F428881

General Info

Members Datasets Scaffolds Average Seq Length
381 168 762 113

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100070459|Ga0070673_1000704592
Length 114
Sequence MKKIEAVIQPHKLEEVKNALSHIGIDGITVSEVSGHGHEQVPSIVFRGASYKPNGDFLSKIKVEIFVPDYLVQQVIGVISDAAMSGEIGDGKIFVSAIEEAVRIRNGDRGEDAL

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100070459 3300005364 Unclassified 2806
2 rootL2_10007760 3300003322 Bacteria 1213
3 Ga0070658_10006094 3300005327 Bacteria 9779
4 Ga0070658_10017356 3300005327 Bacteria 5760
5 Ga0070658_10036304 3300005327 Bacteria 3972
6 Ga0070658_10183365 3300005327 Unclassified 1762
7 Ga0070658_10226352 3300005327 Bacteria 1583
8 Ga0070683_100005522 3300005329 Bacteria 10564
9 Ga0070683_100625136 3300005329 Bacteria 1031
10 Ga0070683_100975891 3300005329 Bacteria 813
11 Ga0070690_100596430 3300005330 Bacteria 838
12 Ga0070666_10042982 3300005335 Unclassified 3024
13 Ga0070666_10247060 3300005335 Bacteria 1263
14 Ga0070680_100075178 3300005336 Bacteria 2781
15 Ga0070680_100203879 3300005336 Bacteria 1668
16 Ga0070680_100300544 3300005336 Unclassified 1361
17 Ga0070680_100334134 3300005336 Bacteria 1287
18 Ga0070682_100369341 3300005337 Bacteria 1075
19 Ga0070660_100013209 3300005339 Bacteria 5918
20 Ga0070660_100201304 3300005339 Bacteria 1615
21 Ga0070660_100310514 3300005339 Bacteria 1294
22 Ga0070660_100325573 3300005339 Bacteria 1263
23 Ga0070660_100366913 3300005339 Bacteria 1187
24 Ga0070660_100732261 3300005339 Bacteria 830
25 Ga0070689_100477107 3300005340 Bacteria 1065
26 Ga0070691_10190590 3300005341 Bacteria 1072
27 Ga0070661_100022308 3300005344 Bacteria 4532
28 Ga0070661_100226978 3300005344 Bacteria 1434
29 Ga0070669_101629500 3300005353 Unclassified 562
30 Ga0070675_100532430 3300005354 Bacteria 1061
31 Ga0070675_101458318 3300005354 Bacteria 631
32 Ga0070671_102069111 3300005355 Bacteria 507
33 Ga0070673_100651245 3300005364 Bacteria 964
34 Ga0070659_101996809 3300005366 Unclassified 521
35 Ga0070667_100143452 3300005367 Unclassified 2093
36 Ga0070667_100400863 3300005367 Bacteria 1249
37 Ga0070667_101997609 3300005367 Unclassified 546
38 Ga0070667_102054007 3300005367 Bacteria 538
39 Ga0070714_100097158 3300005435 Bacteria 2589
40 Ga0070714_100788662 3300005435 Bacteria 920
41 Ga0070713_101154054 3300005436 Bacteria 749
42 Ga0070711_100166795 3300005439 Bacteria 1675
43 Ga0070711_100211566 3300005439 Bacteria 1502
44 Ga0070711_100311904 3300005439 Bacteria 1254
45 Ga0070681_10226137 3300005458 Bacteria 1786
46 Ga0070681_10256296 3300005458 Bacteria 1661
47 Ga0070681_10348938 3300005458 Bacteria 1390
48 Ga0070681_10364403 3300005458 Bacteria 1355
49 Ga0070681_10922791 3300005458 Bacteria 792
50 Ga0068867_100026916 3300005459 Bacteria 4132
51 Ga0070685_10311986 3300005466 Bacteria 1063
52 Ga0070685_10361580 3300005466 Bacteria 995
53 Ga0070707_100548506 3300005468 Bacteria 1118
54 Ga0070679_100082130 3300005530 Unclassified 3213
55 Ga0070679_100238433 3300005530 Bacteria 1777
56 Ga0070679_100270014 3300005530 Bacteria 1655
57 Ga0070679_100574912 3300005530 Bacteria 1070
58 Ga0070679_101890770 3300005530 Bacteria 545
59 Ga0070684_100041299 3300005535 Bacteria 3976
60 Ga0070697_100513128 3300005536 Bacteria 1049
61 Ga0068853_100014131 3300005539 Bacteria 6536
62 Ga0068853_100156995 3300005539 Bacteria 2050
63 Ga0068853_100293916 3300005539 Bacteria 1500
64 Ga0070665_101552967 3300005548 Bacteria 670
65 Ga0068855_100018248 3300005563 Bacteria 8428
66 Ga0068855_100047607 3300005563 Bacteria 5065
67 Ga0068855_100133499 3300005563 Bacteria 2833
68 Ga0068855_100276625 3300005563 Unclassified 1866
