F429380

General Info

Members Datasets Scaffolds Average Seq Length
382 97 764 105

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0013743|Ga0495606_0013743_869_1195
Length 108
Sequence MRRAILLLGAALALSGCATAPDEPGKIVAEDRFAQVVVPGRTTRAELLAAFGPTKAIVFDSGMEAWLYEANAANAGAGRHTELVLLLDRTGIVQKMRRRPPYPTDPER

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
4 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
5 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
6 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
7 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
8 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
9 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
10 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
11 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
12 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
13 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
14 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
15 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
16 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
17 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
18 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
19 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
20 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
21 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
22 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
23 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
24 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
25 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
26 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
27 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
28 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
29 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
30 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
31 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
32 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
33 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
34 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
35 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
36 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
37 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
38 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
39 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
40 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
41 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
42 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
43 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
44 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
45 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
46 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
47 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
48 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
49 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
50 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
51 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
52 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
53 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
54 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
55 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
56 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
57 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
58 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
59 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
60 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
61 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
62 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
63 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
64 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
65 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
66 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
67 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
68 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
69 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
70 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
71 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
72 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
73 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
74 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
75 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
76 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
77 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
78 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
97 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 4.45
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0013743 3300046507 Bacteria 6372
2 Ga0065165_1000800 3300005262 Bacteria 42024
3 Ga0157327_1085467 3300012512 Bacteria 515
4 Ga0395899_0295056 3300037312 Bacteria 1099
5 Ga0395900_0997701 3300037418 Bacteria 757
6 Ga0395905_0278574 3300037471 Bacteria 1558
7 Ga0395905_0361494 3300037471 Bacteria 1344
8 Ga0466957_0003269 3300044842 Bacteria 8878
9 Ga0495617_000022 3300046452 Bacteria 185975
10 Ga0495627_008876 3300046453 Bacteria 3726
11 Ga0495627_030475 3300046453 Bacteria 1709
12 Ga0495627_034232 3300046453 Bacteria 1588
13 Ga0495603_0010423 3300046455 Bacteria 5629
14 Ga0495590_0000033 3300046457 Bacteria 133950
15 Ga0495590_0000324 3300046457 Bacteria 25008
16 Ga0495590_0032110 3300046457 Bacteria 1836
17 Ga0495591_000363 3300046458 Bacteria 39453
18 Ga0495638_0162538 3300046460 Bacteria 1287
19 Ga0495638_0242612 3300046460 Bacteria 997
20 Ga0495638_0331348 3300046460 Bacteria 810
21 Ga0495653_0076716 3300046463 Bacteria 2483
22 Ga0495650_0031369 3300046471 Bacteria 2392
23 Ga0495650_0039616 3300046471 Bacteria 2032
24 Ga0495582_0028646 3300046473 Bacteria 3056
25 Ga0495605_0000064 3300046474 Bacteria 140769
26 Ga0495605_0002199 3300046474 Bacteria 12180
27 Ga0495605_0004634 3300046474 Bacteria 8040
28 Ga0495605_0044818 3300046474 Bacteria 2184
29 Ga0495605_0068980 3300046474 Bacteria 1674
30 Ga0495605_0088179 3300046474 Bacteria 1442
31 Ga0495605_0108969 3300046474 Bacteria 1265
32 Ga0495605_0130154 3300046474 Bacteria 1135
33 Ga0495605_0138860 3300046474 Bacteria 1091
34 Ga0495605_0197723 3300046474 Bacteria 877
35 Ga0495639_0243292 3300046475 Bacteria 888
36 Ga0495584_0000113 3300046491 Bacteria 55512
37 Ga0495584_0004557 3300046491 Bacteria 7433
38 Ga0495584_0006391 3300046491 Bacteria 6173
39 Ga0495584_0013562 3300046491 Bacteria 4160
40 Ga0495584_0014003 3300046491 Bacteria 4085
41 Ga0495584_0023686 3300046491 Bacteria 3112
42 Ga0495584_0032964 3300046491 Bacteria 2620
43 Ga0495584_0120504 3300046491 Bacteria 1328
44 Ga0495584_0317936 3300046491 Bacteria 790
45 Ga0495584_0365249 3300046491 Bacteria 733
46 Ga0495584_0372377 3300046491 Bacteria 725
47 Ga0495584_0527995 3300046491 Bacteria 601
48 Ga0495585_0000255 3300046492 Bacteria 54956
49 Ga0495585_0003182 3300046492 Bacteria 11235
50 Ga0495585_0015778 3300046492 Bacteria 4386
51 Ga0495585_0021691 3300046492 Bacteria 3687
52 Ga0495585_0029695 3300046492 Bacteria 3111
53 Ga0495585_0037817 3300046492 Bacteria 2717
54 Ga0495585_0095890 3300046492 Bacteria 1592
55 Ga0495585_0122357 3300046492 Bacteria 1375
56 Ga0495585_0170764 3300046492 Bacteria 1123
57 Ga0495585_0628690 3300046492 Bacteria 504
58 Ga0495594_0013285 3300046499 Bacteria 4296
59 Ga0495594_0020714 3300046499 Bacteria 3504
60 Ga0495594_0194544 3300046499 Bacteria 1155
61 Ga0495596_0003329 3300046500 Bacteria 8182
62 Ga0495596_0004419 3300046500 Bacteria 6856
63 Ga0495596_0005851 3300046500 Bacteria 5750
64 Ga0495596_0008761 3300046500 Bacteria 4480
65 Ga0495596_0009920 3300046500 Bacteria 4172
66 Ga0495596_0012791 3300046500 Bacteria 3579
67 Ga0495596_0019139 3300046500 Bacteria 2816
68 Ga0495596_0022405 3300046500 Bacteria 2572
69 Ga0495596_0079333 3300046500 Bacteria 1274
70 Ga0495596_0088274 3300046500 Bacteria 1203
71 Ga0495596_0148477 3300046500 Bacteria 910
72 Ga0495596_0230841 3300046500 Bacteria 718
73 Ga0495607_0003240 3300046501 Bacteria 12544
74 Ga0495607_0005923 3300046501 Bacteria 8671
