F429885

General Info

Members Datasets Scaffolds Average Seq Length
384 211 768 272

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10142548|Ga0105248_101425482
Length 313
Sequence MVTYYDHAARPRQAVGTVTRNLHLGNASETALVYRCSMLLQDPPVVPQPAVNAPATPPAAPVPPKIQVAGMNFYYGPRRVLENIGLNVQPNQVTALIGPSGCGKSTFLRSLNRMNDIVPGARVEGSVRIDGADIYAASVDVVDLRRRVGMVFQKSNPFPKSIFDNVAYGLRINHLTRSREELRSRVEASLKAAALWDEVRDRLHTSALSLSGGQQQRLCIARALAVEPEVVLMDEPASALDPIATQRIEELIYQLKTRYTIVIVTHNMQQAARVSDVTAFFWLGKLVECDRTNKIFTAPSEKLTEDYVTGRFG

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
123 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0
Rhizoplane 4.43
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10142548 3300009177 Bacteria 2703
2 JGI24751J29686_10023567 3300002459 Bacteria 1277
3 Ga0065712_10095200 3300005290 Bacteria 2226
4 Ga0070658_10031263 3300005327 Bacteria 4274
5 Ga0070676_10257685 3300005328 Bacteria 1167
6 Ga0070683_100024427 3300005329 Bacteria 5413
7 Ga0070683_100104327 3300005329 Bacteria 2672
8 Ga0070670_100034322 3300005331 Bacteria 4366
9 Ga0070670_100375675 3300005331 Bacteria 1252
10 Ga0070677_10019460 3300005333 Bacteria 2459
11 Ga0070666_10056812 3300005335 Bacteria 2644
12 Ga0068868_100071185 3300005338 Bacteria 2773
13 Ga0068868_100131187 3300005338 Bacteria 2051
14 Ga0070660_100008786 3300005339 Bacteria 7076
15 Ga0070660_100108853 3300005339 Bacteria 2203
16 Ga0070668_100185608 3300005347 Bacteria 1701
17 Ga0070668_100397068 3300005347 Bacteria 1177
18 Ga0070675_100000171 3300005354 Bacteria 40220
19 Ga0070675_100106146 3300005354 Bacteria 2371
20 Ga0070675_100288268 3300005354 Bacteria 1444
21 Ga0070671_100008442 3300005355 Bacteria 8257
22 Ga0070674_100184177 3300005356 Bacteria 1602
23 Ga0070674_100187243 3300005356 Bacteria 1590
24 Ga0070674_100189611 3300005356 Bacteria 1581
25 Ga0070673_100497053 3300005364 Bacteria 1103
26 Ga0070688_100005930 3300005365 Bacteria 6472
27 Ga0070688_100155430 3300005365 Bacteria 1567
28 Ga0070688_100494235 3300005365 Bacteria 922
29 Ga0070713_100082690 3300005436 Bacteria 2743
30 Ga0070711_100251732 3300005439 Bacteria 1386
31 Ga0070705_100081182 3300005440 Bacteria 1992
32 Ga0070708_100177581 3300005445 Bacteria 1990
33 Ga0070678_100088135 3300005456 Bacteria 2372
34 Ga0070681_10002932 3300005458 Bacteria 15809
35 Ga0070681_10237806 3300005458 Bacteria 1735
36 Ga0070707_100110642 3300005468 Bacteria 2664
37 Ga0070707_100127890 3300005468 Bacteria 2469
38 Ga0070707_100324145 3300005468 Bacteria 1497
39 Ga0070698_100007033 3300005471 Bacteria 12189
40 Ga0070698_100330294 3300005471 Bacteria 1456
41 Ga0070679_100278725 3300005530 Bacteria 1625
42 Ga0070672_100041036 3300005543 Bacteria 3554
43 Ga0070672_100218895 3300005543 Bacteria 1596
44 Ga0070686_100064645 3300005544 Bacteria 2374
45 Ga0070686_100244902 3300005544 Bacteria 1307
46 Ga0070686_100271597 3300005544 Bacteria 1247
47 Ga0070695_100005732 3300005545 Bacteria 7318
48 Ga0070695_100114831 3300005545 Bacteria 1834
49 Ga0070696_100084884 3300005546 Bacteria 2247
50 Ga0070665_100002281 3300005548 Bacteria 21328
51 Ga0070665_100003341 3300005548 Bacteria 17173
52 Ga0070665_100022038 3300005548 Bacteria 6409
53 Ga0070665_100033094 3300005548 Bacteria 5202
54 Ga0070704_100082550 3300005549 Bacteria 2370
55 Ga0070704_100149429 3300005549 Bacteria 1835
56 Ga0068855_100011868 3300005563 Bacteria 10536
57 Ga0068855_100460344 3300005563 Bacteria 1387
58 Ga0070664_100081578 3300005564 Bacteria 2788
59 Ga0070664_100160780 3300005564 Bacteria 1987
60 Ga0070664_100275610 3300005564 Bacteria 1516
61 Ga0068854_100057344 3300005578 Bacteria 2809
62 Ga0068854_100231077 3300005578 Bacteria 1468
63 Ga0068856_100147133 3300005614 Bacteria 2363
64 Ga0068856_100724418 3300005614 Bacteria 1015