69 Ga0068855_100327068 3300005563 Unclassified 1693
70 Ga0068855_100829898 3300005563 Bacteria 981
71 Ga0068857_100001850 3300005577 Bacteria 17044
72 Ga0068857_100161189 3300005577 Bacteria 2035
73 Ga0068854_101087565 3300005578 Bacteria 712
74 Ga0068856_100010845 3300005614 Bacteria 8846
75 Ga0068856_100011839 3300005614 Bacteria 8453
76 Ga0068856_100019253 3300005614 Bacteria 6626
77 Ga0068856_100091926 3300005614 Bacteria 3019
78 Ga0068856_100092540 3300005614 Bacteria 3009
79 Ga0068856_101835892 3300005614 Bacteria 618
80 Ga0068852_100052644 3300005616 Bacteria 3499
81 Ga0068852_100346806 3300005616 Bacteria 1449
82 Ga0068852_100869345 3300005616 Unclassified 918
83 Ga0068859_100851123 3300005617 Bacteria 998
84 Ga0068859_101305068 3300005617 Unclassified 800
85 Ga0068864_100895663 3300005618 Bacteria 876
86 Ga0068864_101582048 3300005618 Unclassified 659
87 Ga0068866_10975056 3300005718 Bacteria 601
88 Ga0068851_10408571 3300005834 Bacteria 800
89 Ga0068863_101269461 3300005841 Bacteria 743
90 Ga0068863_101712936 3300005841 Bacteria 638
91 Ga0068858_100032528 3300005842 Bacteria 4842
92 Ga0068858_100648727 3300005842 Bacteria 1026
93 Ga0068858_102363686 3300005842 Bacteria 525
94 Ga0068860_100006793 3300005843 Bacteria 11468
95 Ga0068862_102391825 3300005844 Bacteria 540
96 Ga0070717_10004137 3300006028 Bacteria 10461
97 Ga0070715_10114639 3300006163 Bacteria 1276
98 Ga0070716_100833249 3300006173 Bacteria 717
99 Ga0070712_100482910 3300006175 Bacteria 1036
100 Ga0070712_100938316 3300006175 Bacteria 747
101 Ga0097621_100066521 3300006237 Bacteria 2968
102 Ga0097621_100436750 3300006237 Unclassified 1177
103 Ga0068871_100034055 3300006358 Bacteria 4038
104 Ga0068871_100059813 3300006358 Bacteria 3105
105 Ga0068871_101422875 3300006358 Bacteria 654
106 Ga0068871_101481777 3300006358 Bacteria 641
107 Ga0068865_100006819 3300006881 Bacteria 6995
108 Ga0068865_100444999 3300006881 Unclassified 1070
109 Ga0097620_100851043 3300006931 Bacteria 998
110 Ga0097620_101305312 3300006931 Unclassified 800
111 Ga0105240_10000696 3300009093 Bacteria 61797
112 Ga0105240_10043865 3300009093 Bacteria 5687
113 Ga0105240_10214091 3300009093 Bacteria 2249
114 Ga0105240_10273865 3300009093 Bacteria 1942
115 Ga0105240_10308170 3300009093 Bacteria 1809
116 Ga0105240_10350309 3300009093 Bacteria 1675
117 Ga0105240_10384975 3300009093 Bacteria 1583
118 Ga0105240_11505743 3300009093 Bacteria 705
119 Ga0105245_10042189 3300009098 Bacteria 4070
120 Ga0105245_10178455 3300009098 Unclassified 2027
121 Ga0105245_12209958 3300009098 Bacteria 604
122 Ga0105247_10150081 3300009101 Bacteria 1535
123 Ga0114129_10078250 3300009147 Bacteria 4600
124 Ga0105243_10422507 3300009148 Bacteria 1244
125 Ga0105241_10003465 3300009174 Bacteria 11740
126 Ga0105241_10076343 3300009174 Bacteria 2613
127 Ga0105241_10153703 3300009174 Bacteria 1885
128 Ga0105241_10181921 3300009174 Bacteria 1744
129 Ga0105241_12291432 3300009174 Bacteria 537
130 Ga0105242_10014620 3300009176 Bacteria 6076
131 Ga0105242_10024207 3300009176 Bacteria 4793
132 Ga0105242_10031548 3300009176 Bacteria 4234
133 Ga0105242_11503656 3300009176 Bacteria 704
134 Ga0105248_10146242 3300009177 Unclassified 2667
135 Ga0105248_10567681 3300009177 Bacteria 1280
136 Ga0105248_10666398 3300009177 Bacteria 1174
137 Ga0105248_12001502 3300009177 Bacteria 658
138 Ga0105237_10000975 3300009545 Bacteria 38478
139 Ga0105237_10040430 3300009545 Bacteria 4702
140 Ga0105237_10196749 3300009545 Bacteria 2016
141 Ga0105237_10576495 3300009545 Bacteria 1132
142 Ga0105237_10732579 3300009545 Bacteria 995
