F428026

General Info

Members Datasets Scaffolds Average Seq Length
378 227 756 318

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10160735|Ga0157375_101607352
Length 371
Sequence MTQSGHEAAAFAAPKIVPRSKMACYALLTILGLGTEHMRRREFIAVVAGGAAGWALVARARAAQGPERIRKIGMLLNFQSQDPEGEERVKAFVQALQKLGWTQSGNVRIEMRWAGDDADRYRRYSEELIALEPDVILAAASPSVAALQWVNHTVPIVFANVIDPVGGGFVNSLARPGGNTTGFTAFEYSISGKWLELLKEFVPDLKRVAVVREPSLPAGIGQFAAIQTMASASSSGVELSAIDPRDAHGIERAFAAFAHQPNGGVIVTAGSXXSTHRKLIISLSTLHRLPTVYPFRYFTANGGLASYGPDGNDVYTRVATYVDRILKGEKPADLPVQAPIQYELVINLKTAKALGLTVPPTVLARADEVIE

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 12.43
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10160735 3300013308 Unclassified 2388
2 JGI24743J22301_10001720 3300001991 Bacteria 3129
3 JGI24738J21930_10014654 3300002075 Bacteria 1680
4 JGI24744J21845_10012963 3300002077 Bacteria 1684
5 Ga0070683_100202961 3300005329 Bacteria 1883
6 Ga0070690_100251040 3300005330 Bacteria 1251
7 Ga0068869_100034745 3300005334 Bacteria 3568
8 Ga0068868_100072564 3300005338 Bacteria 2746
9 Ga0070660_100156636 3300005339 Bacteria 1834
10 Ga0070689_100080224 3300005340 Bacteria 2561
11 Ga0070691_10032728 3300005341 Bacteria 2444
12 Ga0070687_100127874 3300005343 Bacteria 1463
13 Ga0070692_10082187 3300005345 Bacteria 1737
14 Ga0070668_100128407 3300005347 Bacteria 2032
15 Ga0070668_100426535 3300005347 Bacteria 1136
16 Ga0070669_100351750 3300005353 Bacteria 1196
17 Ga0070675_100025747 3300005354 Bacteria 4717
18 Ga0070671_100016422 3300005355 Bacteria 5987
19 Ga0070674_100021463 3300005356 Bacteria 4146
20 Ga0070659_100219174 3300005366 Bacteria 1570
21 Ga0070667_100194594 3300005367 Bacteria 1797
22 Ga0070709_10066212 3300005434 Bacteria 2316
23 Ga0070714_100014085 3300005435 Bacteria 6418
24 Ga0070714_100329346 3300005435 Bacteria 1430
25 Ga0070713_100109232 3300005436 Bacteria 2409
26 Ga0070710_10001212 3300005437 Bacteria 12203
27 Ga0070710_10158474 3300005437 Bacteria 1402
28 Ga0070711_100088401 3300005439 Bacteria 2226
29 Ga0070711_100162671 3300005439 Bacteria 1693
30 Ga0070711_100193050 3300005439 Bacteria 1566
31 Ga0070711_100241361 3300005439 Bacteria 1413
32 Ga0070700_100009020 3300005441 Bacteria 5462
33 Ga0070694_100039166 3300005444 Bacteria 3154
34 Ga0070708_100158612 3300005445 Bacteria 2107
35 Ga0070678_100216676 3300005456 Bacteria 1589
36 Ga0068867_100036936 3300005459 Bacteria 3549
37 Ga0070685_10042484 3300005466 Bacteria 2594
38 Ga0070706_100092852 3300005467 Bacteria 2800
39 Ga0070707_100413373 3300005468 Bacteria 1309
40 Ga0070684_100202989 3300005535 Bacteria 1806
41 Ga0070697_100039481 3300005536 Bacteria 3816
42 Ga0070672_100108343 3300005543 Bacteria 2262
43 Ga0070686_100238971 3300005544 Bacteria 1321
44 Ga0070665_100079871 3300005548 Bacteria 3276
45 Ga0070665_100280421 3300005548 Bacteria 1668
46 Ga0068852_100021454 3300005616 Bacteria 5158
47 Ga0068859_100496450 3300005617 Bacteria 1316
48 Ga0068864_100015205 3300005618 Bacteria 6401
49 Ga0068866_10014863 3300005718 Bacteria 3446
50 Ga0068861_100005869 3300005719 Bacteria 8344
51 Ga0068870_10005566 3300005840 Bacteria 5503
52 Ga0068863_100075716 3300005841 Bacteria 3184
53 Ga0068858_100010246 3300005842 Bacteria 8893
54 Ga0068858_100182224 3300005842 Bacteria 1983
55 Ga0068860_100260731 3300005843 Bacteria 1689
56 Ga0068862_100043129 3300005844 Bacteria 3845
57 Ga0081455_10063079 3300005937 Bacteria 3111
58 Ga0081540_1029008 3300005983 Bacteria 3092
59 Ga0081540_1031358 3300005983 Bacteria 2924
60 Ga0081539_10026790 3300005985 Bacteria 3665
61 Ga0070717_10057127 3300006028 Bacteria 3225