65 Ga0068859_100196225 3300005617 Bacteria 2103
66 Ga0068859_100208613 3300005617 Bacteria 2040
67 Ga0068864_100076567 3300005618 Bacteria 2924
68 Ga0068861_100443589 3300005719 Bacteria 1161
69 Ga0068863_100059555 3300005841 Bacteria 3612
70 Ga0068858_100001103 3300005842 Bacteria 27912
71 Ga0068858_100138109 3300005842 Bacteria 2288
72 Ga0068858_100262209 3300005842 Bacteria 1643
73 Ga0068858_100340061 3300005842 Bacteria 1436
74 Ga0068860_100229448 3300005843 Bacteria 1804
75 Ga0068860_100308366 3300005843 Bacteria 1552
76 Ga0068862_100065376 3300005844 Bacteria 3132
77 Ga0068862_100080242 3300005844 Bacteria 2829
78 Ga0081539_10006104 3300005985 Bacteria 11754
79 Ga0081539_10078660 3300005985 Bacteria 1740
80 Ga0075368_10016675 3300006042 Bacteria 2739
81 Ga0075368_10027454 3300006042 Bacteria 2196
82 Ga0075364_10024069 3300006051 Bacteria 3862
83 Ga0075367_10019668 3300006178 Bacteria 3748
84 Ga0075366_10002554 3300006195 Bacteria 9358
85 Ga0075366_10097153 3300006195 Bacteria 1766
86 Ga0097621_100008596 3300006237 Bacteria 7361
87 Ga0097621_100079322 3300006237 Bacteria 2729
88 Ga0097621_100100593 3300006237 Bacteria 2432
89 Ga0097621_100139494 3300006237 Bacteria 2071
90 Ga0075370_10020256 3300006353 Bacteria 3634
91 Ga0075370_10121380 3300006353 Bacteria 1521
92 Ga0068871_100027985 3300006358 Bacteria 4415
93 Ga0068871_100052864 3300006358 Bacteria 3291
94 Ga0068871_100138889 3300006358 Bacteria 2065
95 Ga0068871_100258644 3300006358 Bacteria 1518
96 Ga0068871_100299775 3300006358 Bacteria 1411
97 Ga0068871_100476836 3300006358 Bacteria 1122
98 Ga0075431_100021002 3300006847 Bacteria 6672
99 Ga0075433_10059115 3300006852 Bacteria 3354
100 Ga0075433_10205675 3300006852 Bacteria 1750
101 Ga0075433_10258944 3300006852 Bacteria 1543
102 Ga0075434_100000188 3300006871 Bacteria 40703
103 Ga0075434_100007133 3300006871 Bacteria 10328
104 Ga0075434_100260413 3300006871 Bacteria 1753
105 Ga0075434_100269805 3300006871 Bacteria 1721
106 Ga0068865_100012502 3300006881 Bacteria 5344
107 Ga0068865_100025938 3300006881 Bacteria 3860
108 Ga0075436_100000169 3300006914 Bacteria 41077
109 Ga0097620_100196234 3300006931 Bacteria 2103
110 Ga0097620_100208619 3300006931 Bacteria 2040
111 Ga0075435_100000002 3300007076 Bacteria 140391
112 Ga0075435_100001529 3300007076 Bacteria 14891
113 Ga0075435_100005263 3300007076 Bacteria 9008
114 Ga0075435_100077149 3300007076 Bacteria 2732
115 Ga0075435_100198346 3300007076 Bacteria 1700
116 Ga0105240_10018919 3300009093 Bacteria 9224
117 Ga0105240_10463806 3300009093 Bacteria 1415
118 Ga0111539_10007717 3300009094 Bacteria 13745
119 Ga0111539_10025467 3300009094 Bacteria 7254
120 Ga0105245_10048508 3300009098 Bacteria 3799
121 Ga0105245_10185735 3300009098 Bacteria 1989
122 Ga0105247_10020693 3300009101 Bacteria 3955
123 Ga0105247_10056782 3300009101 Bacteria 2419
124 Ga0114129_10001017 3300009147 Bacteria 36585
125 Ga0114129_10001985 3300009147 Bacteria 27999
126 Ga0114129_10026950 3300009147 Bacteria 8135
127 Ga0114129_10037191 3300009147 Bacteria 6874
128 Ga0114129_10048824 3300009147 Bacteria 5949
129 Ga0114129_10126450 3300009147 Bacteria 3514
130 Ga0114129_10135765 3300009147 Bacteria 3375
131 Ga0114129_10458509 3300009147 Bacteria 1671
132 Ga0105242_10023953 3300009176 Bacteria 4817
133 Ga0105242_10037325 3300009176 Bacteria 3902
134 Ga0105242_10192276 3300009176 Bacteria 1807
135 Ga0105248_10064338 3300009177 Bacteria 4118
136 Ga0105248_10117646 3300009177 Bacteria 2997
137 Ga0105248_10233715 3300009177 Bacteria 2069
138 Ga0105248_10315888 3300009177 Bacteria 1759
139 Ga0105248_10650099 3300009177 Bacteria 1190
140 Ga0105248_10772371 3300009177 Bacteria 1084
141 Ga0105237_10041364 3300009545 Bacteria 4648