143 Ga0105237_10839054 3300009545 Bacteria 926
144 Ga0105237_11203176 3300009545 Bacteria 764
145 Ga0105238_10013626 3300009551 Bacteria 8212
146 Ga0105238_10067936 3300009551 Bacteria 3565
147 Ga0105238_10310232 3300009551 Bacteria 1562
148 Ga0105238_11157139 3300009551 Bacteria 797
149 Ga0105238_13079150 3300009551 Bacteria 500
150 Ga0105239_10003349 3300010375 Bacteria 19691
151 Ga0105239_10025767 3300010375 Bacteria 6477
152 Ga0105239_10250223 3300010375 Bacteria 1990
153 Ga0105239_10841382 3300010375 Bacteria 1052
154 Ga0105239_11076210 3300010375 Bacteria 925
155 Ga0105239_11118379 3300010375 Bacteria 907
156 Ga0105239_11294241 3300010375 Bacteria 841
157 Ga0105239_11718911 3300010375 Bacteria 726
158 Ga0105246_11404002 3300011119 Bacteria 652
159 Ga0157373_10072403 3300013100 Bacteria 2433
160 Ga0157373_10747979 3300013100 Bacteria 718
161 Ga0157370_10020122 3300013104 Bacteria 6673
162 Ga0157370_10220764 3300013104 Bacteria 1755
163 Ga0157370_10479657 3300013104 Unclassified 1143
164 Ga0157370_10591810 3300013104 Bacteria 1016
165 Ga0157370_11071104 3300013104 Bacteria 729
166 Ga0157370_12029183 3300013104 Bacteria 516
167 Ga0157369_10001712 3300013105 Bacteria 26704
168 Ga0157369_10074375 3300013105 Bacteria 3643
169 Ga0157369_10293684 3300013105 Unclassified 1692
170 Ga0157369_10365309 3300013105 Bacteria 1498
171 Ga0157369_10828959 3300013105 Unclassified 950
172 Ga0157369_10874859 3300013105 Bacteria 922
173 Ga0157374_10002888 3300013296 Bacteria 14404
174 Ga0157374_10032279 3300013296 Bacteria 4766
175 Ga0157374_10105841 3300013296 Bacteria 2702
176 Ga0157374_10928510 3300013296 Bacteria 888
177 Ga0157374_11072474 3300013296 Bacteria 826
178 Ga0157378_10023244 3300013297 Bacteria 5456
179 Ga0157378_10168087 3300013297 Bacteria 2055
180 Ga0157378_11276287 3300013297 Bacteria 775
181 Ga0157378_12206721 3300013297 Bacteria 602
182 Ga0163162_10205976 3300013306 Bacteria 2096
183 Ga0163162_10374593 3300013306 Bacteria 1557
184 Ga0163162_12569087 3300013306 Bacteria 586
185 Ga0157372_10281466 3300013307 Bacteria 1934
186 Ga0157372_10302390 3300013307 Bacteria 1861
187 Ga0157372_10315633 3300013307 Unclassified 1819
188 Ga0157372_10374233 3300013307 Bacteria 1660
189 Ga0157372_11018283 3300013307 Bacteria 959
190 Ga0157372_11212820 3300013307 Unclassified 872
191 Ga0157372_11355657 3300013307 Bacteria 820
192 Ga0157375_11362394 3300013308 Bacteria 835
193 Ga0157375_11481921 3300013308 Bacteria 801
194 Ga0157375_11868600 3300013308 Bacteria 713
195 Ga0157375_12493468 3300013308 Bacteria 617
196 Ga0163163_10072293 3300014325 Bacteria 3438
197 Ga0163163_10089649 3300014325 Bacteria 3088
198 Ga0163163_10130272 3300014325 Bacteria 2555
199 Ga0163163_10657939 3300014325 Bacteria 1111
200 Ga0163163_10962675 3300014325 Unclassified 917
201 Ga0157379_10016191 3300014968 Bacteria 6560
202 Ga0157376_10103772 3300014969 Bacteria 2490
203 Ga0157376_10173733 3300014969 Bacteria 1964
204 Ga0157376_10346833 3300014969 Bacteria 1420
205 Ga0157376_10539614 3300014969 Unclassified 1152
206 Ga0207692_10837580 3300025898 Unclassified 603
207 Ga0207710_10155617 3300025900 Bacteria 1111
208 Ga0207680_10044657 3300025903 Unclassified 2608
209 Ga0207680_10559847 3300025903 Bacteria 816
210 Ga0207685_10507614 3300025905 Bacteria 635
211 Ga0207705_10025839 3300025909 Bacteria 4190
212 Ga0207705_10032711 3300025909 Unclassified 3717
213 Ga0207705_10360256 3300025909 Unclassified 1121
214 Ga0207705_10510566 3300025909 Bacteria 934
215 Ga0207705_10673556 3300025909 Bacteria 804
216 Ga0207654_10017588 3300025911 Bacteria 3741