62 Ga0070717_10122792 3300006028 Bacteria 2227
63 Ga0070717_10128136 3300006028 Bacteria 2180
64 Ga0075365_10039309 3300006038 Bacteria 3080
65 Ga0075365_10109357 3300006038 Bacteria 1899
66 Ga0070715_10036672 3300006163 Bacteria 2024
67 Ga0070716_100054047 3300006173 Bacteria 2292
68 Ga0070712_100132264 3300006175 Bacteria 1892
69 Ga0070712_100174856 3300006175 Bacteria 1669
70 Ga0070712_100282505 3300006175 Bacteria 1337
71 Ga0070712_100419417 3300006175 Bacteria 1109
72 Ga0075366_10017914 3300006195 Bacteria 4086
73 Ga0097621_100047703 3300006237 Bacteria 3472
74 Ga0068871_100172396 3300006358 Bacteria 1855
75 Ga0075434_100153104 3300006871 Bacteria 2326
76 Ga0068865_100022944 3300006881 Bacteria 4079
77 Ga0097620_100496438 3300006931 Bacteria 1316
78 Ga0075435_100228265 3300007076 Bacteria 1581
79 Ga0075435_100242695 3300007076 Bacteria 1532
80 Ga0105240_10082326 3300009093 Bacteria 3953
81 Ga0111539_10018678 3300009094 Bacteria 8586
82 Ga0111539_10782897 3300009094 Bacteria 1110
83 Ga0105245_10057543 3300009098 Bacteria 3497
84 Ga0105245_10133837 3300009098 Bacteria 2328
85 Ga0105247_10101005 3300009101 Bacteria 1844
86 Ga0114129_10354384 3300009147 Bacteria 1943
87 Ga0114129_10572818 3300009147 Bacteria 1466
88 Ga0114129_10690823 3300009147 Bacteria 1312
89 Ga0105243_10036442 3300009148 Bacteria 3818
90 Ga0105243_10561497 3300009148 Bacteria 1092
91 Ga0105242_10060498 3300009176 Bacteria 3112
92 Ga0105242_10606942 3300009176 Bacteria 1058
93 Ga0105248_10086849 3300009177 Bacteria 3520
94 Ga0105248_10159769 3300009177 Bacteria 2542
95 Ga0105248_10255097 3300009177 Bacteria 1974
96 Ga0105248_10308702 3300009177 Bacteria 1781
97 Ga0105237_10079249 3300009545 Bacteria 3275
98 Ga0105249_10061138 3300009553 Bacteria 3457
99 Ga0105249_10537094 3300009553 Bacteria 1218
100 Ga0105246_10006290 3300011119 Bacteria 7247
101 Ga0157374_10043694 3300013296 Bacteria 4141
102 Ga0157374_10131041 3300013296 Bacteria 2427
103 Ga0157378_10052121 3300013297 Bacteria 3640
104 Ga0163162_10240476 3300013306 Bacteria 1941
105 Ga0163162_10701344 3300013306 Bacteria 1134
106 Ga0157375_10012191 3300013308 Bacteria 7619
107 Ga0163163_10038928 3300014325 Bacteria 4637
108 Ga0163163_10145082 3300014325 Bacteria 2417
109 Ga0157380_10043365 3300014326 Bacteria 3522
110 Ga0157380_10529256 3300014326 Bacteria 1151
111 Ga0157377_10007329 3300014745 Bacteria 5320
112 Ga0157377_10284185 3300014745 Bacteria 1086
113 Ga0157379_10013143 3300014968 Bacteria 7250
114 Ga0157379_10050510 3300014968 Bacteria 3712
115 Ga0157376_10050626 3300014969 Bacteria 3447
116 Ga0163161_10034925 3300017792 Bacteria 3597
117 Ga0163161_10140088 3300017792 Bacteria 1831
118 Ga0224572_1009177 3300024225 Bacteria 1841
119 Ga0207692_10018174 3300025898 Bacteria 3151
120 Ga0207642_10100591 3300025899 Bacteria 1450
121 Ga0207710_10033609 3300025900 Bacteria 2250
122 Ga0207688_10003933 3300025901 Bacteria 8098
123 Ga0207688_10076144 3300025901 Bacteria 1910
124 Ga0207688_10252569 3300025901 Bacteria 1068
125 Ga0207647_10085202 3300025904 Bacteria 1890
126 Ga0207699_10031071 3300025906 Bacteria 2995
127 Ga0207643_10000935 3300025908 Bacteria 17500
128 Ga0207684_10196054 3300025910 Bacteria 1742
129 Ga0207695_10184338 3300025913 Unclassified 2007
130 Ga0207671_10232512 3300025914 Bacteria 1446
131 Ga0207693_10029079 3300025915 Bacteria 4368
132 Ga0207693_10184831 3300025915 Bacteria 1641
133 Ga0207693_10297411 3300025915 Bacteria 1265
134 Ga0207663_10025780 3300025916 Bacteria 3404
135 Ga0207663_10211341 3300025916 Bacteria 1406
