411 3300009098 Bacteria 5671
137 Ga0105241_10000123 3300009174 Bacteria 56005
138 Ga0105241_10000673 3300009174 Bacteria 25723
139 Ga0105241_10011651 3300009174 Bacteria 6451
140 Ga0105241_10016631 3300009174 Bacteria 5398
141 Ga0105241_10062105 3300009174 Unclassified 2879
142 Ga0105242_10017519 3300009176 Bacteria 5584
143 Ga0105242_10071002 3300009176 Bacteria 2888
144 Ga0105248_10001233 3300009177 Bacteria 28557
145 Ga0105248_10002098 3300009177 Bacteria 22077
146 Ga0105248_10013362 3300009177 Bacteria 9035
147 Ga0105248_10026613 3300009177 Bacteria 6432
148 Ga0105248_10027095 3300009177 Bacteria 6376
149 Ga0105248_10047188 3300009177 Bacteria 4830
150 Ga0105248_10087680 3300009177 Unclassified 3502
151 Ga0105237_10006922 3300009545 Bacteria 12504
152 Ga0105237_10013557 3300009545 Bacteria 8539
153 Ga0105237_10097459 3300009545 Unclassified 2931
154 Ga0105238_10000334 3300009551 Bacteria 51408
155 Ga0105238_10000344 3300009551 Bacteria 50133
156 Ga0105238_10005504 3300009551 Bacteria 12505
157 Ga0105238_10021275 3300009551 Bacteria 6610
158 Ga0105238_10022210 3300009551 Bacteria 6469
159 Ga0105238_10087057 3300009551 Unclassified 3111
160 Ga0105249_10003984 3300009553 Bacteria 12744
161 Ga0105239_10002910 3300010375 Bacteria 21385
162 Ga0105239_10008371 3300010375 Bacteria 11783
163 Ga0105239_10013729 3300010375 Bacteria 8993
164 Ga0105239_10014176 3300010375 Bacteria 8844
165 Ga0105239_10021146 3300010375 Bacteria 7177
166 Ga0105239_10076938 3300010375 Unclassified 3671
167 Ga0105246_10001815 3300011119 Bacteria 12795
168 Ga0105246_10023353 3300011119 Bacteria 4001
169 Ga0157373_10032495 3300013100 Unclassified 3756
170 Ga0157373_10047547 3300013100 Bacteria 3060
171 Ga0157370_10000542 3300013104 Bacteria 47157
172 Ga0157370_10081854 3300013104 Unclassified 3038
173 Ga0157369_10002679 3300013105 Bacteria 21243
174 Ga0157369_10005286 3300013105 Bacteria 15041
175 Ga0157369_10007556 3300013105 Bacteria 12507
176 Ga0157369_10057662 3300013105 Bacteria 4189
177 Ga0157374_10000341 3300013296 Bacteria 43231
178 Ga0157374_10000869 3300013296 Bacteria 26398
179 Ga0157374_10002229 3300013296 Bacteria 16328
180 Ga0157374_10012953 3300013296 Bacteria 7270
181 Ga0157374_10086102 3300013296 Plasmid 2989
182 Ga0157374_10087310 3300013296 Bacteria 2969
183 Ga0157378_10000106 3300013297 Bacteria 79497
184 Ga0157378_10000256 3300013297 Bacteria 52148
185 Ga0157378_10000419 3300013297 Bacteria 41780
186 Ga0157378_10001048 3300013297 Bacteria 25267
187 Ga0157378_10007893 3300013297 Bacteria 9291
188 Ga0157378_10008694 3300013297 Bacteria 8837
189 Ga0157378_10009380 3300013297 Bacteria 8527
190 Ga0157378_10085049 3300013297 Unclassified 2865
191 Ga0163162_10014528 3300013306 Bacteria 7693
192 Ga0163162_10045367 3300013306 Unclassified 4404
193 Ga0163162_10057800 3300013306 Bacteria 3906
194 Ga0157372_10000083 3300013307 Bacteria 99009