75 Ga0495607_0009997 3300046501 Bacteria 6391
76 Ga0495607_0032511 3300046501 Bacteria 3183
77 Ga0495607_0070291 3300046501 Bacteria 1957
78 Ga0495607_0185836 3300046501 Bacteria 1039
79 Ga0495607_0260028 3300046501 Bacteria 831
80 Ga0495607_0409432 3300046501 Bacteria 615
81 Ga0495583_0000648 3300046506 Bacteria 45972
82 Ga0495583_0000678 3300046506 Bacteria 44207
83 Ga0495583_0001974 3300046506 Bacteria 18835
84 Ga0495583_0006613 3300046506 Bacteria 7538
85 Ga0495583_0013622 3300046506 Bacteria 4524
86 Ga0495583_0018583 3300046506 Bacteria 3656
87 Ga0495583_0027751 3300046506 Bacteria 2790
88 Ga0495583_0029514 3300046506 Bacteria 2683
89 Ga0495583_0117799 3300046506 Bacteria 1120
90 Ga0495583_0176572 3300046506 Bacteria 875
91 Ga0495583_0226971 3300046506 Bacteria 753
92 Ga0495606_0048089 3300046507 Bacteria 2808
93 Ga0495606_0082391 3300046507 Bacteria 1997
94 Ga0495606_0082868 3300046507 Bacteria 1990
95 Ga0495606_0174098 3300046507 Bacteria 1246
96 Ga0495606_0412507 3300046507 Bacteria 700
97 Ga0495606_0420851 3300046507 Bacteria 691
98 Ga0495610_0000526 3300046512 Bacteria 38495
99 Ga0495610_0192050 3300046512 Bacteria 842
100 Ga0495616_0003313 3300046513 Bacteria 10342
101 Ga0495616_0020370 3300046513 Bacteria 3610
102 Ga0495616_0037208 3300046513 Bacteria 2505
103 Ga0495616_0042928 3300046513 Bacteria 2299
104 Ga0495616_0120134 3300046513 Bacteria 1214
105 Ga0495616_0136947 3300046513 Bacteria 1118
106 Ga0495616_0167244 3300046513 Bacteria 985
107 Ga0495616_0314029 3300046513 Bacteria 659
108 Ga0495616_0463389 3300046513 Bacteria 511
109 Ga0495631_0000500 3300046518 Bacteria 26207
110 Ga0495631_0000569 3300046518 Bacteria 24781
111 Ga0495631_0004273 3300046518 Bacteria 7632
112 Ga0495631_0012553 3300046518 Bacteria 4133
113 Ga0495631_0020207 3300046518 Bacteria 3114
114 Ga0495631_0028213 3300046518 Bacteria 2561
115 Ga0495631_0061903 3300046518 Bacteria 1622
116 Ga0495631_0081718 3300046518 Bacteria 1393
117 Ga0495631_0081926 3300046518 Bacteria 1391
118 Ga0495631_0096665 3300046518 Bacteria 1271
119 Ga0495631_0120838 3300046518 Bacteria 1126
120 Ga0495631_0124474 3300046518 Bacteria 1108
121 Ga0495631_0211989 3300046518 Bacteria 827
122 Ga0495631_0223985 3300046518 Bacteria 802
123 Ga0495632_0000026 3300046519 Bacteria 176367
124 Ga0495632_0000072 3300046519 Bacteria 104826
125 Ga0495632_0002950 3300046519 Bacteria 12489
126 Ga0495632_0017574 3300046519 Bacteria 3943
127 Ga0495632_0039820 3300046519 Bacteria 2369
128 Ga0495637_0000018 3300046520 Bacteria 186671
129 Ga0495637_0173181 3300046520 Bacteria 804
130 Ga0495643_0016213 3300046522 Bacteria 4381
131 Ga0495643_0017052 3300046522 Bacteria 4254
132 Ga0495643_0030751 3300046522 Bacteria 2995
133 Ga0495643_0088418 3300046522 Bacteria 1601
134 Ga0495644_0003892 3300046523 Bacteria 5877
135 Ga0495644_0017194 3300046523 Bacteria 2765
136 Ga0495644_0033662 3300046523 Bacteria 1935
137 Ga0495644_0034692 3300046523 Bacteria 1904
138 Ga0495644_0059176 3300046523 Bacteria 1440
139 Ga0495644_0090412 3300046523 Bacteria 1155
140 Ga0495644_0190093 3300046523 Bacteria 790
141 Ga0495648_0000379 3300046524 Bacteria 48793
142 Ga0495648_0004400 3300046524 Bacteria 12048
143 Ga0495648_0030342 3300046524 Bacteria 3576
144 Ga0495648_0046764 3300046524 Bacteria 2679
145 Ga0495648_0096215 3300046524 Bacteria 1646
146 Ga0495648_0119019 3300046524 Bacteria 1423
147 Ga0495663_0398088 3300046525 Bacteria 506
148 Ga0495666_0004398 3300046526 Bacteria 7122
149 Ga0495666_0309541 3300046526 Bacteria 714
150 Ga0495642_0000272 3300046528 Bacteria 29189
151 Ga0495642_0001945 3300046528 Bacteria 8709
152 Ga0495642_0011591 3300046528 Bacteria 3390
153 Ga0495642_0017630 3300046528 Bacteria 2790
154 Ga0495642_0024350 3300046528 Bacteria 2394
155 Ga0495642_0035560 3300046528 Bacteria 2010
156 Ga0495642_0079455 3300046528 Bacteria 1379
157 Ga0495642_0104422 3300046528 Bacteria 1208
158 Ga0495642_0125837 3300046528 Bacteria 1101
159 Ga0495642_0188016 3300046528 Bacteria 899
160 Ga0495642_0201862 3300046528 Bacteria 867
161 Ga0495654_0001736 3300046530 Bacteria 14615
162 Ga0495654_0008266 3300046530 Bacteria 5758