136 Ga0207662_10099197 3300025918 Bacteria 1803
137 Ga0207657_10191498 3300025919 Bacteria 1650
138 Ga0207659_10219383 3300025926 Bacteria 1528
139 Ga0207687_10072070 3300025927 Bacteria 2470
140 Ga0207644_10044655 3300025931 Bacteria 3149
141 Ga0207690_10036321 3300025932 Bacteria 3189
142 Ga0207690_10440252 3300025932 Bacteria 1046
143 Ga0207706_10040632 3300025933 Bacteria 4123
144 Ga0207706_10441538 3300025933 Bacteria 1126
145 Ga0207709_10028558 3300025935 Bacteria 3226
146 Ga0207670_10105226 3300025936 Bacteria 2022
147 Ga0207669_10081504 3300025937 Bacteria 2073
148 Ga0207704_10044098 3300025938 Bacteria 2639
149 Ga0207691_10116590 3300025940 Bacteria 2370
150 Ga0207711_10083419 3300025941 Bacteria 2795
151 Ga0207711_10318782 3300025941 Bacteria 1436
152 Ga0207711_10501653 3300025941 Unclassified 1131
153 Ga0207689_10047207 3300025942 Bacteria 3557
154 Ga0207661_10250407 3300025944 Bacteria 1574
155 Ga0207679_10252341 3300025945 Bacteria 1500
156 Ga0207712_10036167 3300025961 Bacteria 3361
157 Ga0207668_10143477 3300025972 Bacteria 1839
158 Ga0207640_10108918 3300025981 Bacteria 1959
159 Ga0207658_10218093 3300025986 Bacteria 1603
160 Ga0207677_10105944 3300026023 Bacteria 2081
161 Ga0207703_10047344 3300026035 Bacteria 3466
162 Ga0207708_10115233 3300026075 Bacteria 2090
163 Ga0207702_10455007 3300026078 Unclassified 1242
164 Ga0207641_10233761 3300026088 Bacteria 1709
165 Ga0207676_10016744 3300026095 Bacteria 5306
166 Ga0207674_10218578 3300026116 Bacteria 1854
167 Ga0207675_100049739 3300026118 Bacteria 3911
168 Ga0207675_100155975 3300026118 Bacteria 2176
169 Ga0207683_10007477 3300026121 Bacteria 9373
170 Ga0207698_10130441 3300026142 Bacteria 2147
171 Ga0207428_10001839 3300027907 Bacteria 21689
172 Ga0268266_10029370 3300028379 Bacteria 4674
173 Ga0268266_10035534 3300028379 Bacteria 4239
174 Ga0268265_10108485 3300028380 Bacteria 2260
175 Ga0268264_10257783 3300028381 Bacteria 1623
176 Ga0373926_0057357 3300035083 Unclassified 1414
177 Ga0373944_0032725 3300035089 Bacteria 1572
178 Ga0373936_0006431 3300035113 Unclassified 4431
179 Ga0373945_0025631 3300035116 Bacteria 2049
180 Ga0373954_0028287 3300035118 Bacteria 2577
181 Ga0373943_0002077 3300035170 Bacteria 9092
182 Ga0373943_0009717 3300035170 Bacteria 4308
183 Ga0373943_0081999 3300035170 Bacteria 1655
184 Ga0373946_0000527 3300035171 Bacteria 12658
185 Ga0373946_0005697 3300035171 Bacteria 4504
186 Ga0373946_0066133 3300035171 Bacteria 1549
187 Ga0373946_0165741 3300035171 Bacteria 1040
188 Ga0373955_0095373 3300035172 Bacteria 1701
189 Ga0373924_0027504 3300035410 Bacteria 2262
190 Ga0373924_0088209 3300035410 Bacteria 1325
191 Ga0373924_0141150 3300035410 Bacteria 1051
192 Ga0373935_0006535 3300035692 Bacteria 6964
193 Ga0373935_0055835 3300035692 Bacteria 2516
194 Ga0373935_0105181 3300035692 Bacteria 1866
195 Ga0373927_0005476 3300035695 Bacteria 8747
196 Ga0373927_0005566 3300035695 Bacteria 8659
197 Ga0373927_0049188 3300035695 Bacteria 2726
198 Ga0373927_0085030 3300035695 Bacteria 2052
199 Ga0373927_0211239 3300035695 Bacteria 1275
200 Ga0373927_0287705 3300035695 Bacteria 1081
201 Ga0373933_0034845 3300035724 Bacteria 2936
202 Ga0373947_0002032 3300035725 Bacteria 12353
203 Ga0373947_0007318 3300035725 Bacteria 6391
204 Ga0373947_0043746 3300035725 Bacteria 2675
205 Ga0373947_0100738 3300035725 Bacteria 1815
206 Ga0373947_0280862 3300035725 Unclassified 1107
207 Ga0373937_0021274 3300036401 Bacteria 5822
208 Ga0373937_0027268 3300036401 Bacteria 5165
209 Ga0373937_0391803 3300036401 Bacteria 1318
210 Ga0373937_0547276 3300036401 Bacteria 1099
