F427338

General Info

Members Datasets Scaffolds Average Seq Length
376 176 752 260

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10031132|Ga0105243_100311322
Length 286
Sequence MEAPPQRFVLSITSLEGHMVHASGMTAYPSRRALCALFLTVFAGAAGTAGSQTLQEFSAEARFQLDFHVPDAALAAMLPQGFMLNVATQGPAKDANIRVIFVDRMTINGPDGKPVGKTGSNRLVYLAAPVKDPSGANAQLVIGGLTADPADAPGPFGVYLPAATHTMQRSTSSKGNGPVLDSQDWVFQAASGEHLELHIKYEHGVGNKGMPADTKFYSAKNPGIAQISRQEQVLDILRNVTTTPPDRVKEFSFKGSGGSYAKLFDGTEKVLSWDNIVWINRSVMQP

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.27
Rhizosphere 99.73
Stem 0
Stem Tuber 0
Unclassified 21.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10031132 3300009148 Bacteria 4112
2 Ga0065704_10005945 3300005289 Bacteria 4752
3 Ga0065715_10256234 3300005293 Unclassified 1151
4 Ga0070658_10160490 3300005327 Bacteria 1886
5 Ga0070676_10057636 3300005328 Unclassified 2299
6 Ga0070676_10353771 3300005328 Bacteria 1010
7 Ga0070683_100065250 3300005329 Bacteria 3390
8 Ga0070683_100222424 3300005329 Bacteria 1794
9 Ga0070683_100231047 3300005329 Bacteria 1758
10 Ga0070683_100322547 3300005329 Unclassified 1470
11 Ga0070670_100003391 3300005331 Bacteria 13203
12 Ga0070666_10038698 3300005335 Bacteria 3174
13 Ga0070680_100535568 3300005336 Bacteria 1003
14 Ga0068868_100038774 3300005338 Bacteria 3698
15 Ga0070689_100024118 3300005340 Unclassified 4561
16 Ga0070689_100638290 3300005340 Unclassified 925
17 Ga0070691_10006581 3300005341 Bacteria 5317
18 Ga0070687_100024751 3300005343 Bacteria 2872
19 Ga0070661_100001592 3300005344 Bacteria 15744
20 Ga0070661_100053062 3300005344 Bacteria 2967
21 Ga0070669_100269669 3300005353 Bacteria 1360
22 Ga0070675_100002358 3300005354 Bacteria 14051
23 Ga0070671_100006329 3300005355 Bacteria 9446
24 Ga0070671_100009793 3300005355 Bacteria 7693
25 Ga0070671_100017807 3300005355 Bacteria 5760
26 Ga0070673_100012113 3300005364 Bacteria 5911
27 Ga0070673_100040705 3300005364 Bacteria 3567
28 Ga0070688_100025582 3300005365 Unclassified 3495
29 Ga0070688_100060726 3300005365 Unclassified 2388
30 Ga0070688_100164146 3300005365 Bacteria 1528
31 Ga0070688_100250331 3300005365 Unclassified 1261
32 Ga0070667_100025023 3300005367 Unclassified 4961
33 Ga0070667_100177238 3300005367 Unclassified 1884
34 Ga0070709_10420846 3300005434 Bacteria 1001
35 Ga0070713_100012377 3300005436 Bacteria 6254
36 Ga0070701_10086014 3300005438 Bacteria 1712
37 Ga0070711_100062231 3300005439 Bacteria 2601
38 Ga0070711_100075450 3300005439 Bacteria 2388
39 Ga0070705_100001283 3300005440 Bacteria 13542
40 Ga0070705_100189061 3300005440 Bacteria 1402
41 Ga0070694_100019559 3300005444 Bacteria 4308
42 Ga0070694_100054922 3300005444 Unclassified 2700
43 Ga0070694_100130161 3300005444 Bacteria 1817
44 Ga0070678_100066132 3300005456 Bacteria 2687
45 Ga0070681_10006223 3300005458 Bacteria 11600
46 Ga0070681_10127031 3300005458 Bacteria 2482
47 Ga0070681_10342372 3300005458 Bacteria 1405
48 Ga0068867_100070795 3300005459 Unclassified 2608
49 Ga0068867_100135607 3300005459 Unclassified 1918
50 Ga0068867_100169528 3300005459 Bacteria 1728
51 Ga0070707_100026412 3300005468 Bacteria 5513
52 Ga0070707_100053908 3300005468 Bacteria 3855
53 Ga0070707_100105034 3300005468 Bacteria 2739
54 Ga0070707_100170533 3300005468 Bacteria 2121
55 Ga0070698_100028550 3300005471 Bacteria 5794
56 Ga0070699_100003725 3300005518 Bacteria 13465
57 Ga0070699_100009237 3300005518 Bacteria 8544
58 Ga0070679_100001380 3300005530 Bacteria 21432
59 Ga0070684_100014336 3300005535 Bacteria 6417
60 Ga0070684_100031178 3300005535 Bacteria 4536
61 Ga0070684_100034355 3300005535 Bacteria 4335
62 Ga0070684_100125976 3300005535 Bacteria 2307