195 Ga0157372_10000216 3300013307 Bacteria 63844
196 Ga0157372_10000408 3300013307 Bacteria 47157
197 Ga0157372_10007924 3300013307 Bacteria 11291
198 Ga0157372_10023203 3300013307 Bacteria 6723
199 Ga0157372_10043624 3300013307 Bacteria 4966
200 Ga0157372_10074736 3300013307 Bacteria 3822
201 Ga0157372_10112851 3300013307 Bacteria 3114
202 Ga0157375_10092445 3300013308 Bacteria 3089
203 Ga0157376_10000030 3300014969 Bacteria 181885
204 Ga0157376_10000386 3300014969 Bacteria 28694
205 Ga0157376_10001679 3300014969 Bacteria 14710
206 Ga0157376_10002264 3300014969 Bacteria 12993
207 Ga0157376_10016393 3300014969 Bacteria 5624
208 Ga0157376_10063712 3300014969 Bacteria 3107
209 Ga0157376_10119549 3300014969 Unclassified 2333
210 Ga0207710_10001408 3300025900 Bacteria 12030
211 Ga0207680_10013354 3300025903 Unclassified 4216
212 Ga0207647_10008248 3300025904 Bacteria 7484
213 Ga0207699_10000856 3300025906 Bacteria 14471
214 Ga0207699_10006600 3300025906 Bacteria 5632
215 Ga0207643_10034400 3300025908 Bacteria 2840
216 Ga0207684_10009501 3300025910 Bacteria 8585
217 Ga0207684_10049540 3300025910 Bacteria 3563
218 Ga0207654_10000078 3300025911 Bacteria 63974
219 Ga0207654_10000095 3300025911 Bacteria 59415
220 Ga0207654_10000236 3300025911 Bacteria 33775
221 Ga0207707_10001024 3300025912 Bacteria 26818
222 Ga0207707_10076116 3300025912 Bacteria 2928
223 Ga0207695_10000075 3300025913 Bacteria 308496
224 Ga0207695_10000145 3300025913 Bacteria 209555
225 Ga0207695_10000787 3300025913 Bacteria 59756
226 Ga0207695_10001098 3300025913 Bacteria 47165
227 Ga0207695_10005299 3300025913 Bacteria 17188
228 Ga0207695_10032101 3300025913 Bacteria 5751
229 Ga0207695_10042491 3300025913 Unclassified 4854
230 Ga0207695_10056910 3300025913 Unclassified 4066
231 Ga0207671_10000032 3300025914 Bacteria 245878
232 Ga0207671_10000324 3300025914 Bacteria 70145
233 Ga0207671_10030983 3300025914 Bacteria 3988
234 Ga0207693_10000015 3300025915 Bacteria 147464
235 Ga0207693_10000054 3300025915 Bacteria 96633
236 Ga0207693_10000817 3300025915 Bacteria 27778
237 Ga0207693_10006995 3300025915 Bacteria 9317
238 Ga0207693_10014166 3300025915 Bacteria 6422
239 Ga0207663_10000212 3300025916 Bacteria 25801
240 Ga0207663_10003780 3300025916 Bacteria 7467
241 Ga0207663_10032543 3300025916 Bacteria 3096
242 Ga0207657_10002074 3300025919 Bacteria 21676
243 Ga0207649_10005697 3300025920 Bacteria 6743
244 Ga0207652_10016582 3300025921 Bacteria 6017
245 Ga0207646_10024388 3300025922 Bacteria 5540
246 Ga0207694_10000024 3300025924 Bacteria 259443
247 Ga0207694_10000259 3300025924 Bacteria 50419
248 Ga0207694_10020340 3300025924 Bacteria 5020
249 Ga0207650_10014451 3300025925 Bacteria 5488
250 Ga0207687_10000208 3300025927 Bacteria 39686
251 Ga0207700_10000835 3300025928 Bacteria 17800
252 Ga0207700_10011058 3300025928 Bacteria 5736
253 Ga0207700_10025333 3300025928 Unclassified 4117