217 Ga0207654_10287092 3300025911 Bacteria 1114
218 Ga0207707_10019875 3300025912 Bacteria 5861
219 Ga0207707_10304976 3300025912 Bacteria 1376
220 Ga0207707_10515501 3300025912 Bacteria 1019
221 Ga0207707_10749805 3300025912 Bacteria 817
222 Ga0207707_10811773 3300025912 Bacteria 779
223 Ga0207695_10003044 3300025913 Bacteria 24027
224 Ga0207695_10004975 3300025913 Bacteria 17889
225 Ga0207695_10185137 3300025913 Bacteria 2002
226 Ga0207695_10246818 3300025913 Unclassified 1685
227 Ga0207695_10542490 3300025913 Bacteria 1044
228 Ga0207695_10683311 3300025913 Bacteria 907
229 Ga0207695_10894808 3300025913 Bacteria 767
230 Ga0207695_11747623 3300025913 Bacteria 503
231 Ga0207671_10025405 3300025914 Bacteria 4449
232 Ga0207671_10029286 3300025914 Bacteria 4111
233 Ga0207671_10085212 3300025914 Bacteria 2374
234 Ga0207671_10411144 3300025914 Bacteria 1076
235 Ga0207671_10838226 3300025914 Bacteria 728
236 Ga0207663_10175742 3300025916 Bacteria 1525
237 Ga0207663_10190302 3300025916 Bacteria 1473
238 Ga0207663_10391299 3300025916 Bacteria 1061
239 Ga0207663_11134305 3300025916 Unclassified 629
240 Ga0207660_10122787 3300025917 Bacteria 1969
241 Ga0207657_10001436 3300025919 Bacteria 25465
242 Ga0207657_10108238 3300025919 Bacteria 2298
243 Ga0207657_10459701 3300025919 Bacteria 998
244 Ga0207657_10500878 3300025919 Bacteria 951
245 Ga0207649_10042405 3300025920 Bacteria 2776
246 Ga0207649_10170976 3300025920 Bacteria 1514
247 Ga0207652_10163458 3300025921 Bacteria 1996
248 Ga0207652_10236070 3300025921 Bacteria 1648
249 Ga0207652_10821716 3300025921 Bacteria 824
250 Ga0207652_11156430 3300025921 Bacteria 675
251 Ga0207694_10027563 3300025924 Bacteria 4327
252 Ga0207694_10226582 3300025924 Bacteria 1526
253 Ga0207694_10924685 3300025924 Bacteria 738
254 Ga0207694_11255125 3300025924 Bacteria 627
255 Ga0207694_11892590 3300025924 Bacteria 500
256 Ga0207659_10727868 3300025926 Bacteria 850
257 Ga0207687_10004585 3300025927 Bacteria 9194
258 Ga0207687_10035895 3300025927 Bacteria 3375
259 Ga0207687_11748898 3300025927 Bacteria 533
260 Ga0207700_10550753 3300025928 Bacteria 1024
261 Ga0207664_10152521 3300025929 Bacteria 1964
262 Ga0207664_11914790 3300025929 Bacteria 516
263 Ga0207644_10956324 3300025931 Unclassified 718
264 Ga0207690_11120842 3300025932 Unclassified 656
265 Ga0207686_10013366 3300025934 Bacteria 4540
266 Ga0207686_10057802 3300025934 Bacteria 2443
267 Ga0207686_10236924 3300025934 Bacteria 1326
268 Ga0207704_10086151 3300025938 Bacteria 2048
269 Ga0207704_11545424 3300025938 Bacteria 570
270 Ga0207711_10088754 3300025941 Unclassified 2715
271 Ga0207689_10216148 3300025942 Bacteria 1584
272 Ga0207689_11463966 3300025942 Bacteria 571
273 Ga0207661_10003687 3300025944 Bacteria 10676
274 Ga0207661_10260117 3300025944 Bacteria 1546
275 Ga0207661_10554062 3300025944 Bacteria 1053
276 Ga0207667_10015759 3300025949 Bacteria 8571
277 Ga0207667_10030648 3300025949 Bacteria 5815
278 Ga0207667_10037793 3300025949 Bacteria 5160
279 Ga0207667_10048692 3300025949 Bacteria 4480
280 Ga0207667_10058650 3300025949 Bacteria 4036
281 Ga0207667_10154580 3300025949 Unclassified 2361
282 Ga0207651_10304575 3300025960 Bacteria 1326
283 Ga0207651_10576311 3300025960 Bacteria 981
284 Ga0207640_10288746 3300025981 Bacteria 1292
285 Ga0207658_10167103 3300025986 Unclassified 1808
286 Ga0207658_10255865 3300025986 Bacteria 1490
287 Ga0207658_11876664 3300025986 Bacteria 546
288 Ga0207703_10043997 3300026035 Bacteria 3586
289 Ga0207703_11395303 3300026035 Bacteria 674
290 Ga0207639_10005957 3300026041 Bacteria 8269
291 Ga0207639_10142498 3300026041 Bacteria 1998