211 Ga0373925_0011798 3300037068 Bacteria 6324
212 Ga0373925_0018266 3300037068 Bacteria 5096
213 Ga0373925_0268627 3300037068 Bacteria 1371
214 Ga0373925_0346242 3300037068 Bacteria 1206
215 Ga0436365_1500607 3300039437 Bacteria 5804
216 Ga0495592_0158599 3300046454 Bacteria 1559
217 Ga0495603_0085404 3300046455 Bacteria 1847
218 Ga0495591_039621 3300046458 Bacteria 1349
219 Ga0495629_0000698 3300046459 Bacteria 27178
220 Ga0495651_0005326 3300046462 Bacteria 9815
221 Ga0495653_0119900 3300046463 Bacteria 1877
222 Ga0495580_0081501 3300046472 Unclassified 2255
223 Ga0495580_0219575 3300046472 Bacteria 1306
224 Ga0495582_0065869 3300046473 Bacteria 2001
225 Ga0495664_0072299 3300046477 Bacteria 2060
226 Ga0495584_0032603 3300046491 Bacteria 2636
227 Ga0495594_0100590 3300046499 Bacteria 1626
228 Ga0495608_0012434 3300046511 Bacteria 5908
229 Ga0495618_0019092 3300046514 Bacteria 4215
230 Ga0495618_0134560 3300046514 Bacteria 1581
231 Ga0495618_0244343 3300046514 Bacteria 1128
232 Ga0495628_0012491 3300046516 Bacteria 7159
233 Ga0495630_0040357 3300046517 Unclassified 3488
234 Ga0495630_0051799 3300046517 Bacteria 3072
235 Ga0495630_0161590 3300046517 Bacteria 1705
236 Ga0495666_0046335 3300046526 Bacteria 2096
237 Ga0495642_0061632 3300046528 Bacteria 1557
238 Ga0495652_0018045 3300046529 Bacteria 6294
239 Ga0495652_0066433 3300046529 Bacteria 3027
240 Ga0495665_0089001 3300046531 Bacteria 1622
241 Ga0495665_0092808 3300046531 Bacteria 1586
242 Ga0495640_0005471 3300046533 Bacteria 10105
243 Ga0495640_0024211 3300046533 Bacteria 4417
244 Ga0495640_0030219 3300046533 Unclassified 3881
245 Ga0495640_0032827 3300046533 Unclassified 3694
246 Ga0495640_0105097 3300046533 Unclassified 1850
247 Ga0495640_0123239 3300046533 Bacteria 1683
248 Ga0495640_0131281 3300046533 Bacteria 1621
249 Ga0495640_0186428 3300046533 Bacteria 1320
250 Ga0495640_0206225 3300046533 Bacteria 1244
251 Ga0495586_0097456 3300046535 Bacteria 1629
252 Ga0495587_0010279 3300046536 Bacteria 5966
253 Ga0495598_0004994 3300046537 Bacteria 2910
254 Ga0495621_0077533 3300046539 Bacteria 1234
255 Ga0495633_0028130 3300046558 Bacteria 2742
256 Ga0495667_0106209 3300046559 Bacteria 1815
257 Ga0495656_0057635 3300046615 Bacteria 1682
258 Ga0495668_0195826 3300046616 Bacteria 1107
259 Ga0495634_0073273 3300046642 Bacteria 2251
260 Ga0495634_0245701 3300046642 Bacteria 1096
261 Ga0495611_0065014 3300046648 Bacteria 1662
262 Ga0495635_0084970 3300046663 Bacteria 2165
263 Ga0495635_0093116 3300046663 Bacteria 2060
264 Ga0495635_0095342 3300046663 Bacteria 2034
265 Ga0495635_0220002 3300046663 Bacteria 1284
266 Ga0495659_0129282 3300046664 Bacteria 1000
267 Ga0495588_0061195 3300046674 Bacteria 1949
268 Ga0495599_0170305 3300046678 Bacteria 1344
269 Ga0495623_0177140 3300046679 Unclassified 1241
270 Ga0495646_0033775 3300046680 Bacteria 3180
271 Ga0495646_0104437 3300046680 Bacteria 1620
272 Ga0495647_0041610 3300046681 Bacteria 1750
273 Ga0495658_0008695 3300046683 Bacteria 5041
274 Ga0495613_0010354 3300046689 Bacteria 6927
275 Ga0495613_0075193 3300046689 Bacteria 2459
276 Ga0495613_0289343 3300046689 Bacteria 1136
277 Ga0495624_0004613 3300046690 Bacteria 10043
278 Ga0495624_0042951 3300046690 Bacteria 2886
279 Ga0495624_0112910 3300046690 Bacteria 1670
280 Ga0495624_0120000 3300046690 Bacteria 1615
281 Ga0495624_0176114 3300046690 Unclassified 1304
282 Ga0495589_0152410 3300046794 Bacteria 1103
283 Ga0495600_0033720 3300046809 Bacteria 3323
284 Ga0495600_0086043 3300046809 Bacteria 2051
285 Ga0495581_0046545 3300047315 Bacteria 2507