254 Ga0207700_10026820 3300025928 Unclassified 4024
255 Ga0207664_10000839 3300025929 Bacteria 20839
256 Ga0207664_10113899 3300025929 Bacteria 2253
257 Ga0207706_10002899 3300025933 Bacteria 16587
258 Ga0207686_10020964 3300025934 Unclassified 3742
259 Ga0207686_10034655 3300025934 Bacteria 3023
260 Ga0207709_10056288 3300025935 Bacteria 2433
261 Ga0207665_10000217 3300025939 Bacteria 38774
262 Ga0207665_10047774 3300025939 Unclassified 2870
263 Ga0207711_10007378 3300025941 Bacteria 9203
264 Ga0207689_10000487 3300025942 Bacteria 37505
265 Ga0207689_10000875 3300025942 Bacteria 29020
266 Ga0207689_10013111 3300025942 Bacteria 7076
267 Ga0207661_10000123 3300025944 Bacteria 49544
268 Ga0207661_10013531 3300025944 Bacteria 5959
269 Ga0207661_10101670 3300025944 Bacteria 2415
270 Ga0207679_10039943 3300025945 Bacteria 3355
271 Ga0207667_10000281 3300025949 Bacteria 70283
272 Ga0207667_10000659 3300025949 Bacteria 44741
273 Ga0207667_10002606 3300025949 Bacteria 22356
274 Ga0207667_10010917 3300025949 Bacteria 10585
275 Ga0207667_10012294 3300025949 Bacteria 9877
276 Ga0207667_10023411 3300025949 Bacteria 6801
277 Ga0207667_10127135 3300025949 Bacteria 2625
278 Ga0207668_10020954 3300025972 Unclassified 4163
279 Ga0207658_10000135 3300025986 Bacteria 77651
280 Ga0207677_10000034 3300026023 Bacteria 117922
281 Ga0207677_10052657 3300026023 Bacteria 2766
282 Ga0207677_10055375 3300026023 Unclassified 2712
283 Ga0207677_10058969 3300026023 Unclassified 2646
284 Ga0207703_10011096 3300026035 Bacteria 7017
285 Ga0207703_10012013 3300026035 Bacteria 6744
286 Ga0207703_10018057 3300026035 Bacteria 5509
287 Ga0207639_10000050 3300026041 Bacteria 121432
288 Ga0207678_10001472 3300026067 Bacteria 21589
289 Ga0207678_10007344 3300026067 Bacteria 9761
290 Ga0207702_10000109 3300026078 Bacteria 95381
291 Ga0207702_10000215 3300026078 Bacteria 67893
292 Ga0207702_10001176 3300026078 Bacteria 26691
293 Ga0207702_10001421 3300026078 Bacteria 23913
294 Ga0207702_10004710 3300026078 Bacteria 12055
295 Ga0207702_10048520 3300026078 Bacteria 3581
296 Ga0207702_10073590 3300026078 Unclassified 2947
297 Ga0207641_10004397 3300026088 Bacteria 12208
298 Ga0207641_10006547 3300026088 Bacteria 9792
299 Ga0207648_10038979 3300026089 Bacteria 4179
300 Ga0207648_10042804 3300026089 Bacteria 3976
301 Ga0207648_10102567 3300026089 Unclassified 2508
302 Ga0207676_10000316 3300026095 Bacteria 41392
303 Ga0207676_10002387 3300026095 Bacteria 13403
304 Ga0207674_10000968 3300026116 Bacteria 37588
305 Ga0207674_10001367 3300026116 Bacteria 31586
306 Ga0207674_10005577 3300026116 Bacteria 14923
307 Ga0207674_10063487 3300026116 Bacteria 3728
308 Ga0207675_100035645 3300026118 Bacteria 4641
309 Ga0207698_10000129 3300026142 Bacteria 47118
310 Ga0207698_10000393 3300026142 Bacteria 25270
311 Ga0207698_10066532 3300026142 Bacteria 2837
312 Ga0268266_10000465 3300028379 Bacteria 58957