142 Ga0105238_10184018 3300009551 Bacteria 2066
143 Ga0157374_10014823 3300013296 Bacteria 6829
144 Ga0157378_10006457 3300013297 Bacteria 10256
145 Ga0163162_10186964 3300013306 Bacteria 2199
146 Ga0157372_10038993 3300013307 Bacteria 5243
147 Ga0157375_10479489 3300013308 Bacteria 1409
148 Ga0157375_10675466 3300013308 Bacteria 1188
149 Ga0163163_10220140 3300014325 Bacteria 1947
150 Ga0163163_10514383 3300014325 Bacteria 1259
151 Ga0157380_10145980 3300014326 Bacteria 2039
152 Ga0157377_10075260 3300014745 Bacteria 1961
153 Ga0157379_10007570 3300014968 Bacteria 9403
154 Ga0157379_10027276 3300014968 Bacteria 5085
155 Ga0157376_10047359 3300014969 Bacteria 3548
156 Ga0157376_10064852 3300014969 Bacteria 3081
157 Ga0157376_10075292 3300014969 Bacteria 2880
158 Ga0157376_10162291 3300014969 Bacteria 2027
159 Ga0157376_10292814 3300014969 Bacteria 1538
160 Ga0163161_10370974 3300017792 Bacteria 1142
161 Ga0213876_10180808 3300021384 Bacteria 1122
162 Ga0207697_10041867 3300025315 Bacteria 1881
163 Ga0207682_10021438 3300025893 Bacteria 2542
164 Ga0207682_10022019 3300025893 Bacteria 2509
165 Ga0207642_10023065 3300025899 Bacteria 2480
166 Ga0207680_10203998 3300025903 Bacteria 1349
167 Ga0207645_10211501 3300025907 Bacteria 1277
168 Ga0207705_10074667 3300025909 Bacteria 2462
169 Ga0207707_10002065 3300025912 Bacteria 18220
170 Ga0207707_10149946 3300025912 Bacteria 2039
171 Ga0207707_10254260 3300025912 Bacteria 1526
172 Ga0207695_10060932 3300025913 Bacteria 3903
173 Ga0207657_10016037 3300025919 Bacteria 7231
174 Ga0207657_10090933 3300025919 Bacteria 2546
175 Ga0207652_10110146 3300025921 Bacteria 2441
176 Ga0207652_10446375 3300025921 Bacteria 1166
177 Ga0207646_10044095 3300025922 Bacteria 4003
178 Ga0207646_10158994 3300025922 Bacteria 2039
179 Ga0207646_10331681 3300025922 Bacteria 1374
180 Ga0207646_10363208 3300025922 Bacteria 1308
181 Ga0207650_10174177 3300025925 Bacteria 1712
182 Ga0207650_10364221 3300025925 Bacteria 1191
183 Ga0207687_10005267 3300025927 Bacteria 8573
184 Ga0207687_10063938 3300025927 Bacteria 2607
185 Ga0207687_10322719 3300025927 Bacteria 1250
186 Ga0207700_10064744 3300025928 Bacteria 2786
187 Ga0207644_10112890 3300025931 Bacteria 2057
188 Ga0207706_10057394 3300025933 Bacteria 3430
189 Ga0207686_10046664 3300025934 Bacteria 2674
190 Ga0207686_10049362 3300025934 Bacteria 2612
191 Ga0207686_10062065 3300025934 Bacteria 2372
192 Ga0207669_10047658 3300025937 Bacteria 2540
193 Ga0207669_10244931 3300025937 Bacteria 1331
194 Ga0207704_10015096 3300025938 Bacteria 3925
195 Ga0207704_10070584 3300025938 Bacteria 2213
196 Ga0207691_10111399 3300025940 Bacteria 2434
197 Ga0207691_10206488 3300025940 Bacteria 1708
198 Ga0207711_10052334 3300025941 Bacteria 3499
199 Ga0207711_10059245 3300025941 Bacteria 3297
200 Ga0207711_10178916 3300025941 Bacteria 1928
201 Ga0207711_10449203 3300025941 Bacteria 1200
202 Ga0207711_10507728 3300025941 Bacteria 1124
203 Ga0207711_10606746 3300025941 Bacteria 1021
204 Ga0207661_10056920 3300025944 Bacteria 3141
205 Ga0207679_10209521 3300025945 Bacteria 1634
206 Ga0207679_10236623 3300025945 Bacteria 1545
207 Ga0207712_10145927 3300025961 Bacteria 1822
208 Ga0207668_10030349 3300025972 Bacteria 3552
209 Ga0207668_10154216 3300025972 Bacteria 1782
210 Ga0207668_10293899 3300025972 Bacteria 1338
211 Ga0207668_10458496 3300025972 Bacteria 1089
212 Ga0207658_10088830 3300025986 Bacteria 2391
213 Ga0207677_10026278 3300026023 Bacteria 3648
214 Ga0207677_10046788 3300026023 Bacteria 2899
215 Ga0207677_10119127 3300026023 Bacteria 1982
216 Ga0207703_10004498 3300026035 Bacteria 11442
217 Ga0207703_10015113 3300026035 Bacteria 6025
218 Ga0207703_10016919 3300026035 Bacteria 5688