286 Ga0495581_0085498 3300047315 Bacteria 1828
287 Ga0495604_0106716 3300047317 Bacteria 2048
288 Ga0495636_0037187 3300047318 Bacteria 2010
289 Ga0495674_0035385 3300047319 Bacteria 4506
290 Ga0495674_0097114 3300047319 Unclassified 2510
291 Ga0495674_0129645 3300047319 Bacteria 2125
292 Ga0495676_0206227 3300047321 Bacteria 1363
293 Ga0495680_0025712 3300047322 Bacteria 4869
294 Ga0495680_0050427 3300047322 Bacteria 3254
295 Ga0495680_0053376 3300047322 Bacteria 3146
296 Ga0495677_0082609 3300047445 Bacteria 1205
297 Ga0495684_0021492 3300047471 Bacteria 4968
298 Ga0495684_0024934 3300047471 Bacteria 4599
299 Ga0495684_0028017 3300047471 Bacteria 4326
300 Ga0495684_0078587 3300047471 Bacteria 2504
301 Ga0495593_0015130 3300047673 Bacteria 4380
302 Ga0495602_0011468 3300048088 Bacteria 9162
303 Ga0495614_0129835 3300048089 Bacteria 1115
304 Ga0496100_0025171 3300048903 Bacteria 3638
305 Ga0496100_0081788 3300048903 Bacteria 2182
306 Ga0496101_0005261 3300048904 Bacteria 8238
307 Ga0496101_0041828 3300048904 Bacteria 3270
308 Ga0496101_0064323 3300048904 Bacteria 2672
309 Ga0496101_0093712 3300048904 Bacteria 2237
310 Ga0496102_0011607 3300048905 Bacteria 7602
311 Ga0496102_0584604 3300048905 Bacteria 1039
312 Ga0496103_0004807 3300048906 Bacteria 8165
313 Ga0496103_0226485 3300048906 Bacteria 1202
314 Ga0496104_0006136 3300048907 Bacteria 10547
315 Ga0496104_0057183 3300048907 Bacteria 3691
316 Ga0496104_0095532 3300048907 Bacteria 2843
317 Ga0496104_0156976 3300048907 Bacteria 2183
318 Ga0496104_0173871 3300048907 Bacteria 2064
319 Ga0496104_0186160 3300048907 Bacteria 1987
320 Ga0496104_0407403 3300048907 Bacteria 1272
321 Ga0496104_0465354 3300048907 Unclassified 1176
322 Ga0496105_0046186 3300048908 Bacteria 3594
323 Ga0496105_0141075 3300048908 Bacteria 1983
324 Ga0496106_0019773 3300048909 Bacteria 4993
325 Ga0496107_0005225 3300048910 Bacteria 8864
326 Ga0496107_0261189 3300048910 Unclassified 1288
327 Ga0496107_0360020 3300048910 Bacteria 1082
328 Ga0496107_0364355 3300048910 Unclassified 1075
329 Ga0496108_0032554 3300048911 Bacteria 4331
330 Ga0496108_0042461 3300048911 Bacteria 3796
331 Ga0496108_0055773 3300048911 Bacteria 3318
332 Ga0496108_0400881 3300048911 Unclassified 1198
333 Ga0496109_0004739 3300048912 Bacteria 11370
334 Ga0496109_0076306 3300048912 Bacteria 3082
335 Ga0496109_0081829 3300048912 Bacteria 2975
336 Ga0496110_0062045 3300048913 Bacteria 3300
337 Ga0496110_0069039 3300048913 Bacteria 3128
338 Ga0496110_0100415 3300048913 Bacteria 2594
339 Ga0496110_0403417 3300048913 Bacteria 1246
340 Ga0496111_0004586 3300048914 Bacteria 8748
341 Ga0496111_0029339 3300048914 Bacteria 3907
342 Ga0496112_0059417 3300048915 Bacteria 3767
343 Ga0496112_0291329 3300048915 Unclassified 1578
344 Ga0496112_0395700 3300048915 Bacteria 1321
345 Ga0496113_0037276 3300048916 Bacteria 3566
346 Ga0496113_0057328 3300048916 Bacteria 2927
347 Ga0496113_0137892 3300048916 Bacteria 1918
348 Ga0496114_0007930 3300048917 Bacteria 8403
349 Ga0496114_0114747 3300048917 Bacteria 2310
350 Ga0496115_0333228 3300048918 Bacteria 1239
351 Ga0496121_0076571 3300048924 Bacteria 2667
352 Ga0496126_0017316 3300048929 Bacteria 7182
353 nmdc:mga00v17_26631_c1 3300050491 Bacteria 3371
354 nmdc:mga0yw44_111813_c1 3300050492 Bacteria 1751
355 nmdc:mga05p37_549005_c1 3300050507 Bacteria 1316
356 nmdc:mga0n895_215000_c1 3300050512 Bacteria 1952
357 nmdc:mga0rr50_246192_c1 3300050513 Bacteria 1483
358 Ga0495601_0001908 3300053077 Bacteria 11658
359 Ga0495601_0012970 3300053077 Bacteria 5005
360 Ga0495601_0035155 3300053077 Unclassified 3126