313 Ga0268264_10000540 3300028381 Bacteria 47743
314 Ga0268264_10008325 3300028381 Bacteria 8621
315 Ga0268264_10029755 3300028381 Bacteria 4476
316 Ga0265338_10001467 3300028800 Bacteria 38200
317 Ga0265338_10004796 3300028800 Bacteria 18073
318 Ga0265338_10108487 3300028800 Bacteria 2242
319 Ga0265325_10006011 3300031241 Bacteria 7426
320 Ga0265340_10004251 3300031247 Bacteria 8027
321 Ga0265339_10000252 3300031249 Bacteria 43149
322 Ga0265331_10002776 3300031250 Bacteria 11618
323 Ga0265316_10010616 3300031344 Bacteria 8378
324 Ga0265316_10039509 3300031344 Bacteria 3789
325 Ga0265314_10003771 3300031711 Bacteria 14490
326 Ga0265314_10039235 3300031711 Unclassified 3414
327 Ga0373936_0000215 3300035113 Bacteria 19008
328 Ga0373945_0017121 3300035116 Bacteria 2452
329 Ga0373943_0000004 3300035170 Bacteria 99386
330 Ga0373931_0038435 3300035691 Unclassified 2503
331 Ga0373935_0000211 3300035692 Bacteria 27991
332 Ga0373927_0000741 3300035695 Bacteria 24928
333 Ga0373927_0057986 3300035695 Bacteria 2504
334 Ga0373947_0000164 3300035725 Bacteria 35529
335 Ga0373925_0029899 3300037068 Unclassified 3996
336 Ga0436364_0202439 3300037853 Bacteria 10529
337 Ga0436365_1831917 3300039437 Unclassified 4705
338 Ga0466961_0007970 3300044693 Bacteria 6750
339 Ga0466964_0001017 3300044706 Bacteria 9319
340 Ga0466970_0009775 3300044765 Bacteria 4856
341 Ga0466959_0000561 3300045049 Bacteria 21601
342 Ga0466967_0003442 3300045976 Bacteria 10326
343 Ga0495629_0004192 3300046459 Bacteria 10823
344 Ga0495580_0002338 3300046472 Bacteria 16540
345 Ga0495580_0006189 3300046472 Bacteria 9785
346 Ga0495580_0008892 3300046472 Bacteria 7944
347 Ga0495580_0012537 3300046472 Bacteria 6498
348 Ga0495580_0025190 3300046472 Bacteria 4348
349 Ga0495580_0026669 3300046472 Unclassified 4210
350 Ga0495580_0079917 3300046472 Unclassified 2280
351 Ga0495582_0003205 3300046473 Bacteria 9186
352 Ga0495582_0003825 3300046473 Bacteria 8473
353 Ga0495639_0003056 3300046475 Bacteria 7286
354 Ga0495584_0007999 3300046491 Bacteria 5496
355 Ga0495594_0027532 3300046499 Bacteria 3063
356 Ga0495630_0018585 3300046517 Bacteria 5108
357 Ga0495634_0027526 3300046642 Unclassified 3955
358 Ga0495647_0000482 3300046681 Bacteria 11596
359 Ga0495658_0010946 3300046683 Bacteria 4548
360 Ga0495674_0002174 3300047319 Bacteria 19251
361 Ga0495674_0009307 3300047319 Bacteria 9337
362 Ga0495676_0073508 3300047321 Bacteria 2621
363 Ga0495684_0062601 3300047471 Bacteria 2830
364 Ga0495614_0015227 3300048089 Bacteria 3354
365 Ga0496100_0042664 3300048903 Unclassified 2898
366 Ga0496102_0001752 3300048905 Bacteria 18947
367 Ga0496102_0075292 3300048905 Bacteria 3103
368 Ga0496104_0053142 3300048907 Bacteria 3827
369 Ga0496104_0099912 3300048907 Archaea 2778
370 Ga0496112_0001244 3300048915 Bacteria 19257
371 Ga0496112_0051588 3300048915 Bacteria 4035
372 Ga0496112_0060432 3300048915 Bacteria 3735