63 Ga0070684_100125982 3300005535 Bacteria 2307
64 Ga0070684_100356009 3300005535 Unclassified 1347
65 Ga0070684_100411987 3300005535 Bacteria 1247
66 Ga0070697_100191054 3300005536 Bacteria 1738
67 Ga0070672_100000492 3300005543 Bacteria 22987
68 Ga0070672_100267741 3300005543 Bacteria 1442
69 Ga0070695_100000040 3300005545 Bacteria 49538
70 Ga0070695_100017605 3300005545 Bacteria 4335
71 Ga0070696_100011888 3300005546 Bacteria 5834
72 Ga0070696_100021687 3300005546 Bacteria 4356
73 Ga0070696_100026946 3300005546 Bacteria 3913
74 Ga0070704_100113584 3300005549 Bacteria 2065
75 Ga0070704_100177594 3300005549 Bacteria 1700
76 Ga0068855_100032315 3300005563 Bacteria 6250
77 Ga0068855_100034343 3300005563 Bacteria 6049
78 Ga0068855_100177721 3300005563 Bacteria 2407
79 Ga0068855_100348290 3300005563 Unclassified 1632
80 Ga0068855_100367359 3300005563 Bacteria 1582
81 Ga0070664_100000375 3300005564 Bacteria 33197
82 Ga0070664_100621154 3300005564 Bacteria 1003
83 Ga0068857_100157174 3300005577 Bacteria 2062
84 Ga0068854_100133344 3300005578 Bacteria 1899
85 Ga0068856_100010295 3300005614 Bacteria 9090
86 Ga0068856_100033036 3300005614 Bacteria 5067
87 Ga0068856_100111778 3300005614 Bacteria 2729
88 Ga0068856_100136149 3300005614 Bacteria 2461
89 Ga0068856_100953465 3300005614 Bacteria 876
90 Ga0070702_100032657 3300005615 Unclassified 2857
91 Ga0070702_100080344 3300005615 Bacteria 1951
92 Ga0070702_100149068 3300005615 Bacteria 1499
93 Ga0070702_100342208 3300005615 Bacteria 1050
94 Ga0068852_100048043 3300005616 Bacteria 3645
95 Ga0068859_100040877 3300005617 Unclassified 4657
96 Ga0068859_100100431 3300005617 Bacteria 2949
97 Ga0068859_100271493 3300005617 Bacteria 1788
98 Ga0068859_100623691 3300005617 Bacteria 1171
99 Ga0068859_101021654 3300005617 Unclassified 908
100 Ga0068864_100000266 3300005618 Bacteria 46438
101 Ga0068864_100036731 3300005618 Unclassified 4178
102 Ga0068864_100157607 3300005618 Bacteria 2062
103 Ga0068864_100236838 3300005618 Bacteria 1690
104 Ga0068864_100390601 3300005618 Bacteria 1321
105 Ga0068864_100486979 3300005618 Bacteria 1185
106 Ga0068861_100108075 3300005719 Bacteria 2225
107 Ga0068870_10015205 3300005840 Bacteria 3648
108 Ga0068870_10045948 3300005840 Bacteria 2288
109 Ga0068863_100016677 3300005841 Bacteria 7048
110 Ga0068863_100068294 3300005841 Bacteria 3362
111 Ga0068863_100134672 3300005841 Unclassified 2360
112 Ga0068863_100402784 3300005841 Bacteria 1338
113 Ga0068858_100034217 3300005842 Unclassified 4713
114 Ga0068858_100080825 3300005842 Bacteria 3021
115 Ga0068858_100087019 3300005842 Unclassified 2906
116 Ga0068860_100028562 3300005843 Bacteria 5370
117 Ga0081539_10108193 3300005985 Bacteria 1405
118 Ga0075432_10012326 3300006058 Bacteria 2904
119 Ga0097621_100090231 3300006237 Unclassified 2564
120 Ga0097621_100208946 3300006237 Unclassified 1697
121 Ga0097621_100270567 3300006237 Unclassified 1493
122 Ga0068871_100046657 3300006358 Unclassified 3490
123 Ga0068871_100108726 3300006358 Bacteria 2331
124 Ga0068871_100335501 3300006358 Bacteria 1334
125 Ga0075428_100005989 3300006844 Bacteria 13502
126 Ga0075431_100114121 3300006847 Bacteria 2789
127 Ga0075433_10007809 3300006852 Bacteria 8507
128 Ga0075433_10069962 3300006852 Bacteria 3083
129 Ga0075433_10071665 3300006852 Unclassified 3046
130 Ga0075433_10163142 3300006852 Unclassified 1983
131 Ga0075433_10197483 3300006852 Unclassified 1789
132 Ga0075434_100017355 3300006871 Bacteria 6931
133 Ga0075434_100019256 3300006871 Bacteria 6603
134 Ga0075434_100022837 3300006871 Bacteria 6090
135 Ga0075434_100081530 3300006871 Bacteria 3233
136 Ga0075434_100351838 3300006871 Bacteria 1494