292 Ga0207639_11355019 3300026041 Bacteria 668
293 Ga0207702_10010883 3300026078 Bacteria 7588
294 Ga0207702_10067276 3300026078 Bacteria 3074
295 Ga0207702_10083092 3300026078 Bacteria 2786
296 Ga0207702_10343813 3300026078 Bacteria 1426
297 Ga0207702_11564254 3300026078 Bacteria 653
298 Ga0207641_10467981 3300026088 Unclassified 1220
299 Ga0207641_11052887 3300026088 Bacteria 811
300 Ga0207641_11112160 3300026088 Bacteria 789
301 Ga0207641_11255092 3300026088 Bacteria 741
302 Ga0207648_10042311 3300026089 Bacteria 3998
303 Ga0207676_10845238 3300026095 Bacteria 895
304 Ga0207676_10962719 3300026095 Bacteria 840
305 Ga0207676_10992863 3300026095 Bacteria 827
306 Ga0207676_12318051 3300026095 Bacteria 534
307 Ga0207674_10002600 3300026116 Bacteria 22678
308 Ga0207674_10118942 3300026116 Bacteria 2612
309 Ga0207674_10846791 3300026116 Bacteria 882
310 Ga0207683_10574599 3300026121 Bacteria 1043
311 Ga0207683_12049908 3300026121 Bacteria 520
312 Ga0207698_10033466 3300026142 Bacteria 3735
313 Ga0207698_11002574 3300026142 Bacteria 846
314 Ga0207698_11120385 3300026142 Bacteria 800
315 Ga0268266_10157917 3300028379 Bacteria 2050
316 Ga0268264_10016991 3300028381 Bacteria 5957
317 Ga0268264_11802982 3300028381 Bacteria 622
318 Ga0265316_10750139 3300031344 Bacteria 686
319 Ga0265313_10002209 3300031595 Bacteria 17167
320 Ga0265313_10084009 3300031595 Bacteria 1441
321 Ga0316575_10312540 3300031665 Bacteria 666
322 Ga0265314_10000941 3300031711 Bacteria 34248
323 Ga0316576_10241720 3300031727 Bacteria 1356
324 Ga0316592_1044912 3300033524 Bacteria 982
325 Ga0316596_1046530 3300033541 Bacteria 1146
326 Ga0373926_0010987 3300035083 Bacteria 3041
327 Ga0373939_0001244 3300035114 Bacteria 6229
328 Ga0373943_0462245 3300035170 Bacteria 738
329 Ga0373943_0635188 3300035170 Bacteria 630
330 Ga0373946_0017013 3300035171 Bacteria 2777
331 Ga0373955_0823703 3300035172 Bacteria 571
332 Ga0373942_0133452 3300035207 Bacteria 785
333 Ga0316574_0032690 3300035398 Bacteria 3162
334 Ga0373927_0002125 3300035695 Bacteria 14601
335 Ga0373933_0250876 3300035724 Unclassified 1140
336 Ga0373947_0008342 3300035725 Bacteria 5967
337 Ga0373937_0064003 3300036401 Bacteria 3383
338 Ga0373937_0247104 3300036401 Bacteria 1682
339 Ga0373937_0311487 3300036401 Bacteria 1489
340 Ga0316582_0611224 3300036647 Bacteria 750
341 Ga0316584_0607424 3300036712 Bacteria 758
342 Ga0436364_0574400 3300037853 Bacteria 919
343 Ga0466957_0178076 3300044842 Bacteria 1388
344 Ga0466959_0168663 3300045049 Bacteria 1536
345 Ga0495592_0844492 3300046454 Bacteria 541
346 Ga0495603_0639133 3300046455 Bacteria 609
347 Ga0495653_0252167 3300046463 Bacteria 1171
348 Ga0495580_0003758 3300046472 Bacteria 12850
349 Ga0495582_0747679 3300046473 Bacteria 566
350 Ga0495664_0118180 3300046477 Bacteria 1603
351 Ga0495594_0383226 3300046499 Bacteria 800
352 Ga0495618_0780619 3300046514 Bacteria 557
353 Ga0495630_0580514 3300046517 Bacteria 859
354 Ga0495652_0391676 3300046529 Bacteria 986
355 Ga0495665_0207747 3300046531 Bacteria 1014
356 Ga0495640_0079630 3300046533 Bacteria 2181
357 Ga0495640_0198108 3300046533 Bacteria 1274
358 Ga0495667_0072599 3300046559 Bacteria 2243
359 Ga0495635_0469434 3300046663 Bacteria 831
360 Ga0495599_0643268 3300046678 Bacteria 615
361 Ga0495623_0211431 3300046679 Bacteria 1110
362 Ga0495623_0245194 3300046679 Bacteria 1010
363 Ga0495646_0481255 3300046680 Bacteria 639
364 Ga0495624_0335480 3300046690 Bacteria 910
365 Ga0495604_0364058 3300047317 Bacteria 958
366 Ga0495604_0707907 3300047317 Bacteria 639
367 Ga0495636_0436640 3300047318 Bacteria 627