373 Ga0496112_0078020 3300048915 Unclassified 3276
374 Ga0496114_0045343 3300048917 Bacteria 3652
375 Ga0496115_0002146 3300048918 Bacteria 14101
376 Ga0496115_0058983 3300048918 Unclassified 3090
377 Ga0496126_0001321 3300048929 Bacteria 39430
378 Ga0496126_0005881 3300048929 Bacteria 13833
379 nmdc:mga0n895_22105_c1 3300050512 Bacteria 5961
380 nmdc:mga0n895_2227_c1 3300050512 Bacteria 14994
381 nmdc:mga0n895_7007_c1 3300050512 Bacteria 9628
382 nmdc:mga0rr50_51974_c1 3300050513 Unclassified 3043
383 nmdc:mga0rr50_992_c1 3300050513 Bacteria 15405
384 Ga0500616_0003393 3300053153 Bacteria 12221
385 Ga0500637_0049596 3300053178 Bacteria 2390
386 Ga0265314_10009413
387 rootH2_10040690
388 rootH2_10066095
389 rootH2_10237018
390 Ga0070658_10006481
391 Ga0070683_100001294
392 Ga0070683_100008478
393 Ga0070683_100008905
394 Ga0070683_100060100
395 Ga0070670_100002947
396 Ga0070670_100026775
397 Ga0068869_100001913
398 Ga0068869_100017389
399 Ga0068869_100022558
400 Ga0070666_10056953
401 Ga0070680_100016607
402 Ga0068868_100000009
403 Ga0068868_100001752
404 Ga0068868_100074449
405 Ga0070661_100006196
406 Ga0070661_100015034
407 Ga0070661_100020937
408 Ga0070668_100029433
409 Ga0070688_100012199
410 Ga0070667_100001882
411 Ga0070709_10000443
412 Ga0070709_10007268
413 Ga0070709_10024817
414 Ga0070714_100000062
415 Ga0070714_100012018
416 Ga0070713_100000068
417 Ga0070713_100008354
418 Ga0070713_100032645
419 Ga0070713_100039691
420 Ga0070713_100093872
421 Ga0070711_100000241
422 Ga0070711_100003327
423 Ga0070711_100069674
424 Ga0070705_100014761
425 Ga0070662_100000518
426 Ga0070681_10000592
427 Ga0070681_10118434
428 Ga0068867_100006655
429 Ga0070706_100033978
430 Ga0070706_100038398
431 Ga0070707_100038846
432 Ga0070698_100078358
433 Ga0070699_100016564
434 Ga0070699_100020503
435 Ga0070679_100027550
436 Ga0070684_100000031
437 Ga0070684_100008864
438 Ga0070684_100047152
439 Ga0070684_100060901
440 Ga0068853_100000914
441 Ga0068853_100056067
442 Ga0068853_100097092
443 Ga0070693_100039757
444 Ga0070665_100002460
445 Ga0070665_100045905
446 Ga0070665_100120839
447 Ga0068855_100000143
448 Ga0068855_100002586
449 Ga0068855_100005167
450 Ga0068855_100015529
451 Ga0068855_100068545
452 Ga0068855_100143237
453 Ga0068857_100000269
454 Ga0068857_100001151
455 Ga0068854_100012656
456 Ga0068854_100019603
457 Ga0068854_100023053
458 Ga0068856_100000148
459 Ga0068856_100000273
460 Ga0068856_100000809
461 Ga0068856_100007671
462 Ga0068856_100009031
463 Ga0068856_100026595
464 Ga0068856_100052453
465 Ga0068852_100000199
466 Ga0068852_100000887
467 Ga0068852_100014888
468 Ga0068859_100029557
469 Ga0068859_100123788
470 Ga0068864_100001951
471 Ga0068864_100025987
472 Ga0068866_10020570
473 Ga0068861_100042830
474 Ga0068863_100000273
475 Ga0068863_100004406
476 Ga0068863_100008959
477 Ga0068863_100011845
478 Ga0068858_100010001