163 Ga0495654_0010372 3300046530 Bacteria 5069
164 Ga0495654_0020132 3300046530 Bacteria 3480
165 Ga0495654_0117911 3300046530 Bacteria 1204
166 Ga0495654_0429235 3300046530 Bacteria 522
167 Ga0495665_0030495 3300046531 Bacteria 2886
168 Ga0495586_0009658 3300046535 Bacteria 5137
169 Ga0495587_0029387 3300046536 Bacteria 3336
170 Ga0495609_0003370 3300046538 Bacteria 9193
171 Ga0495609_0003519 3300046538 Bacteria 8937
172 Ga0495609_0016064 3300046538 Bacteria 3493
173 Ga0495609_0024236 3300046538 Bacteria 2785
174 Ga0495609_0030963 3300046538 Bacteria 2434
175 Ga0495609_0038634 3300046538 Bacteria 2151
176 Ga0495609_0288096 3300046538 Bacteria 670
177 Ga0495597_0000032 3300046542 Bacteria 126825
178 Ga0495597_0000669 3300046542 Bacteria 27892
179 Ga0495597_0006452 3300046542 Bacteria 6070
180 Ga0495597_0015123 3300046542 Bacteria 3657
181 Ga0495597_0028861 3300046542 Bacteria 2535
182 Ga0495597_0108738 3300046542 Bacteria 1164
183 Ga0495645_0566447 3300046543 Bacteria 702
184 Ga0495622_0015603 3300046557 Bacteria 3530
185 Ga0495622_0089818 3300046557 Bacteria 1411
186 Ga0495633_0000987 3300046558 Bacteria 23359
187 Ga0495633_0003580 3300046558 Bacteria 10275
188 Ga0495633_0007636 3300046558 Bacteria 6190
189 Ga0495633_0127137 3300046558 Bacteria 1179
190 Ga0495633_0138552 3300046558 Bacteria 1125
191 Ga0495633_0321306 3300046558 Bacteria 702
192 Ga0495633_0347308 3300046558 Bacteria 672
193 Ga0495633_0542771 3300046558 Bacteria 523
194 Ga0495656_0009802 3300046615 Bacteria 3458
195 Ga0495656_0231190 3300046615 Bacteria 928
196 Ga0495656_0450784 3300046615 Bacteria 678
197 Ga0495668_0000320 3300046616 Bacteria 65752
198 Ga0495668_0000653 3300046616 Bacteria 41611
199 Ga0495668_0001542 3300046616 Bacteria 21852
200 Ga0495668_0002509 3300046616 Bacteria 14997
201 Ga0495668_0008679 3300046616 Bacteria 6316
202 Ga0495668_0009556 3300046616 Bacteria 5943
203 Ga0495668_0051243 3300046616 Bacteria 2285
204 Ga0495668_0078973 3300046616 Bacteria 1806
205 Ga0495668_0090627 3300046616 Bacteria 1675
206 Ga0495668_0096959 3300046616 Bacteria 1613
207 Ga0495668_0714413 3300046616 Bacteria 554
208 Ga0495611_0000128 3300046648 Bacteria 52770
209 Ga0495611_0000382 3300046648 Bacteria 28304
210 Ga0495611_0029698 3300046648 Bacteria 2398
211 Ga0495611_0038773 3300046648 Bacteria 2120
212 Ga0495611_0148225 3300046648 Bacteria 1095
213 Ga0495611_0441767 3300046648 Bacteria 593
214 Ga0495611_0525648 3300046648 Bacteria 536
215 Ga0495625_0004529 3300046660 Bacteria 13102
216 Ga0495625_0007814 3300046660 Bacteria 9221
217 Ga0495625_0041527 3300046660 Bacteria 3348
218 Ga0495625_0066943 3300046660 Bacteria 2529
219 Ga0495625_0147182 3300046660 Bacteria 1585
220 Ga0495625_0314424 3300046660 Bacteria 999
221 Ga0495635_0006366 3300046663 Bacteria 8224
222 Ga0495661_0000681 3300046665 Bacteria 33855
223 Ga0495661_0000974 3300046665 Bacteria 25862
224 Ga0495661_0013116 3300046665 Bacteria 5577
225 Ga0495661_0043700 3300046665 Bacteria 2752
226 Ga0495661_0051932 3300046665 Bacteria 2473
227 Ga0495661_0062590 3300046665 Bacteria 2203
228 Ga0495661_0063549 3300046665 Bacteria 2181
229 Ga0495661_0100600 3300046665 Bacteria 1627
230 Ga0495661_0102594 3300046665 Bacteria 1607
231 Ga0495661_0290760 3300046665 Bacteria 821
232 Ga0495661_0305702 3300046665 Bacteria 794
233 Ga0495661_0376345 3300046665 Bacteria 694
234 Ga0495661_0388106 3300046665 Bacteria 681
235 Ga0495661_0410020 3300046665 Bacteria 657
236 Ga0495661_0412192 3300046665 Bacteria 655
237 Ga0495661_0435933 3300046665 Bacteria 632
238 Ga0495661_0486052 3300046665 Bacteria 590
239 Ga0495588_0015911 3300046674 Bacteria 3628
240 Ga0495588_0017709 3300046674 Bacteria 3464
241 Ga0495588_0024175 3300046674 Bacteria 3016
242 Ga0495588_0038934 3300046674 Bacteria 2420
243 Ga0495588_0111573 3300046674 Bacteria 1440
244 Ga0495588_0241192 3300046674 Bacteria 953
245 Ga0495588_0365864 3300046674 Bacteria 757
246 Ga0495623_0270203 3300046679 Bacteria 950
247 Ga0495669_0000066 3300046684 Bacteria 69245
248 Ga0495669_0006142 3300046684 Bacteria 5009