368 Ga0495674_0017116 3300047319 Bacteria 6751
369 Ga0495674_0955037 3300047319 Bacteria 659
370 Ga0495684_0094855 3300047471 Bacteria 2259
371 Ga0495602_0150758 3300048088 Bacteria 1828
372 Ga0496102_0550012 3300048905 Bacteria 1077
373 Ga0496112_0467570 3300048915 Bacteria 1198
374 Ga0496115_0139782 3300048918 Bacteria 1998
375 Ga0496115_0463504 3300048918 Bacteria 1022
376 nmdc:mga05p37_228025_c1 3300050507 Bacteria 2245
377 nmdc:mga06r32_311224_c1 3300050510 Bacteria 1560
378 Ga0587073_0086447 3300059492 Bacteria 789
379 Ga0587083_0106406 3300059505 Bacteria 706
380 Ga0587075_003816 3300059644 Bacteria 1710
381 Ga0587075_021668 3300059644 Bacteria 959
382 Ga0070673_100070459
383 rootL2_10007760
384 Ga0070658_10006094
385 Ga0070658_10017356
386 Ga0070658_10036304
387 Ga0070658_10183365
388 Ga0070658_10226352
389 Ga0070683_100005522
390 Ga0070683_100625136
391 Ga0070683_100975891
392 Ga0070690_100596430
393 Ga0070666_10042982
394 Ga0070666_10247060
395 Ga0070680_100075178
396 Ga0070680_100203879
397 Ga0070680_100300544
398 Ga0070680_100334134
399 Ga0070682_100369341
400 Ga0070660_100013209
401 Ga0070660_100201304
402 Ga0070660_100310514
403 Ga0070660_100325573
404 Ga0070660_100366913
405 Ga0070660_100732261
406 Ga0070689_100477107
407 Ga0070691_10190590
408 Ga0070661_100022308
409 Ga0070661_100226978
410 Ga0070669_101629500
411 Ga0070675_100532430
412 Ga0070675_101458318
413 Ga0070671_102069111
414 Ga0070673_100651245
415 Ga0070659_101996809
416 Ga0070667_100143452
417 Ga0070667_100400863
418 Ga0070667_101997609
419 Ga0070667_102054007
420 Ga0070714_100097158
421 Ga0070714_100788662
422 Ga0070713_101154054
423 Ga0070711_100166795
424 Ga0070711_100211566
425 Ga0070711_100311904
426 Ga0070681_10226137
427 Ga0070681_10256296
428 Ga0070681_10348938
429 Ga0070681_10364403
430 Ga0070681_10922791
431 Ga0068867_100026916
432 Ga0070685_10311986
433 Ga0070685_10361580
434 Ga0070707_100548506
435 Ga0070679_100082130
436 Ga0070679_100238433
437 Ga0070679_100270014
438 Ga0070679_100574912
439 Ga0070679_101890770
440 Ga0070684_100041299
441 Ga0070697_100513128
442 Ga0068853_100014131
443 Ga0068853_100156995
444 Ga0068853_100293916
445 Ga0070665_101552967
446 Ga0068855_100018248
447 Ga0068855_100047607
448 Ga0068855_100133499
449 Ga0068855_100276625
450 Ga0068855_100327068
451 Ga0068855_100829898
452 Ga0068857_100001850
453 Ga0068857_100161189
454 Ga0068854_101087565
455 Ga0068856_100010845
456 Ga0068856_100011839
457 Ga0068856_100019253
458 Ga0068856_100091926
459 Ga0068856_100092540
460 Ga0068856_101835892
461 Ga0068852_100052644
462 Ga0068852_100346806
463 Ga0068852_100869345
464 Ga0068859_100851123
465 Ga0068859_101305068
466 Ga0068864_100895663
467 Ga0068864_101582048
468 Ga0068866_10975056
469 Ga0068851_10408571
470 Ga0068863_101269461
471 Ga0068863_101712936
472 Ga0068858_100032528
473 Ga0068858_100648727
474 Ga0068858_102363686
475 Ga0068860_100006793
476 Ga0068862_102391825
477 Ga0070717_10004137
478 Ga0070715_10114639
479 Ga0070716_100833249
480 Ga0070712_100482910
481 Ga0070712_100938316
482 Ga0097621_100066521
483 Ga0097621_100436750
484 Ga0068871_100034055
485 Ga0068871_100059813
486 Ga0068871_101422875
487 Ga0068871_101481777
488 Ga0068865_100006819
489 Ga0068865_100444999
490 Ga0097620_100851043
491 Ga0097620_101305312
492 Ga0105240_10000696
493 Ga0105240_10043865
494 Ga0105240_10214091
495 Ga0105240_10273865
496 Ga0105240_10308170
497 Ga0105240_10350309
498 Ga0105240_10384975
499 Ga0105240_11505743
500 Ga0105245_10042189
501 Ga0105245_10178455
502 Ga0105245_12209958
503 Ga0105247_10150081
504 Ga0114129_10078250