479 Ga0068858_100047180
480 Ga0068860_100000031
481 Ga0068860_100011277
482 Ga0068860_100115160
483 Ga0070717_10003280
484 Ga0070717_10012783
485 Ga0070717_10024927
486 Ga0070715_10007242
487 Ga0070716_100000198
488 Ga0070712_100000076
489 Ga0070712_100000162
490 Ga0070712_100001388
491 Ga0070712_100005749
492 Ga0097621_100000136
493 Ga0097621_100003104
494 Ga0097621_100005630
495 Ga0097621_100022197
496 Ga0097621_100067888
497 Ga0068871_100000057
498 Ga0068871_100001083
499 Ga0068871_100002198
500 Ga0068871_100002330
501 Ga0068871_100032505
502 Ga0068871_100036595
503 Ga0075434_100003012
504 Ga0075434_100015418
505 Ga0075434_100034874
506 Ga0068865_100016581
507 Ga0097620_100029555
508 Ga0097620_100123801
509 Ga0075435_100062280
510 Ga0105240_10000451
511 Ga0105240_10000758
512 Ga0105240_10001070
513 Ga0105240_10001619
514 Ga0105240_10008294
515 Ga0105240_10043986
516 Ga0105240_10044583
517 Ga0105240_10060855
518 Ga0105240_10061145
519 Ga0105245_10000523
520 Ga0105245_10003181
521 Ga0105245_10021411
522 Ga0105241_10000123
523 Ga0105241_10000673
524 Ga0105241_10011651
525 Ga0105241_10016631
526 Ga0105241_10062105
527 Ga0105242_10017519
528 Ga0105242_10071002
529 Ga0105248_10001233
530 Ga0105248_10002098
531 Ga0105248_10013362
532 Ga0105248_10026613
533 Ga0105248_10027095
534 Ga0105248_10047188
535 Ga0105248_10087680
536 Ga0105237_10006922
537 Ga0105237_10013557
538 Ga0105237_10097459
539 Ga0105238_10000334
540 Ga0105238_10000344
541 Ga0105238_10005504
542 Ga0105238_10021275
543 Ga0105238_10022210
544 Ga0105238_10087057
545 Ga0105249_10003984
546 Ga0105239_10002910
547 Ga0105239_10008371
548 Ga0105239_10013729
549 Ga0105239_10014176
550 Ga0105239_10021146
551 Ga0105239_10076938
552 Ga0105246_10001815
553 Ga0105246_10023353
554 Ga0157373_10032495
555 Ga0157373_10047547
556 Ga0157370_10000542
557 Ga0157370_10081854
558 Ga0157369_10002679
559 Ga0157369_10005286
560 Ga0157369_10007556
561 Ga0157369_10057662
562 Ga0157374_10000341
563 Ga0157374_10000869
564 Ga0157374_10002229
565 Ga0157374_10012953
566 Ga0157374_10086102
567 Ga0157374_10087310
568 Ga0157378_10000106
569 Ga0157378_10000256
570 Ga0157378_10000419
571 Ga0157378_10001048
572 Ga0157378_10007893
573 Ga0157378_10008694
574 Ga0157378_10009380
575 Ga0157378_10085049
576 Ga0163162_10014528
577 Ga0163162_10045367
578 Ga0163162_10057800
579 Ga0157372_10000083
580 Ga0157372_10000216
581 Ga0157372_10000408
582 Ga0157372_10007924
583 Ga0157372_10023203
584 Ga0157372_10043624
585 Ga0157372_10074736
586 Ga0157372_10112851
587 Ga0157375_10092445
588 Ga0157376_10000030
589 Ga0157376_10000386
590 Ga0157376_10001679
591 Ga0157376_10002264
592 Ga0157376_10016393
593 Ga0157376_10063712
594 Ga0157376_10119549
595 Ga0207710_10001408
596 Ga0207680_10013354
597 Ga0207647_10008248
598 Ga0207699_10000856
599 Ga0207699_10006600
600 Ga0207643_10034400
601 Ga0207684_10009501
602 Ga0207684_10049540