219 Ga0207703_10049764 3300026035 Bacteria 3388
220 Ga0207703_10510719 3300026035 Bacteria 1129
221 Ga0207708_10085165 3300026075 Bacteria 2431
222 Ga0207702_10360339 3300026078 Bacteria 1393
223 Ga0207641_10166897 3300026088 Bacteria 2006
224 Ga0207641_10587398 3300026088 Bacteria 1089
225 Ga0207648_10368073 3300026089 Bacteria 1298
226 Ga0207676_10063664 3300026095 Bacteria 2930
227 Ga0207676_10180622 3300026095 Bacteria 1847
228 Ga0207676_10556476 3300026095 Bacteria 1096
229 Ga0207674_10059416 3300026116 Bacteria 3869
230 Ga0207675_100013082 3300026118 Bacteria 7746
231 Ga0207675_100024827 3300026118 Bacteria 5577
232 Ga0207675_100087952 3300026118 Bacteria 2918
233 Ga0207683_10013257 3300026121 Bacteria 7028
234 Ga0207683_10017074 3300026121 Bacteria 6177
235 Ga0207683_10096778 3300026121 Bacteria 2632
236 Ga0207683_10281471 3300026121 Bacteria 1520
237 Ga0207683_10552412 3300026121 Bacteria 1065
238 Ga0207428_10028458 3300027907 Bacteria 4643
239 Ga0207428_10093120 3300027907 Bacteria 2338
240 Ga0207428_10281996 3300027907 Bacteria 1233
241 Ga0268266_10007194 3300028379 Bacteria 10079
242 Ga0268266_10053306 3300028379 Bacteria 3474
243 Ga0268266_10099126 3300028379 Bacteria 2565
244 Ga0268265_10097739 3300028380 Bacteria 2363
245 Ga0268264_10051837 3300028381 Bacteria 3421
246 Ga0268264_10083077 3300028381 Bacteria 2743
247 Ga0268264_10246791 3300028381 Bacteria 1657
248 Ga0268264_10337510 3300028381 Bacteria 1430
249 Ga0265314_10017540 3300031711 Bacteria 5616
250 Ga0307405_10098123 3300031731 Bacteria 1958
251 Ga0307415_100111057 3300032126 Bacteria 2034
252 Ga0307415_100224673 3300032126 Bacteria 1508
253 Ga0373930_0000300 3300034816 Bacteria 6404
254 Ga0373959_0000588 3300034820 Bacteria 6367
255 Ga0373938_0001462 3300034957 Bacteria 3785
256 Ga0373928_0000646 3300035084 Bacteria 6845
257 Ga0373929_0002904 3300035085 Bacteria 3128
258 Ga0373944_0051549 3300035089 Bacteria 1298
259 Ga0373949_0011656 3300035090 Bacteria 1938
260 Ga0373951_0001091 3300035091 Bacteria 7261
261 Ga0373952_0002525 3300035092 Bacteria 3297
262 Ga0373923_0098310 3300035111 Bacteria 1288
263 Ga0373932_0001022 3300035112 Bacteria 8096
264 Ga0373936_0038254 3300035113 Bacteria 1917
265 Ga0373939_0000191 3300035114 Bacteria 17055
266 Ga0373941_0000418 3300035115 Bacteria 8443
267 Ga0373941_0012765 3300035115 Bacteria 2205
268 Ga0373960_0000566 3300035121 Bacteria 7499
269 Ga0373943_0017872 3300035170 Bacteria 3251
270 Ga0373955_0051387 3300035172 Bacteria 2245
271 Ga0373942_0002730 3300035207 Bacteria 4218
272 Ga0373961_0007757 3300035241 Bacteria 2600
273 Ga0373962_0001273 3300035242 Bacteria 5924
274 Ga0373924_0034226 3300035410 Bacteria 2056
275 Ga0373931_0028790 3300035691 Bacteria 2847
276 Ga0373931_0172326 3300035691 Bacteria 1276
277 Ga0373933_0031614 3300035724 Bacteria 3071
278 Ga0373947_0009410 3300035725 Bacteria 5613
279 Ga0373937_0047514 3300036401 Bacteria 3927
280 Ga0373937_0076388 3300036401 Bacteria 3094
281 Ga0373937_0088433 3300036401 Bacteria 2868
282 Ga0373937_0207390 3300036401 Bacteria 1843
283 Ga0373937_0392610 3300036401 Bacteria 1316
284 Ga0373925_0030972 3300037068 Bacteria 3929
285 Ga0373925_0039800 3300037068 Bacteria 3479
286 Ga0439431_0020380 3300041997 Bacteria 1584
287 Ga0450910_012682 3300042147 Bacteria 1220
288 Ga0439435_0037266 3300042436 Bacteria 1347
289 Ga0450918_006371 3300042531 Bacteria 2106
290 Ga0466963_0074350 3300044694 Bacteria 2292
291 Ga0466963_0195772 3300044694 Bacteria 1413
292 Ga0451576_0017201 3300045051 Bacteria 7954
293 Ga0451576_0343849 3300045051 Bacteria 1562
294 Ga0495592_0049503 3300046454 Bacteria 3124
295 Ga0495629_0311130 3300046459 Bacteria 1078
296 Ga0495638_0083764 3300046460 Bacteria 1931