505 Ga0105243_10422507
506 Ga0105241_10003465
507 Ga0105241_10076343
508 Ga0105241_10153703
509 Ga0105241_10181921
510 Ga0105241_12291432
511 Ga0105242_10014620
512 Ga0105242_10024207
513 Ga0105242_10031548
514 Ga0105242_11503656
515 Ga0105248_10146242
516 Ga0105248_10567681
517 Ga0105248_10666398
518 Ga0105248_12001502
519 Ga0105237_10000975
520 Ga0105237_10040430
521 Ga0105237_10196749
522 Ga0105237_10576495
523 Ga0105237_10732579
524 Ga0105237_10839054
525 Ga0105237_11203176
526 Ga0105238_10013626
527 Ga0105238_10067936
528 Ga0105238_10310232
529 Ga0105238_11157139
530 Ga0105238_13079150
531 Ga0105239_10003349
532 Ga0105239_10025767
533 Ga0105239_10250223
534 Ga0105239_10841382
535 Ga0105239_11076210
536 Ga0105239_11118379
537 Ga0105239_11294241
538 Ga0105239_11718911
539 Ga0105246_11404002
540 Ga0157373_10072403
541 Ga0157373_10747979
542 Ga0157370_10020122
543 Ga0157370_10220764
544 Ga0157370_10479657
545 Ga0157370_10591810
546 Ga0157370_11071104
547 Ga0157370_12029183
548 Ga0157369_10001712
549 Ga0157369_10074375
550 Ga0157369_10293684
551 Ga0157369_10365309
552 Ga0157369_10828959
553 Ga0157369_10874859
554 Ga0157374_10002888
555 Ga0157374_10032279
556 Ga0157374_10105841
557 Ga0157374_10928510
558 Ga0157374_11072474
559 Ga0157378_10023244
560 Ga0157378_10168087
561 Ga0157378_11276287
562 Ga0157378_12206721
563 Ga0163162_10205976
564 Ga0163162_10374593
565 Ga0163162_12569087
566 Ga0157372_10281466
567 Ga0157372_10302390
568 Ga0157372_10315633
569 Ga0157372_10374233
570 Ga0157372_11018283
571 Ga0157372_11212820
572 Ga0157372_11355657
573 Ga0157375_11362394
574 Ga0157375_11481921
575 Ga0157375_11868600
576 Ga0157375_12493468
577 Ga0163163_10072293
578 Ga0163163_10089649
579 Ga0163163_10130272
580 Ga0163163_10657939
581 Ga0163163_10962675
582 Ga0157379_10016191
583 Ga0157376_10103772
584 Ga0157376_10173733
585 Ga0157376_10346833
586 Ga0157376_10539614
587 Ga0207692_10837580
588 Ga0207710_10155617
589 Ga0207680_10044657
590 Ga0207680_10559847
591 Ga0207685_10507614
592 Ga0207705_10025839
593 Ga0207705_10032711
594 Ga0207705_10360256
595 Ga0207705_10510566
596 Ga0207705_10673556
597 Ga0207654_10017588
598 Ga0207654_10287092
599 Ga0207707_10019875
600 Ga0207707_10304976
601 Ga0207707_10515501
602 Ga0207707_10749805
603 Ga0207707_10811773
604 Ga0207695_10003044
605 Ga0207695_10004975
606 Ga0207695_10185137
607 Ga0207695_10246818
608 Ga0207695_10542490
609 Ga0207695_10683311
610 Ga0207695_10894808
611 Ga0207695_11747623
612 Ga0207671_10025405
613 Ga0207671_10029286
614 Ga0207671_10085212
615 Ga0207671_10411144
616 Ga0207671_10838226
617 Ga0207663_10175742
618 Ga0207663_10190302
619 Ga0207663_10391299
620 Ga0207663_11134305
621 Ga0207660_10122787
622 Ga0207657_10001436
623 Ga0207657_10108238
624 Ga0207657_10459701
625 Ga0207657_10500878
626 Ga0207649_10042405
627 Ga0207649_10170976
628 Ga0207652_10163458
629 Ga0207652_10236070
630 Ga0207652_10821716
631 Ga0207652_11156430
632 Ga0207694_10027563
633 Ga0207694_10226582
634 Ga0207694_10924685
635 Ga0207694_11255125
636 Ga0207694_11892590
637 Ga0207659_10727868
638 Ga0207687_10004585
639 Ga0207687_10035895
640 Ga0207687_11748898
641 Ga0207700_10550753
642 Ga0207664_10152521
643 Ga0207664_11914790
644 Ga0207644_10956324
645 Ga0207690_11120842
646 Ga0207686_10013366
647 Ga0207686_10057802
648 Ga0207686_10236924
649 Ga0207704_10086151
650 Ga0207704_11545424
651 Ga0207711_10088754
652 Ga0207689_10216148
653 Ga0207689_11463966
654 Ga0207661_10003687
655 Ga0207661_10260117
656 Ga0207661_10554062
657 Ga0207667_10015759
658 Ga0207667_10030648
659 Ga0207667_10037793
660 Ga0207667_10048692