603 Ga0207654_10000078
604 Ga0207654_10000095
605 Ga0207654_10000236
606 Ga0207707_10001024
607 Ga0207707_10076116
608 Ga0207695_10000075
609 Ga0207695_10000145
610 Ga0207695_10000787
611 Ga0207695_10001098
612 Ga0207695_10005299
613 Ga0207695_10032101
614 Ga0207695_10042491
615 Ga0207695_10056910
616 Ga0207671_10000032
617 Ga0207671_10000324
618 Ga0207671_10030983
619 Ga0207693_10000015
620 Ga0207693_10000054
621 Ga0207693_10000817
622 Ga0207693_10006995
623 Ga0207693_10014166
624 Ga0207663_10000212
625 Ga0207663_10003780
626 Ga0207663_10032543
627 Ga0207657_10002074
628 Ga0207649_10005697
629 Ga0207652_10016582
630 Ga0207646_10024388
631 Ga0207694_10000024
632 Ga0207694_10000259
633 Ga0207694_10020340
634 Ga0207650_10014451
635 Ga0207687_10000208
636 Ga0207700_10000835
637 Ga0207700_10011058
638 Ga0207700_10025333
639 Ga0207700_10026820
640 Ga0207664_10000839
641 Ga0207664_10113899
642 Ga0207706_10002899
643 Ga0207686_10020964
644 Ga0207686_10034655
645 Ga0207709_10056288
646 Ga0207665_10000217
647 Ga0207665_10047774
648 Ga0207711_10007378
649 Ga0207689_10000487
650 Ga0207689_10000875
651 Ga0207689_10013111
652 Ga0207661_10000123
653 Ga0207661_10013531
654 Ga0207661_10101670
655 Ga0207679_10039943
656 Ga0207667_10000281
657 Ga0207667_10000659
658 Ga0207667_10002606
659 Ga0207667_10010917
660 Ga0207667_10012294
661 Ga0207667_10023411
662 Ga0207667_10127135
663 Ga0207668_10020954
664 Ga0207658_10000135
665 Ga0207677_10000034
666 Ga0207677_10052657
667 Ga0207677_10055375
668 Ga0207677_10058969
669 Ga0207703_10011096
670 Ga0207703_10012013
671 Ga0207703_10018057
672 Ga0207639_10000050
673 Ga0207678_10001472
674 Ga0207678_10007344
675 Ga0207702_10000109
676 Ga0207702_10000215
677 Ga0207702_10001176
678 Ga0207702_10001421
679 Ga0207702_10004710
680 Ga0207702_10048520
681 Ga0207702_10073590
682 Ga0207641_10004397
683 Ga0207641_10006547
684 Ga0207648_10038979
685 Ga0207648_10042804
686 Ga0207648_10102567
687 Ga0207676_10000316
688 Ga0207676_10002387
689 Ga0207674_10000968
690 Ga0207674_10001367
691 Ga0207674_10005577
692 Ga0207674_10063487
693 Ga0207675_100035645
694 Ga0207698_10000129
695 Ga0207698_10000393
696 Ga0207698_10066532
697 Ga0268266_10000465
698 Ga0268264_10000540
699 Ga0268264_10008325
700 Ga0268264_10029755
701 Ga0265338_10001467
702 Ga0265338_10004796
703 Ga0265338_10108487
704 Ga0265325_10006011
705 Ga0265340_10004251
706 Ga0265339_10000252
707 Ga0265331_10002776
708 Ga0265316_10010616
709 Ga0265316_10039509
710 Ga0265314_10003771
711 Ga0265314_10039235
712 Ga0373936_0000215
713 Ga0373945_0017121
714 Ga0373943_0000004
715 Ga0373931_0038435
716 Ga0373935_0000211
717 Ga0373927_0000741
718 Ga0373927_0057986
719 Ga0373947_0000164
720 Ga0373925_0029899
721 Ga0436364_0202439
722 Ga0436365_1831917
723 Ga0466961_0007970
724 Ga0466964_0001017
725 Ga0466970_0009775
726 Ga0466959_0000561
727 Ga0466967_0003442
728 Ga0495629_0004192