297 Ga0495580_0149195 3300046472 Bacteria 1620
298 Ga0495662_0119246 3300046476 Bacteria 1295
299 Ga0495608_0202079 3300046511 Bacteria 1252
300 Ga0495618_0284901 3300046514 Bacteria 1030
301 Ga0495628_0101445 3300046516 Bacteria 2221
302 Ga0495630_0003070 3300046517 Bacteria 11576
303 Ga0495652_0427004 3300046529 Bacteria 933
304 Ga0495645_0006557 3300046543 Bacteria 8085
305 Ga0495667_0187859 3300046559 Bacteria 1325
306 Ga0495634_0109862 3300046642 Bacteria 1774
307 Ga0495634_0169156 3300046642 Bacteria 1374
308 Ga0495588_0123376 3300046674 Bacteria 1366
309 Ga0495599_0144631 3300046678 Bacteria 1474
310 Ga0495623_0095732 3300046679 Bacteria 1815
311 Ga0495647_0016857 3300046681 Bacteria 2579
312 Ga0495647_0049044 3300046681 Bacteria 1635
313 Ga0495658_0014012 3300046683 Bacteria 4088
314 Ga0495669_0022237 3300046684 Bacteria 2754
315 Ga0495613_0002581 3300046689 Bacteria 13615
316 Ga0495613_0159772 3300046689 Bacteria 1604
317 Ga0495604_0020864 3300047317 Bacteria 5231
318 Ga0495674_0009341 3300047319 Bacteria 9323
319 Ga0495674_0525137 3300047319 Bacteria 945
320 Ga0495684_0003689 3300047471 Bacteria 11942
321 Ga0495684_0263009 3300047471 Bacteria 1251
322 Ga0495602_0221770 3300048088 Bacteria 1427
323 Ga0496100_0027058 3300048903 Bacteria 3522
324 Ga0496101_0008363 3300048904 Bacteria 6760
325 Ga0496104_0011503 3300048907 Bacteria 7930
326 Ga0496104_0074027 3300048907 Bacteria 3242
327 Ga0496104_0081908 3300048907 Bacteria 3078
328 Ga0496104_0193074 3300048907 Bacteria 1948
329 Ga0496106_0045816 3300048909 Bacteria 3286
330 Ga0496107_0271937 3300048910 Bacteria 1261
331 Ga0496108_0017611 3300048911 Bacteria 5845
332 Ga0496110_0131342 3300048913 Bacteria 2261
333 Ga0496111_0097072 3300048914 Bacteria 2163
334 Ga0496112_0030459 3300048915 Bacteria 5222
335 Ga0496112_0138257 3300048915 Bacteria 2406
336 Ga0496112_0604831 3300048915 Bacteria 1028
337 Ga0496114_0000095 3300048917 Bacteria 63591
338 Ga0496114_0070860 3300048917 Bacteria 2929
339 Ga0496115_0406979 3300048918 Bacteria 1103
340 Ga0501033_0078977 3300049570 Bacteria 2415
341 Ga0501034_0045842 3300049571 Bacteria 4417
342 Ga0501034_0428230 3300049571 Bacteria 1243
343 Ga0501047_0084270 3300049581 Bacteria 3055
344 Ga0501044_0010163 3300049823 Bacteria 10228
345 nmdc:mga00v17_36575_c1 3300050491 Bacteria 2927
346 nmdc:mga0k408_10236_c1 3300050493 Bacteria 5069
347 nmdc:mga06z11_12823_c1 3300050494 Bacteria 3657
348 nmdc:mga07m45_20247_c1 3300050496 Bacteria 3613
349 nmdc:mga07m45_62282_c1 3300050496 Bacteria 2114
350 nmdc:mga05p37_12079_c1 3300050507 Bacteria 10309
351 nmdc:mga05p37_198371_c1 3300050507 Bacteria 2432
352 nmdc:mga05p37_230110_c1 3300050507 Bacteria 2234
353 nmdc:mga05p37_5737_c1 3300050507 Bacteria 14599
354 nmdc:mga05p37_69315_c1 3300050507 Bacteria 4338
355 nmdc:mga05p37_765287_c1 3300050507 Bacteria 1062
356 nmdc:mga06r32_267748_c1 3300050510 Bacteria 1696
357 nmdc:mga06r32_785281_c1 3300050510 Bacteria 914
358 nmdc:mga08y16_120873_c1 3300050511 Bacteria 2726
359 nmdc:mga08y16_178994_c1 3300050511 Bacteria 2202
360 nmdc:mga0n895_165_c1 3300050512 Bacteria 40820
361 nmdc:mga0n895_549083_c1 3300050512 Bacteria 1161
362 nmdc:mga0n895_552715_c1 3300050512 Bacteria 1157
363 nmdc:mga0n895_812151_c1 3300050512 Bacteria 925
364 nmdc:mga0n895_83036_c1 3300050512 Bacteria 3195
365 nmdc:mga0n895_9639_c1 3300050512 Bacteria 8463
366 nmdc:mga0rr50_19700_c1 3300050513 Bacteria 4561
367 nmdc:mga0rr50_21225_c1 3300050513 Bacteria 4430
368 nmdc:mga0rr50_50_c1 3300050513 Bacteria 71098
369 nmdc:mga08x19_244_c1 3300050514 Bacteria 41531
370 nmdc:mga0a205_312381_c1 3300050515 Bacteria 1444
371 nmdc:mga0a205_34214_c1 3300050515 Bacteria 4875
372 nmdc:mga0a205_50142_c1 3300050515 Bacteria 4030