361 Ga0495601_0053675 3300053077 Bacteria 2548
362 Ga0495601_0055955 3300053077 Bacteria 2498
363 Ga0495601_0082393 3300053077 Bacteria 2065
364 Ga0495612_0018694 3300053078 Bacteria 2775
365 Ga0495612_0020175 3300053078 Unclassified 2671
366 Ga0495612_0072959 3300053078 Unclassified 1433
367 Ga0495612_0132249 3300053078 Bacteria 1078
368 Ga0495655_0098920 3300053083 Bacteria 861
369 Ga0495595_0010942 3300053084 Bacteria 3785
370 Ga0495595_0020833 3300053084 Bacteria 2858
371 Ga0495595_0117383 3300053084 Bacteria 1294
372 Ga0495595_0120701 3300053084 Bacteria 1277
373 Ga0495619_0001067 3300053085 Bacteria 17994
374 Ga0495619_0001175 3300053085 Bacteria 17233
375 Ga0495619_0021848 3300053085 Bacteria 4088
376 Ga0495619_0059853 3300053085 Bacteria 2530
377 Ga0495619_0063784 3300053085 Bacteria 2455
378 Ga0495619_0080891 3300053085 Unclassified 2187
379 Ga0157375_10160735
380 JGI24743J22301_10001720
381 JGI24738J21930_10014654
382 JGI24744J21845_10012963
383 Ga0070683_100202961
384 Ga0070690_100251040
385 Ga0068869_100034745
386 Ga0068868_100072564
387 Ga0070660_100156636
388 Ga0070689_100080224
389 Ga0070691_10032728
390 Ga0070687_100127874
391 Ga0070692_10082187
392 Ga0070668_100128407
393 Ga0070668_100426535
394 Ga0070669_100351750
395 Ga0070675_100025747
396 Ga0070671_100016422
397 Ga0070674_100021463
398 Ga0070659_100219174
399 Ga0070667_100194594
400 Ga0070709_10066212
401 Ga0070714_100014085
402 Ga0070714_100329346
403 Ga0070713_100109232
404 Ga0070710_10001212
405 Ga0070710_10158474
406 Ga0070711_100088401
407 Ga0070711_100162671
408 Ga0070711_100193050
409 Ga0070711_100241361
410 Ga0070700_100009020
411 Ga0070694_100039166
412 Ga0070708_100158612
413 Ga0070678_100216676
414 Ga0068867_100036936
415 Ga0070685_10042484
416 Ga0070706_100092852
417 Ga0070707_100413373
418 Ga0070684_100202989
419 Ga0070697_100039481
420 Ga0070672_100108343
421 Ga0070686_100238971
422 Ga0070665_100079871
423 Ga0070665_100280421
424 Ga0068852_100021454
425 Ga0068859_100496450
426 Ga0068864_100015205
427 Ga0068866_10014863
428 Ga0068861_100005869
429 Ga0068870_10005566
430 Ga0068863_100075716
431 Ga0068858_100010246
432 Ga0068858_100182224
433 Ga0068860_100260731
434 Ga0068862_100043129
435 Ga0081455_10063079
436 Ga0081540_1029008
437 Ga0081540_1031358
438 Ga0081539_10026790
439 Ga0070717_10057127
440 Ga0070717_10122792
441 Ga0070717_10128136
442 Ga0075365_10039309
443 Ga0075365_10109357
444 Ga0070715_10036672
445 Ga0070716_100054047
446 Ga0070712_100132264
447 Ga0070712_100174856
448 Ga0070712_100282505
449 Ga0070712_100419417
450 Ga0075366_10017914
451 Ga0097621_100047703
452 Ga0068871_100172396
453 Ga0075434_100153104
454 Ga0068865_100022944
455 Ga0097620_100496438
456 Ga0075435_100228265
457 Ga0075435_100242695
458 Ga0105240_10082326
459 Ga0111539_10018678
460 Ga0111539_10782897
461 Ga0105245_10057543
462 Ga0105245_10133837
463 Ga0105247_10101005
464 Ga0114129_10354384
465 Ga0114129_10572818
466 Ga0114129_10690823
467 Ga0105243_10036442
468 Ga0105243_10561497
469 Ga0105242_10060498
470 Ga0105242_10606942
471 Ga0105248_10086849
472 Ga0105248_10159769
473 Ga0105248_10255097
474 Ga0105248_10308702
475 Ga0105237_10079249
476 Ga0105249_10061138
477 Ga0105249_10537094
478 Ga0105246_10006290
479 Ga0157374_10043694
480 Ga0157374_10131041
481 Ga0157378_10052121
482 Ga0163162_10240476
483 Ga0163162_10701344
484 Ga0157375_10012191
485 Ga0163163_10038928
486 Ga0163163_10145082
487 Ga0157380_10043365
488 Ga0157380_10529256
489 Ga0157377_10007329
490 Ga0157377_10284185
491 Ga0157379_10013143
492 Ga0157379_10050510