249 Ga0495669_0006973 3300046684 Bacteria 4731
250 Ga0495669_0019658 3300046684 Bacteria 2917
251 Ga0495669_0049704 3300046684 Bacteria 1878
252 Ga0495669_0580238 3300046684 Bacteria 545
253 Ga0495613_0012571 3300046689 Bacteria 6293
254 Ga0495670_0001237 3300046691 Bacteria 12455
255 Ga0495670_0005054 3300046691 Bacteria 6490
256 Ga0495670_0021524 3300046691 Bacteria 3180
257 Ga0495670_0022009 3300046691 Bacteria 3147
258 Ga0495670_0026913 3300046691 Bacteria 2847
259 Ga0495670_0053155 3300046691 Bacteria 2028
260 Ga0495670_0265445 3300046691 Bacteria 916
261 Ga0495671_0004178 3300046692 Bacteria 8700
262 Ga0495671_0004218 3300046692 Bacteria 8654
263 Ga0495671_0079216 3300046692 Bacteria 1610
264 Ga0495649_0000116 3300046694 Bacteria 70997
265 Ga0495649_0024065 3300046694 Bacteria 3399
266 Ga0495649_0045138 3300046694 Bacteria 2404
267 Ga0495649_0052126 3300046694 Bacteria 2217
268 Ga0495649_0117269 3300046694 Bacteria 1409
269 Ga0495649_0194108 3300046694 Bacteria 1056
270 Ga0495649_0292683 3300046694 Bacteria 830
271 Ga0495649_0395244 3300046694 Bacteria 694
272 Ga0495589_0003272 3300046794 Bacteria 8809
273 Ga0495589_0009083 3300046794 Bacteria 5168
274 Ga0495589_0016072 3300046794 Bacteria 3845
275 Ga0495589_0131482 3300046794 Bacteria 1201
276 Ga0495589_0235998 3300046794 Bacteria 856
277 Ga0495589_0243262 3300046794 Bacteria 842
278 Ga0495589_0322095 3300046794 Bacteria 714
279 Ga0495660_0003371 3300046810 Bacteria 9902
280 Ga0495660_0061882 3300046810 Bacteria 2007
281 Ga0495660_0081037 3300046810 Bacteria 1702
282 Ga0495660_0083215 3300046810 Bacteria 1674
283 Ga0495660_0095328 3300046810 Bacteria 1539
284 Ga0495660_0125820 3300046810 Bacteria 1291
285 Ga0495660_0170206 3300046810 Bacteria 1061
286 Ga0495660_0226138 3300046810 Bacteria 879
287 Ga0495581_0021024 3300047315 Bacteria 3785
288 Ga0495581_0567889 3300047315 Bacteria 658
289 Ga0495604_0188776 3300047317 Bacteria 1437
290 Ga0495604_0197452 3300047317 Bacteria 1398
291 Ga0495636_0170026 3300047318 Bacteria 985
292 Ga0495672_0000064 3300047320 Bacteria 195158
293 Ga0495672_0000166 3300047320 Bacteria 95954
294 Ga0495672_0005780 3300047320 Bacteria 9719
295 Ga0495672_0012125 3300047320 Bacteria 6034
296 Ga0495676_0000015 3300047321 Bacteria 199492
297 Ga0495680_0016713 3300047322 Bacteria 6294
298 Ga0495683_0000264 3300047323 Bacteria 46961
299 Ga0495683_0022970 3300047323 Bacteria 3206
300 Ga0495683_0103870 3300047323 Bacteria 1363
301 Ga0495683_0120176 3300047323 Bacteria 1247
302 Ga0495683_0154892 3300047323 Bacteria 1063
303 Ga0495683_0209457 3300047323 Bacteria 875
304 Ga0495687_000030 3300047443 Bacteria 279992
305 Ga0495687_001761 3300047443 Bacteria 19143
306 Ga0495687_067330 3300047443 Bacteria 1450
307 Ga0495675_0001050 3300047444 Bacteria 16778
308 Ga0495677_0000480 3300047445 Bacteria 16984
309 Ga0495677_0000708 3300047445 Bacteria 13488
310 Ga0495677_0005670 3300047445 Bacteria 4731
311 Ga0495677_0062955 3300047445 Bacteria 1377
312 Ga0495677_0077802 3300047445 Bacteria 1241
313 Ga0495677_0079154 3300047445 Bacteria 1230
314 Ga0495677_0080253 3300047445 Bacteria 1222
315 Ga0495677_0108907 3300047445 Bacteria 1052
316 Ga0495677_0145413 3300047445 Bacteria 911
317 Ga0495679_038124 3300047446 Bacteria 1507
318 Ga0495679_051540 3300047446 Bacteria 1233
319 Ga0495679_064113 3300047446 Bacteria 1071
320 Ga0495679_071598 3300047446 Bacteria 998
321 Ga0495685_000710 3300047447 Bacteria 10213
322 Ga0495685_003275 3300047447 Bacteria 5157
323 Ga0495685_155533 3300047447 Bacteria 742
324 Ga0495681_0000133 3300047470 Bacteria 63830
325 Ga0495681_0000272 3300047470 Bacteria 41251
326 Ga0495681_0003838 3300047470 Bacteria 10399
327 Ga0495681_0011850 3300047470 Bacteria 5158
328 Ga0495681_0068984 3300047470 Bacteria 1607
329 Ga0495681_0179658 3300047470 Bacteria 870
330 Ga0495681_0247189 3300047470 Bacteria 705
331 Ga0495681_0254307 3300047470 Bacteria 692
332 Ga0495686_0000508 3300047472 Bacteria 56430
333 Ga0495686_0024696 3300047472 Bacteria 3945
334 Ga0495686_0446338 3300047472 Bacteria 688
335 Ga0495593_0208063 3300047673 Bacteria 982