661 Ga0207667_10058650
662 Ga0207667_10154580
663 Ga0207651_10304575
664 Ga0207651_10576311
665 Ga0207640_10288746
666 Ga0207658_10167103
667 Ga0207658_10255865
668 Ga0207658_11876664
669 Ga0207703_10043997
670 Ga0207703_11395303
671 Ga0207639_10005957
672 Ga0207639_10142498
673 Ga0207639_11355019
674 Ga0207702_10010883
675 Ga0207702_10067276
676 Ga0207702_10083092
677 Ga0207702_10343813
678 Ga0207702_11564254
679 Ga0207641_10467981
680 Ga0207641_11052887
681 Ga0207641_11112160
682 Ga0207641_11255092
683 Ga0207648_10042311
684 Ga0207676_10845238
685 Ga0207676_10962719
686 Ga0207676_10992863
687 Ga0207676_12318051
688 Ga0207674_10002600
689 Ga0207674_10118942
690 Ga0207674_10846791
691 Ga0207683_10574599
692 Ga0207683_12049908
693 Ga0207698_10033466
694 Ga0207698_11002574
695 Ga0207698_11120385
696 Ga0268266_10157917
697 Ga0268264_10016991
698 Ga0268264_11802982
699 Ga0265316_10750139
700 Ga0265313_10002209
701 Ga0265313_10084009
702 Ga0316575_10312540
703 Ga0265314_10000941
704 Ga0316576_10241720
705 Ga0316592_1044912
706 Ga0316596_1046530
707 Ga0373926_0010987
708 Ga0373939_0001244
709 Ga0373943_0462245
710 Ga0373943_0635188
711 Ga0373946_0017013
712 Ga0373955_0823703
713 Ga0373942_0133452
714 Ga0316574_0032690
715 Ga0373927_0002125
716 Ga0373933_0250876
717 Ga0373947_0008342
718 Ga0373937_0064003
719 Ga0373937_0247104
720 Ga0373937_0311487
721 Ga0316582_0611224
722 Ga0316584_0607424
723 Ga0436364_0574400
724 Ga0466957_0178076
725 Ga0466959_0168663
726 Ga0495592_0844492
727 Ga0495603_0639133
728 Ga0495653_0252167
729 Ga0495580_0003758
730 Ga0495582_0747679
731 Ga0495664_0118180
732 Ga0495594_0383226
733 Ga0495618_0780619
734 Ga0495630_0580514
735 Ga0495652_0391676
736 Ga0495665_0207747
737 Ga0495640_0079630
738 Ga0495640_0198108
739 Ga0495667_0072599
740 Ga0495635_0469434
741 Ga0495599_0643268
742 Ga0495623_0211431
743 Ga0495623_0245194
744 Ga0495646_0481255
745 Ga0495624_0335480
746 Ga0495604_0364058
747 Ga0495604_0707907
748 Ga0495636_0436640
749 Ga0495674_0017116
750 Ga0495674_0955037
751 Ga0495684_0094855
752 Ga0495602_0150758
753 Ga0496102_0550012
754 Ga0496112_0467570
755 Ga0496115_0139782
756 Ga0496115_0463504
757 nmdc:mga05p37_228025_c1
758 nmdc:mga06r32_311224_c1
759 Ga0587073_0086447
760 Ga0587083_0106406
761 Ga0587075_003816
762 Ga0587075_021668

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

1

108

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vfj-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9841 1 108
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9832 1 112
1v3r-assembly1.cif.gz_B crystal structure of tt1020 from thermus thermophilus hb8 0.982 1 108
1hwu-assembly3.cif.gz_C structure of pii protein from herbaspirillum seropedicae 0.9811 1 112
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9807 1 108
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9616 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9555 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.952 1 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9448 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9076 2 108 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A1Q4DS82-F1-model_v4 Transcriptional regulator 0.9687 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1Q4DS82-F1-model_v4 Transcriptional regulator 0.9586 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9515 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A2W4Q7H0-F1-model_v4 P-II family nitrogen regulator 0.944 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9423 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map