493 Ga0157376_10050626
494 Ga0163161_10034925
495 Ga0163161_10140088
496 Ga0224572_1009177
497 Ga0207692_10018174
498 Ga0207642_10100591
499 Ga0207710_10033609
500 Ga0207688_10003933
501 Ga0207688_10076144
502 Ga0207688_10252569
503 Ga0207647_10085202
504 Ga0207699_10031071
505 Ga0207643_10000935
506 Ga0207684_10196054
507 Ga0207695_10184338
508 Ga0207671_10232512
509 Ga0207693_10029079
510 Ga0207693_10184831
511 Ga0207693_10297411
512 Ga0207663_10025780
513 Ga0207663_10211341
514 Ga0207662_10099197
515 Ga0207657_10191498
516 Ga0207659_10219383
517 Ga0207687_10072070
518 Ga0207644_10044655
519 Ga0207690_10036321
520 Ga0207690_10440252
521 Ga0207706_10040632
522 Ga0207706_10441538
523 Ga0207709_10028558
524 Ga0207670_10105226
525 Ga0207669_10081504
526 Ga0207704_10044098
527 Ga0207691_10116590
528 Ga0207711_10083419
529 Ga0207711_10318782
530 Ga0207711_10501653
531 Ga0207689_10047207
532 Ga0207661_10250407
533 Ga0207679_10252341
534 Ga0207712_10036167
535 Ga0207668_10143477
536 Ga0207640_10108918
537 Ga0207658_10218093
538 Ga0207677_10105944
539 Ga0207703_10047344
540 Ga0207708_10115233
541 Ga0207702_10455007
542 Ga0207641_10233761
543 Ga0207676_10016744
544 Ga0207674_10218578
545 Ga0207675_100049739
546 Ga0207675_100155975
547 Ga0207683_10007477
548 Ga0207698_10130441
549 Ga0207428_10001839
550 Ga0268266_10029370
551 Ga0268266_10035534
552 Ga0268265_10108485
553 Ga0268264_10257783
554 Ga0373926_0057357
555 Ga0373944_0032725
556 Ga0373936_0006431
557 Ga0373945_0025631
558 Ga0373954_0028287
559 Ga0373943_0002077
560 Ga0373943_0009717
561 Ga0373943_0081999
562 Ga0373946_0000527
563 Ga0373946_0005697
564 Ga0373946_0066133
565 Ga0373946_0165741
566 Ga0373955_0095373
567 Ga0373924_0027504
568 Ga0373924_0088209
569 Ga0373924_0141150
570 Ga0373935_0006535
571 Ga0373935_0055835
572 Ga0373935_0105181
573 Ga0373927_0005476
574 Ga0373927_0005566
575 Ga0373927_0049188
576 Ga0373927_0085030
577 Ga0373927_0211239
578 Ga0373927_0287705
579 Ga0373933_0034845
580 Ga0373947_0002032
581 Ga0373947_0007318
582 Ga0373947_0043746
583 Ga0373947_0100738
584 Ga0373947_0280862
585 Ga0373937_0021274
586 Ga0373937_0027268
587 Ga0373937_0391803
588 Ga0373937_0547276
589 Ga0373925_0011798
590 Ga0373925_0018266
591 Ga0373925_0268627
592 Ga0373925_0346242
593 Ga0436365_1500607
594 Ga0495592_0158599
595 Ga0495603_0085404
596 Ga0495591_039621
597 Ga0495629_0000698
598 Ga0495651_0005326
599 Ga0495653_0119900
600 Ga0495580_0081501
601 Ga0495580_0219575
602 Ga0495582_0065869
603 Ga0495664_0072299
604 Ga0495584_0032603
605 Ga0495594_0100590
606 Ga0495608_0012434
607 Ga0495618_0019092
608 Ga0495618_0134560
609 Ga0495618_0244343
610 Ga0495628_0012491
611 Ga0495630_0040357
612 Ga0495630_0051799
613 Ga0495630_0161590
614 Ga0495666_0046335
615 Ga0495642_0061632
616 Ga0495652_0018045
617 Ga0495652_0066433
618 Ga0495665_0089001
619 Ga0495665_0092808
620 Ga0495640_0005471
621 Ga0495640_0024211
622 Ga0495640_0030219
623 Ga0495640_0032827
624 Ga0495640_0105097
625 Ga0495640_0123239
626 Ga0495640_0131281
627 Ga0495640_0186428
628 Ga0495640_0206225
629 Ga0495586_0097456
630 Ga0495587_0010279
631 Ga0495598_0004994
632 Ga0495621_0077533
633 Ga0495633_0028130
634 Ga0495667_0106209
635 Ga0495656_0057635
636 Ga0495668_0195826
637 Ga0495634_0073273
638 Ga0495634_0245701
639 Ga0495611_0065014
640 Ga0495635_0084970
641 Ga0495635_0093116
642 Ga0495635_0095342
643 Ga0495635_0220002
644 Ga0495659_0129282
645 Ga0495588_0061195
646 Ga0495599_0170305
647 Ga0495623_0177140
648 Ga0495646_0033775
649 Ga0495646_0104437
650 Ga0495647_0041610
651 Ga0495658_0008695