336 Ga0495593_0247136 3300047673 Bacteria 893
337 Ga0495602_0068033 3300048088 Bacteria 3061
338 Ga0495614_0008381 3300048089 Bacteria 4597
339 Ga0495614_0017276 3300048089 Bacteria 3135
340 Ga0495626_0000048 3300048091 Bacteria 161634
341 Ga0495626_0001266 3300048091 Bacteria 20687
342 Ga0495626_0005235 3300048091 Bacteria 7676
343 Ga0495626_0005703 3300048091 Bacteria 7201
344 Ga0495626_0006631 3300048091 Bacteria 6562
345 Ga0495626_0006930 3300048091 Bacteria 6382
346 Ga0495626_0051976 3300048091 Bacteria 1889
347 Ga0495626_0073032 3300048091 Bacteria 1537
348 Ga0495626_0164161 3300048091 Bacteria 929
349 Ga0495626_0170175 3300048091 Bacteria 908
350 Ga0495626_0239220 3300048091 Bacteria 731
351 Ga0495626_0290862 3300048091 Bacteria 647
352 Ga0496100_0061187 3300048903 Bacteria 2480
353 Ga0496101_0019924 3300048904 Bacteria 4587
354 Ga0496102_0100646 3300048905 Bacteria 2684
355 Ga0496102_0853177 3300048905 Bacteria 833
356 Ga0496103_0367931 3300048906 Bacteria 924
357 Ga0496104_0261684 3300048907 Bacteria 1643
358 Ga0496104_0358361 3300048907 Bacteria 1371
359 Ga0496105_0353674 3300048908 Bacteria 1173
360 Ga0496107_1146248 3300048910 Bacteria 560
361 Ga0496108_0415949 3300048911 Bacteria 1174
362 Ga0496109_0025563 3300048912 Bacteria 5263
363 Ga0496110_0000009 3300048913 Bacteria 111367
364 Ga0496110_0732187 3300048913 Bacteria 891
365 Ga0496111_0269186 3300048914 Bacteria 1264
366 Ga0496112_0787339 3300048915 Bacteria 876
367 Ga0496113_0004549 3300048916 Bacteria 8543
368 Ga0496115_0116327 3300048918 Bacteria 2199
369 Ga0496122_0000127 3300048925 Bacteria 178260
370 Ga0496123_0000084 3300048926 Bacteria 187479
371 Ga0496124_0103491 3300048927 Bacteria 2303
372 Ga0496124_0156429 3300048927 Bacteria 1782
373 Ga0496124_0499530 3300048927 Bacteria 816
374 Ga0496125_0002897 3300048928 Bacteria 21601
375 Ga0495678_000034 3300049459 Bacteria 207827
376 Ga0495678_000290 3300049459 Bacteria 55357
377 Ga0495678_000414 3300049459 Bacteria 43072
378 Ga0495682_0001383 3300049460 Bacteria 13241
379 Ga0495682_0005407 3300049460 Bacteria 5310
380 Ga0495682_0028456 3300049460 Bacteria 2071
381 Ga0495682_0051229 3300049460 Bacteria 1502
382 Ga0495682_0233889 3300049460 Bacteria 650
383 Ga0495606_0013743
384 Ga0065165_1000800
385 Ga0157327_1085467
386 Ga0395899_0295056
387 Ga0395900_0997701
388 Ga0395905_0278574
389 Ga0395905_0361494
390 Ga0466957_0003269
391 Ga0495617_000022
392 Ga0495627_008876
393 Ga0495627_030475
394 Ga0495627_034232
395 Ga0495603_0010423
396 Ga0495590_0000033
397 Ga0495590_0000324
398 Ga0495590_0032110
399 Ga0495591_000363
400 Ga0495638_0162538
401 Ga0495638_0242612
402 Ga0495638_0331348
403 Ga0495653_0076716
404 Ga0495650_0031369
405 Ga0495650_0039616
406 Ga0495582_0028646
407 Ga0495605_0000064
408 Ga0495605_0002199
409 Ga0495605_0004634
410 Ga0495605_0044818
411 Ga0495605_0068980
412 Ga0495605_0088179
413 Ga0495605_0108969
414 Ga0495605_0130154
415 Ga0495605_0138860
416 Ga0495605_0197723
417 Ga0495639_0243292
418 Ga0495584_0000113
419 Ga0495584_0004557
420 Ga0495584_0006391
421 Ga0495584_0013562
422 Ga0495584_0014003
423 Ga0495584_0023686
424 Ga0495584_0032964
425 Ga0495584_0120504
426 Ga0495584_0317936
427 Ga0495584_0365249
428 Ga0495584_0372377
429 Ga0495584_0527995
430 Ga0495585_0000255
431 Ga0495585_0003182
432 Ga0495585_0015778
433 Ga0495585_0021691
434 Ga0495585_0029695
435 Ga0495585_0037817
436 Ga0495585_0095890
437 Ga0495585_0122357
438 Ga0495585_0170764
439 Ga0495585_0628690
440 Ga0495594_0013285
441 Ga0495594_0020714
442 Ga0495594_0194544
443 Ga0495596_0003329
444 Ga0495596_0004419
445 Ga0495596_0005851
446 Ga0495596_0008761
447 Ga0495596_0009920
448 Ga0495596_0012791
449 Ga0495596_0019139
450 Ga0495596_0022405
451 Ga0495596_0079333
452 Ga0495596_0088274
453 Ga0495596_0148477
454 Ga0495596_0230841
455 Ga0495607_0003240
456 Ga0495607_0005923
457 Ga0495607_0009997
458 Ga0495607_0032511
459 Ga0495607_0070291
460 Ga0495607_0185836
461 Ga0495607_0260028
462 Ga0495607_0409432
463 Ga0495583_0000648
464 Ga0495583_0000678
465 Ga0495583_0001974
466 Ga0495583_0006613
467 Ga0495583_0013622