729 Ga0495580_0002338
730 Ga0495580_0006189
731 Ga0495580_0008892
732 Ga0495580_0012537
733 Ga0495580_0025190
734 Ga0495580_0026669
735 Ga0495580_0079917
736 Ga0495582_0003205
737 Ga0495582_0003825
738 Ga0495639_0003056
739 Ga0495584_0007999
740 Ga0495594_0027532
741 Ga0495630_0018585
742 Ga0495634_0027526
743 Ga0495647_0000482
744 Ga0495658_0010946
745 Ga0495674_0002174
746 Ga0495674_0009307
747 Ga0495676_0073508
748 Ga0495684_0062601
749 Ga0495614_0015227
750 Ga0496100_0042664
751 Ga0496102_0001752
752 Ga0496102_0075292
753 Ga0496104_0053142
754 Ga0496104_0099912
755 Ga0496112_0001244
756 Ga0496112_0051588
757 Ga0496112_0060432
758 Ga0496112_0078020
759 Ga0496114_0045343
760 Ga0496115_0002146
761 Ga0496115_0058983
762 Ga0496126_0001321
763 Ga0496126_0005881
764 nmdc:mga0n895_22105_c1
765 nmdc:mga0n895_2227_c1
766 nmdc:mga0n895_7007_c1
767 nmdc:mga0rr50_51974_c1
768 nmdc:mga0rr50_992_c1
769 Ga0500616_0003393
770 Ga0500637_0049596

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20091

Abhydrolase_10

Alpha/beta hydrolase domain

262

702

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2odm-assembly1.cif.gz_A crystal structure of s. aureus ylan, an essential leucine rich protein involved in the control of cell shape 0.7002 621 659
7y7f-assembly1.cif.gz_T structure of the bacterial ribosome with human trna asp(manq34) and mrna(gac) 0.6777 619 657
7boe-assembly1.cif.gz_T bacterial 30s ribosomal subunit assembly complex state m (consensus refinement) 0.6773 619 657
2odm-assembly1.cif.gz_B crystal structure of s. aureus ylan, an essential leucine rich protein involved in the control of cell shape 0.6719 621 661
7boi-assembly1.cif.gz_T bacterial 30s ribosomal subunit assembly complex state f (multibody refinement for body domain of 30s ribosome) 0.6718 619 657
ID Description Score Start End Superfamily
af_Q2G2C3_1_91_1.10.287.750 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;SO2669-like 0.726 621 660 1.10.287.750
af_A0A0R0KUL4_74_210_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7005 22 57 2.60.40.1820
af_M0RCU0_16_225_3.15.10.10 Alpha Beta;Super Roll;Bactericidal permeability-increasing protein; domain 1;Bactericidal permeability-increasing protein; domain 1 0.6662 22 90 3.15.10.10
af_Q9HD47_4_184_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6442 22 91 3.40.1000.10
af_Q6ZGV3_1_147_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.6383 21 92 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V9WN36-F1-model_v4 Uncharacterized protein 0.9344 129 275
AF-A0A2V8C4D2-F1-model_v4 Alpha/beta hydrolase domain-containing protein 0.9327 411 661
AF-A0A3M1K8N9-F1-model_v4 Alpha/beta hydrolase domain-containing protein 0.9215 486 659
AF-A0A7X4JCH8-F1-model_v4 Alpha/beta hydrolase domain-containing protein 0.9151 543 658
AF-A0A2V9S0C0-F1-model_v4 Alpha/beta hydrolase domain-containing protein 0.9146 24 657

Map