373 Ga0495601_0000195 3300053077 Bacteria 32156
374 Ga0495601_0007923 3300053077 Bacteria 6258
375 Ga0495612_0120618 3300053078 Bacteria 1128
376 Ga0495655_0021656 3300053083 Bacteria 1458
377 Ga0495595_0061632 3300053084 Bacteria 1757
378 Ga0495619_0020532 3300053085 Bacteria 4209
379 Ga0495619_0035208 3300053085 Bacteria 3256
380 Ga0495619_0039460 3300053085 Bacteria 3083
381 Ga0495619_0183444 3300053085 Bacteria 1448
382 Ga0500555_001530 3300053103 Bacteria 6999
383 Ga0500616_0000158 3300053153 Bacteria 112091
384 Ga0500645_000369 3300053730 Bacteria 31666
385 Ga0105248_10142548
386 JGI24751J29686_10023567
387 Ga0065712_10095200
388 Ga0070658_10031263
389 Ga0070676_10257685
390 Ga0070683_100024427
391 Ga0070683_100104327
392 Ga0070670_100034322
393 Ga0070670_100375675
394 Ga0070677_10019460
395 Ga0070666_10056812
396 Ga0068868_100071185
397 Ga0068868_100131187
398 Ga0070660_100008786
399 Ga0070660_100108853
400 Ga0070668_100185608
401 Ga0070668_100397068
402 Ga0070675_100000171
403 Ga0070675_100106146
404 Ga0070675_100288268
405 Ga0070671_100008442
406 Ga0070674_100184177
407 Ga0070674_100187243
408 Ga0070674_100189611
409 Ga0070673_100497053
410 Ga0070688_100005930
411 Ga0070688_100155430
412 Ga0070688_100494235
413 Ga0070713_100082690
414 Ga0070711_100251732
415 Ga0070705_100081182
416 Ga0070708_100177581
417 Ga0070678_100088135
418 Ga0070681_10002932
419 Ga0070681_10237806
420 Ga0070707_100110642
421 Ga0070707_100127890
422 Ga0070707_100324145
423 Ga0070698_100007033
424 Ga0070698_100330294
425 Ga0070679_100278725
426 Ga0070672_100041036
427 Ga0070672_100218895
428 Ga0070686_100064645
429 Ga0070686_100244902
430 Ga0070686_100271597
431 Ga0070695_100005732
432 Ga0070695_100114831
433 Ga0070696_100084884
434 Ga0070665_100002281
435 Ga0070665_100003341
436 Ga0070665_100022038
437 Ga0070665_100033094
438 Ga0070704_100082550
439 Ga0070704_100149429
440 Ga0068855_100011868
441 Ga0068855_100460344
442 Ga0070664_100081578
443 Ga0070664_100160780
444 Ga0070664_100275610
445 Ga0068854_100057344
446 Ga0068854_100231077
447 Ga0068856_100147133
448 Ga0068856_100724418
449 Ga0068859_100196225
450 Ga0068859_100208613
451 Ga0068864_100076567
452 Ga0068861_100443589
453 Ga0068863_100059555
454 Ga0068858_100001103
455 Ga0068858_100138109
456 Ga0068858_100262209
457 Ga0068858_100340061
458 Ga0068860_100229448
459 Ga0068860_100308366
460 Ga0068862_100065376
461 Ga0068862_100080242
462 Ga0081539_10006104
463 Ga0081539_10078660
464 Ga0075368_10016675
465 Ga0075368_10027454
466 Ga0075364_10024069
467 Ga0075367_10019668
468 Ga0075366_10002554
469 Ga0075366_10097153
470 Ga0097621_100008596
471 Ga0097621_100079322
472 Ga0097621_100100593
473 Ga0097621_100139494
474 Ga0075370_10020256
475 Ga0075370_10121380
476 Ga0068871_100027985
477 Ga0068871_100052864
478 Ga0068871_100138889
479 Ga0068871_100258644
480 Ga0068871_100299775
481 Ga0068871_100476836
482 Ga0075431_100021002
483 Ga0075433_10059115
484 Ga0075433_10205675
485 Ga0075433_10258944
486 Ga0075434_100000188
487 Ga0075434_100007133
488 Ga0075434_100260413
489 Ga0075434_100269805
490 Ga0068865_100012502
491 Ga0068865_100025938
492 Ga0075436_100000169
493 Ga0097620_100196234
494 Ga0097620_100208619
495 Ga0075435_100000002
496 Ga0075435_100001529
497 Ga0075435_100005263
498 Ga0075435_100077149
499 Ga0075435_100198346
500 Ga0105240_10018919
501 Ga0105240_10463806
502 Ga0111539_10007717
503 Ga0111539_10025467
504 Ga0105245_10048508
505 Ga0105245_10185735
506 Ga0105247_10020693
507 Ga0105247_10056782
508 Ga0114129_10001017
509 Ga0114129_10001985
510 Ga0114129_10026950
511 Ga0114129_10037191
512 Ga0114129_10048824
513 Ga0114129_10126450
514 Ga0114129_10135765
515 Ga0114129_10458509
516 Ga0105242_10023953
517 Ga0105242_10037325