468 Ga0495583_0018583
469 Ga0495583_0027751
470 Ga0495583_0029514
471 Ga0495583_0117799
472 Ga0495583_0176572
473 Ga0495583_0226971
474 Ga0495606_0048089
475 Ga0495606_0082391
476 Ga0495606_0082868
477 Ga0495606_0174098
478 Ga0495606_0412507
479 Ga0495606_0420851
480 Ga0495610_0000526
481 Ga0495610_0192050
482 Ga0495616_0003313
483 Ga0495616_0020370
484 Ga0495616_0037208
485 Ga0495616_0042928
486 Ga0495616_0120134
487 Ga0495616_0136947
488 Ga0495616_0167244
489 Ga0495616_0314029
490 Ga0495616_0463389
491 Ga0495631_0000500
492 Ga0495631_0000569
493 Ga0495631_0004273
494 Ga0495631_0012553
495 Ga0495631_0020207
496 Ga0495631_0028213
497 Ga0495631_0061903
498 Ga0495631_0081718
499 Ga0495631_0081926
500 Ga0495631_0096665
501 Ga0495631_0120838
502 Ga0495631_0124474
503 Ga0495631_0211989
504 Ga0495631_0223985
505 Ga0495632_0000026
506 Ga0495632_0000072
507 Ga0495632_0002950
508 Ga0495632_0017574
509 Ga0495632_0039820
510 Ga0495637_0000018
511 Ga0495637_0173181
512 Ga0495643_0016213
513 Ga0495643_0017052
514 Ga0495643_0030751
515 Ga0495643_0088418
516 Ga0495644_0003892
517 Ga0495644_0017194
518 Ga0495644_0033662
519 Ga0495644_0034692
520 Ga0495644_0059176
521 Ga0495644_0090412
522 Ga0495644_0190093
523 Ga0495648_0000379
524 Ga0495648_0004400
525 Ga0495648_0030342
526 Ga0495648_0046764
527 Ga0495648_0096215
528 Ga0495648_0119019
529 Ga0495663_0398088
530 Ga0495666_0004398
531 Ga0495666_0309541
532 Ga0495642_0000272
533 Ga0495642_0001945
534 Ga0495642_0011591
535 Ga0495642_0017630
536 Ga0495642_0024350
537 Ga0495642_0035560
538 Ga0495642_0079455
539 Ga0495642_0104422
540 Ga0495642_0125837
541 Ga0495642_0188016
542 Ga0495642_0201862
543 Ga0495654_0001736
544 Ga0495654_0008266
545 Ga0495654_0010372
546 Ga0495654_0020132
547 Ga0495654_0117911
548 Ga0495654_0429235
549 Ga0495665_0030495
550 Ga0495586_0009658
551 Ga0495587_0029387
552 Ga0495609_0003370
553 Ga0495609_0003519
554 Ga0495609_0016064
555 Ga0495609_0024236
556 Ga0495609_0030963
557 Ga0495609_0038634
558 Ga0495609_0288096
559 Ga0495597_0000032
560 Ga0495597_0000669
561 Ga0495597_0006452
562 Ga0495597_0015123
563 Ga0495597_0028861
564 Ga0495597_0108738
565 Ga0495645_0566447
566 Ga0495622_0015603
567 Ga0495622_0089818
568 Ga0495633_0000987
569 Ga0495633_0003580
570 Ga0495633_0007636
571 Ga0495633_0127137
572 Ga0495633_0138552
573 Ga0495633_0321306
574 Ga0495633_0347308
575 Ga0495633_0542771
576 Ga0495656_0009802
577 Ga0495656_0231190
578 Ga0495656_0450784
579 Ga0495668_0000320
580 Ga0495668_0000653
581 Ga0495668_0001542
582 Ga0495668_0002509
583 Ga0495668_0008679
584 Ga0495668_0009556
585 Ga0495668_0051243
586 Ga0495668_0078973
587 Ga0495668_0090627
588 Ga0495668_0096959
589 Ga0495668_0714413
590 Ga0495611_0000128
591 Ga0495611_0000382
592 Ga0495611_0029698
593 Ga0495611_0038773
594 Ga0495611_0148225
595 Ga0495611_0441767
596 Ga0495611_0525648
597 Ga0495625_0004529
598 Ga0495625_0007814
599 Ga0495625_0041527
600 Ga0495625_0066943
601 Ga0495625_0147182
602 Ga0495625_0314424
603 Ga0495635_0006366
604 Ga0495661_0000681
605 Ga0495661_0000974
606 Ga0495661_0013116
607 Ga0495661_0043700
608 Ga0495661_0051932
609 Ga0495661_0062590
610 Ga0495661_0063549
611 Ga0495661_0100600
612 Ga0495661_0102594
613 Ga0495661_0290760
614 Ga0495661_0305702
615 Ga0495661_0376345
616 Ga0495661_0388106
617 Ga0495661_0410020
618 Ga0495661_0412192
619 Ga0495661_0435933
620 Ga0495661_0486052
621 Ga0495588_0015911
622 Ga0495588_0017709
623 Ga0495588_0024175
624 Ga0495588_0038934
625 Ga0495588_0111573
626 Ga0495588_0241192
627 Ga0495588_0365864
628 Ga0495623_0270203
629 Ga0495669_0000066
630 Ga0495669_0006142
631 Ga0495669_0006973
632 Ga0495669_0019658
633 Ga0495669_0049704
634 Ga0495669_0580238
635 Ga0495613_0012571
636 Ga0495670_0001237
637 Ga0495670_0005054
638 Ga0495670_0021524
639 Ga0495670_0022009
640 Ga0495670_0026913
641 Ga0495670_0053155
642 Ga0495670_0265445
643 Ga0495671_0004178
644 Ga0495671_0004218
645 Ga0495671_0079216
646 Ga0495649_0000116
647 Ga0495649_0024065
648 Ga0495649_0045138
649 Ga0495649_0052126
650 Ga0495649_0117269
651 Ga0495649_0194108
652 Ga0495649_0292683