652 Ga0495613_0010354
653 Ga0495613_0075193
654 Ga0495613_0289343
655 Ga0495624_0004613
656 Ga0495624_0042951
657 Ga0495624_0112910
658 Ga0495624_0120000
659 Ga0495624_0176114
660 Ga0495589_0152410
661 Ga0495600_0033720
662 Ga0495600_0086043
663 Ga0495581_0046545
664 Ga0495581_0085498
665 Ga0495604_0106716
666 Ga0495636_0037187
667 Ga0495674_0035385
668 Ga0495674_0097114
669 Ga0495674_0129645
670 Ga0495676_0206227
671 Ga0495680_0025712
672 Ga0495680_0050427
673 Ga0495680_0053376
674 Ga0495677_0082609
675 Ga0495684_0021492
676 Ga0495684_0024934
677 Ga0495684_0028017
678 Ga0495684_0078587
679 Ga0495593_0015130
680 Ga0495602_0011468
681 Ga0495614_0129835
682 Ga0496100_0025171
683 Ga0496100_0081788
684 Ga0496101_0005261
685 Ga0496101_0041828
686 Ga0496101_0064323
687 Ga0496101_0093712
688 Ga0496102_0011607
689 Ga0496102_0584604
690 Ga0496103_0004807
691 Ga0496103_0226485
692 Ga0496104_0006136
693 Ga0496104_0057183
694 Ga0496104_0095532
695 Ga0496104_0156976
696 Ga0496104_0173871
697 Ga0496104_0186160
698 Ga0496104_0407403
699 Ga0496104_0465354
700 Ga0496105_0046186
701 Ga0496105_0141075
702 Ga0496106_0019773
703 Ga0496107_0005225
704 Ga0496107_0261189
705 Ga0496107_0360020
706 Ga0496107_0364355
707 Ga0496108_0032554
708 Ga0496108_0042461
709 Ga0496108_0055773
710 Ga0496108_0400881
711 Ga0496109_0004739
712 Ga0496109_0076306
713 Ga0496109_0081829
714 Ga0496110_0062045
715 Ga0496110_0069039
716 Ga0496110_0100415
717 Ga0496110_0403417
718 Ga0496111_0004586
719 Ga0496111_0029339
720 Ga0496112_0059417
721 Ga0496112_0291329
722 Ga0496112_0395700
723 Ga0496113_0037276
724 Ga0496113_0057328
725 Ga0496113_0137892
726 Ga0496114_0007930
727 Ga0496114_0114747
728 Ga0496115_0333228
729 Ga0496121_0076571
730 Ga0496126_0017316
731 nmdc:mga00v17_26631_c1
732 nmdc:mga0yw44_111813_c1
733 nmdc:mga05p37_549005_c1
734 nmdc:mga0n895_215000_c1
735 nmdc:mga0rr50_246192_c1
736 Ga0495601_0001908
737 Ga0495601_0012970
738 Ga0495601_0035155
739 Ga0495601_0053675
740 Ga0495601_0055955
741 Ga0495601_0082393
742 Ga0495612_0018694
743 Ga0495612_0020175
744 Ga0495612_0072959
745 Ga0495612_0132249
746 Ga0495655_0098920
747 Ga0495595_0010942
748 Ga0495595_0020833
749 Ga0495595_0117383
750 Ga0495595_0120701
751 Ga0495619_0001067
752 Ga0495619_0001175
753 Ga0495619_0021848
754 Ga0495619_0059853
755 Ga0495619_0063784
756 Ga0495619_0080891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

78

370

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9093 30 307
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9042 28 306
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.884 32 307
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8566 30 307
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8525 28 306
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9208 28 275 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8978 28 275 3.40.50.2300
af_A0A0R0JSN9_31_182_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7987 31 118 3.40.50.2300
af_Q69NA5_27_147_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7752 30 128 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7702 151 307 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A536ZL55-F1-model_v4 ABC transporter substrate-binding protein 0.9674 200 308
AF-A0A2A6PYW4-F1-model_v4 ABC transporter substrate-binding protein 0.9649 30 308
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9644 202 308
AF-A0A537SB65-F1-model_v4 ABC transporter substrate-binding protein 0.9607 132 308
AF-A0A537NR15-F1-model_v4 ABC transporter substrate-binding protein 0.9607 200 308

Map