518 Ga0105242_10192276
519 Ga0105248_10064338
520 Ga0105248_10117646
521 Ga0105248_10233715
522 Ga0105248_10315888
523 Ga0105248_10650099
524 Ga0105248_10772371
525 Ga0105237_10041364
526 Ga0105238_10184018
527 Ga0157374_10014823
528 Ga0157378_10006457
529 Ga0163162_10186964
530 Ga0157372_10038993
531 Ga0157375_10479489
532 Ga0157375_10675466
533 Ga0163163_10220140
534 Ga0163163_10514383
535 Ga0157380_10145980
536 Ga0157377_10075260
537 Ga0157379_10007570
538 Ga0157379_10027276
539 Ga0157376_10047359
540 Ga0157376_10064852
541 Ga0157376_10075292
542 Ga0157376_10162291
543 Ga0157376_10292814
544 Ga0163161_10370974
545 Ga0213876_10180808
546 Ga0207697_10041867
547 Ga0207682_10021438
548 Ga0207682_10022019
549 Ga0207642_10023065
550 Ga0207680_10203998
551 Ga0207645_10211501
552 Ga0207705_10074667
553 Ga0207707_10002065
554 Ga0207707_10149946
555 Ga0207707_10254260
556 Ga0207695_10060932
557 Ga0207657_10016037
558 Ga0207657_10090933
559 Ga0207652_10110146
560 Ga0207652_10446375
561 Ga0207646_10044095
562 Ga0207646_10158994
563 Ga0207646_10331681
564 Ga0207646_10363208
565 Ga0207650_10174177
566 Ga0207650_10364221
567 Ga0207687_10005267
568 Ga0207687_10063938
569 Ga0207687_10322719
570 Ga0207700_10064744
571 Ga0207644_10112890
572 Ga0207706_10057394
573 Ga0207686_10046664
574 Ga0207686_10049362
575 Ga0207686_10062065
576 Ga0207669_10047658
577 Ga0207669_10244931
578 Ga0207704_10015096
579 Ga0207704_10070584
580 Ga0207691_10111399
581 Ga0207691_10206488
582 Ga0207711_10052334
583 Ga0207711_10059245
584 Ga0207711_10178916
585 Ga0207711_10449203
586 Ga0207711_10507728
587 Ga0207711_10606746
588 Ga0207661_10056920
589 Ga0207679_10209521
590 Ga0207679_10236623
591 Ga0207712_10145927
592 Ga0207668_10030349
593 Ga0207668_10154216
594 Ga0207668_10293899
595 Ga0207668_10458496
596 Ga0207658_10088830
597 Ga0207677_10026278
598 Ga0207677_10046788
599 Ga0207677_10119127
600 Ga0207703_10004498
601 Ga0207703_10015113
602 Ga0207703_10016919
603 Ga0207703_10049764
604 Ga0207703_10510719
605 Ga0207708_10085165
606 Ga0207702_10360339
607 Ga0207641_10166897
608 Ga0207641_10587398
609 Ga0207648_10368073
610 Ga0207676_10063664
611 Ga0207676_10180622
612 Ga0207676_10556476
613 Ga0207674_10059416
614 Ga0207675_100013082
615 Ga0207675_100024827
616 Ga0207675_100087952
617 Ga0207683_10013257
618 Ga0207683_10017074
619 Ga0207683_10096778
620 Ga0207683_10281471
621 Ga0207683_10552412
622 Ga0207428_10028458
623 Ga0207428_10093120
624 Ga0207428_10281996
625 Ga0268266_10007194
626 Ga0268266_10053306
627 Ga0268266_10099126
628 Ga0268265_10097739
629 Ga0268264_10051837
630 Ga0268264_10083077
631 Ga0268264_10246791
632 Ga0268264_10337510
633 Ga0265314_10017540
634 Ga0307405_10098123
635 Ga0307415_100111057
636 Ga0307415_100224673
637 Ga0373930_0000300
638 Ga0373959_0000588
639 Ga0373938_0001462
640 Ga0373928_0000646
641 Ga0373929_0002904
642 Ga0373944_0051549
643 Ga0373949_0011656
644 Ga0373951_0001091
645 Ga0373952_0002525
646 Ga0373923_0098310
647 Ga0373932_0001022
648 Ga0373936_0038254
649 Ga0373939_0000191
650 Ga0373941_0000418
651 Ga0373941_0012765
652 Ga0373960_0000566
653 Ga0373943_0017872
654 Ga0373955_0051387
655 Ga0373942_0002730
656 Ga0373961_0007757
657 Ga0373962_0001273
658 Ga0373924_0034226
659 Ga0373931_0028790
660 Ga0373931_0172326
661 Ga0373933_0031614
662 Ga0373947_0009410
663 Ga0373937_0047514
664 Ga0373937_0076388
665 Ga0373937_0088433
666 Ga0373937_0207390
667 Ga0373937_0392610
668 Ga0373925_0030972
669 Ga0373925_0039800
670 Ga0439431_0020380
671 Ga0450910_012682
672 Ga0439435_0037266
673 Ga0450918_006371
674 Ga0466963_0074350
675 Ga0466963_0195772
676 Ga0451576_0017201
677 Ga0451576_0343849
678 Ga0495592_0049503
679 Ga0495629_0311130
680 Ga0495638_0083764
681 Ga0495580_0149195