653 Ga0495649_0395244
654 Ga0495589_0003272
655 Ga0495589_0009083
656 Ga0495589_0016072
657 Ga0495589_0131482
658 Ga0495589_0235998
659 Ga0495589_0243262
660 Ga0495589_0322095
661 Ga0495660_0003371
662 Ga0495660_0061882
663 Ga0495660_0081037
664 Ga0495660_0083215
665 Ga0495660_0095328
666 Ga0495660_0125820
667 Ga0495660_0170206
668 Ga0495660_0226138
669 Ga0495581_0021024
670 Ga0495581_0567889
671 Ga0495604_0188776
672 Ga0495604_0197452
673 Ga0495636_0170026
674 Ga0495672_0000064
675 Ga0495672_0000166
676 Ga0495672_0005780
677 Ga0495672_0012125
678 Ga0495676_0000015
679 Ga0495680_0016713
680 Ga0495683_0000264
681 Ga0495683_0022970
682 Ga0495683_0103870
683 Ga0495683_0120176
684 Ga0495683_0154892
685 Ga0495683_0209457
686 Ga0495687_000030
687 Ga0495687_001761
688 Ga0495687_067330
689 Ga0495675_0001050
690 Ga0495677_0000480
691 Ga0495677_0000708
692 Ga0495677_0005670
693 Ga0495677_0062955
694 Ga0495677_0077802
695 Ga0495677_0079154
696 Ga0495677_0080253
697 Ga0495677_0108907
698 Ga0495677_0145413
699 Ga0495679_038124
700 Ga0495679_051540
701 Ga0495679_064113
702 Ga0495679_071598
703 Ga0495685_000710
704 Ga0495685_003275
705 Ga0495685_155533
706 Ga0495681_0000133
707 Ga0495681_0000272
708 Ga0495681_0003838
709 Ga0495681_0011850
710 Ga0495681_0068984
711 Ga0495681_0179658
712 Ga0495681_0247189
713 Ga0495681_0254307
714 Ga0495686_0000508
715 Ga0495686_0024696
716 Ga0495686_0446338
717 Ga0495593_0208063
718 Ga0495593_0247136
719 Ga0495602_0068033
720 Ga0495614_0008381
721 Ga0495614_0017276
722 Ga0495626_0000048
723 Ga0495626_0001266
724 Ga0495626_0005235
725 Ga0495626_0005703
726 Ga0495626_0006631
727 Ga0495626_0006930
728 Ga0495626_0051976
729 Ga0495626_0073032
730 Ga0495626_0164161
731 Ga0495626_0170175
732 Ga0495626_0239220
733 Ga0495626_0290862
734 Ga0496100_0061187
735 Ga0496101_0019924
736 Ga0496102_0100646
737 Ga0496102_0853177
738 Ga0496103_0367931
739 Ga0496104_0261684
740 Ga0496104_0358361
741 Ga0496105_0353674
742 Ga0496107_1146248
743 Ga0496108_0415949
744 Ga0496109_0025563
745 Ga0496110_0000009
746 Ga0496110_0732187
747 Ga0496111_0269186
748 Ga0496112_0787339
749 Ga0496113_0004549
750 Ga0496115_0116327
751 Ga0496122_0000127
752 Ga0496123_0000084
753 Ga0496124_0103491
754 Ga0496124_0156429
755 Ga0496124_0499530
756 Ga0496125_0002897
757 Ga0495678_000034
758 Ga0495678_000290
759 Ga0495678_000414
760 Ga0495682_0001383
761 Ga0495682_0005407
762 Ga0495682_0028456
763 Ga0495682_0051229
764 Ga0495682_0233889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08139

LPAM_1

Prokaryotic membrane lipoprotein lipid attachment site

1

18

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vi8-assembly1.cif.gz_B crystal structure of a putative thioesterase 0.8145 63 95
4k4c-assembly1.cif.gz_D x-ray crystal structure of e. coli ybdb complexed with phenacyl-coa 0.8142 63 95
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.803 78 97
1sbk-assembly1.cif.gz_A x-ray structure of ydii_ecoli northeast structural genomics consortium target er29. 0.7922 63 95
3r37-assembly1.cif.gz_A crystal structure of arthrobacter sp. strain su 4-hydroxybenzoyl coa thioesterase mutant e73q complexed with 4-hydroxyphenacyl coa 0.7802 63 93
ID Description Score Start End Superfamily
af_A0A1D8PII6_4_230_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8955 78 96 3.30.565.10
2essA01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8222 63 95 3.10.129.10
af_O45003_1_124_2.60.40.2240 Mainly Beta;Sandwich;Immunoglobulin-like;Acyl-CoA thioester hydrolase/BAAT N-terminal domain 0.7981 76 95 2.60.40.2240
1sbkA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7922 63 95 3.10.129.10
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7891 63 93 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A5C4NDU8-F1-model_v4 Outer membrane protein assembly factor BamE 0.8598 24 103 GO:0019867
AF-A0A0J1D827-F1-model_v4 Lipoprotein SmpA/OmlA domain-containing protein 0.8556 12 105
AF-A0A2U1RRU4-F1-model_v4 deleted 0.8437 29 102
AF-A0A6I1Q0C5-F1-model_v4 Lipoprotein 0.842 29 97
AF-A0A7W8USH3-F1-model_v4 Lipoprotein 0.841 29 97

Map