682 Ga0495662_0119246
683 Ga0495608_0202079
684 Ga0495618_0284901
685 Ga0495628_0101445
686 Ga0495630_0003070
687 Ga0495652_0427004
688 Ga0495645_0006557
689 Ga0495667_0187859
690 Ga0495634_0109862
691 Ga0495634_0169156
692 Ga0495588_0123376
693 Ga0495599_0144631
694 Ga0495623_0095732
695 Ga0495647_0016857
696 Ga0495647_0049044
697 Ga0495658_0014012
698 Ga0495669_0022237
699 Ga0495613_0002581
700 Ga0495613_0159772
701 Ga0495604_0020864
702 Ga0495674_0009341
703 Ga0495674_0525137
704 Ga0495684_0003689
705 Ga0495684_0263009
706 Ga0495602_0221770
707 Ga0496100_0027058
708 Ga0496101_0008363
709 Ga0496104_0011503
710 Ga0496104_0074027
711 Ga0496104_0081908
712 Ga0496104_0193074
713 Ga0496106_0045816
714 Ga0496107_0271937
715 Ga0496108_0017611
716 Ga0496110_0131342
717 Ga0496111_0097072
718 Ga0496112_0030459
719 Ga0496112_0138257
720 Ga0496112_0604831
721 Ga0496114_0000095
722 Ga0496114_0070860
723 Ga0496115_0406979
724 Ga0501033_0078977
725 Ga0501034_0045842
726 Ga0501034_0428230
727 Ga0501047_0084270
728 Ga0501044_0010163
729 nmdc:mga00v17_36575_c1
730 nmdc:mga0k408_10236_c1
731 nmdc:mga06z11_12823_c1
732 nmdc:mga07m45_20247_c1
733 nmdc:mga07m45_62282_c1
734 nmdc:mga05p37_12079_c1
735 nmdc:mga05p37_198371_c1
736 nmdc:mga05p37_230110_c1
737 nmdc:mga05p37_5737_c1
738 nmdc:mga05p37_69315_c1
739 nmdc:mga05p37_765287_c1
740 nmdc:mga06r32_267748_c1
741 nmdc:mga06r32_785281_c1
742 nmdc:mga08y16_120873_c1
743 nmdc:mga08y16_178994_c1
744 nmdc:mga0n895_165_c1
745 nmdc:mga0n895_549083_c1
746 nmdc:mga0n895_552715_c1
747 nmdc:mga0n895_812151_c1
748 nmdc:mga0n895_83036_c1
749 nmdc:mga0n895_9639_c1
750 nmdc:mga0rr50_19700_c1
751 nmdc:mga0rr50_21225_c1
752 nmdc:mga0rr50_50_c1
753 nmdc:mga08x19_244_c1
754 nmdc:mga0a205_312381_c1
755 nmdc:mga0a205_34214_c1
756 nmdc:mga0a205_50142_c1
757 Ga0495601_0000195
758 Ga0495601_0007923
759 Ga0495612_0120618
760 Ga0495655_0021656
761 Ga0495595_0061632
762 Ga0495619_0020532
763 Ga0495619_0035208
764 Ga0495619_0039460
765 Ga0495619_0183444
766 Ga0500555_001530
767 Ga0500616_0000158
768 Ga0500645_000369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

81

238

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

143

269

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9249 17 259
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9137 17 258
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9096 17 260
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9066 17 245
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9065 17 244
ID Description Score Start End Superfamily
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9781 17 256 3.40.50.300
af_Q2FYQ0_38_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9662 17 256 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9636 17 259 3.40.50.300
af_P9WQK9_23_275_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.919 17 259 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9179 17 260 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5E4I566-F1-model_v4 Trehalose/maltose import ATP-binding protein MalK (EC 3.6.3.19) 0.9801 17 261 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A7C5MB01-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9792 14 240 GO:0005315
GO:0005524
GO:0016020
GO:0016887
GO:0035435
AF-A0A655R1D5-F1-model_v4 Phosphate transporter ATP-binding protein (EC 3.6.3.27) 0.9677 116 261 GO:0005315
GO:0005524
GO:0005886
GO:0016887
GO:0035435
AF-A0A1H4PVT7-F1-model_v4 Phosphate ABC transporter ATP-binding protein, PhoT family 0.9669 17 261 GO:0005524
GO:0015415
GO:0016020
GO:0016887
GO:0035435
AF-A0A7X3VJH7-F1-model_v4 Phosphate ABC transporter ATP-binding protein 0.9619 37 261 GO:0005315
GO:0005524
GO:0016020
GO:0016887
GO:0035435

Map