137 Ga0075429_100130298 3300006880 Unclassified 2200
138 Ga0075429_100237096 3300006880 Unclassified 1598
139 Ga0068865_100116178 3300006881 Unclassified 1982
140 Ga0075436_100058860 3300006914 Bacteria 2654
141 Ga0097620_100040879 3300006931 Unclassified 4657
142 Ga0097620_100100430 3300006931 Bacteria 2949
143 Ga0097620_100271488 3300006931 Bacteria 1788
144 Ga0097620_100623764 3300006931 Bacteria 1171
145 Ga0097620_101021658 3300006931 Unclassified 908
146 Ga0075435_100008907 3300007076 Bacteria 7231
147 Ga0075435_100075476 3300007076 Unclassified 2761
148 Ga0075435_100204490 3300007076 Bacteria 1674
149 Ga0075435_100252014 3300007076 Bacteria 1503
150 Ga0105240_10006183 3300009093 Bacteria 17642
151 Ga0105240_10041845 3300009093 Bacteria 5843
152 Ga0105240_10050375 3300009093 Bacteria 5251
153 Ga0105240_10055604 3300009093 Bacteria 4955
154 Ga0111539_10227710 3300009094 Bacteria 2171
155 Ga0111539_10541026 3300009094 Bacteria 1357
156 Ga0105245_10383280 3300009098 Unclassified 1400
157 Ga0114129_10002091 3300009147 Bacteria 27446
158 Ga0114129_10003679 3300009147 Bacteria 21574
159 Ga0114129_10011081 3300009147 Bacteria 12845
160 Ga0114129_10014604 3300009147 Bacteria 11189
161 Ga0114129_10232677 3300009147 Bacteria 2481
162 Ga0114129_10277847 3300009147 Bacteria 2238
163 Ga0105241_10006364 3300009174 Bacteria 8701
164 Ga0105241_10105902 3300009174 Bacteria 2244
165 Ga0105241_10236017 3300009174 Bacteria 1544
166 Ga0105242_10048706 3300009176 Bacteria 3445
167 Ga0105242_10077510 3300009176 Bacteria 2773
168 Ga0105242_10174697 3300009176 Bacteria 1890
169 Ga0105242_10423995 3300009176 Bacteria 1247
170 Ga0105248_10005808 3300009177 Bacteria 13565
171 Ga0105248_10022724 3300009177 Bacteria 6960
172 Ga0105248_10047891 3300009177 Bacteria 4794
173 Ga0105248_10275847 3300009177 Bacteria 1893
174 Ga0105248_10674704 3300009177 Unclassified 1166
175 Ga0105237_10059513 3300009545 Bacteria 3822
176 Ga0105237_10631743 3300009545 Bacteria 1078
177 Ga0105238_10006512 3300009551 Bacteria 11620
178 Ga0105238_10016341 3300009551 Bacteria 7511
179 Ga0105238_10028785 3300009551 Bacteria 5658
180 Ga0105238_10168955 3300009551 Bacteria 2163
181 Ga0105249_10054499 3300009553 Bacteria 3657
182 Ga0105239_10004784 3300010375 Bacteria 16067
183 Ga0105239_10151319 3300010375 Bacteria 2589
184 Ga0105239_10169859 3300010375 Bacteria 2438
185 Ga0105246_10076513 3300011119 Bacteria 2371
186 Ga0105246_10165152 3300011119 Bacteria 1690
187 Ga0157373_10272515 3300013100 Bacteria 1198
188 Ga0157371_10055514 3300013102 Bacteria 2811
189 Ga0157370_10032070 3300013104 Bacteria 5133
190 Ga0157369_10035247 3300013105 Bacteria 5488
191 Ga0157369_10043975 3300013105 Unclassified 4864
192 Ga0157369_10253603 3300013105 Bacteria 1836
193 Ga0157374_10088961 3300013296 Unclassified 2942
194 Ga0163162_10002636 3300013306 Bacteria 17018
195 Ga0163162_10265749 3300013306 Bacteria 1847
196 Ga0157372_10726177 3300013307 Bacteria 1155
197 Ga0157372_10737976 3300013307 Unclassified 1145
198 Ga0157375_10003478 3300013308 Bacteria 13653
199 Ga0157375_10022220 3300013308 Bacteria 5837
200 Ga0157375_10082672 3300013308 Bacteria 3254
201 Ga0163163_10029784 3300014325 Bacteria 5253
202 Ga0163163_10083691 3300014325 Unclassified 3196
203 Ga0163163_10629341 3300014325 Unclassified 1136
204 Ga0157377_10027942 3300014745 Unclassified 3033
205 Ga0157377_10059221 3300014745 Bacteria 2182
206 Ga0157376_10312351 3300014969 Bacteria 1491
207 Ga0157376_10615901 3300014969 Bacteria 1082
208 Ga0207688_10157704 3300025901 Unclassified 1344
209 Ga0207680_10028390 3300025903 Bacteria 3129
210 Ga0207699_10284780 3300025906 Unclassified 1149
211 Ga0207645_10024668 3300025907 Bacteria 3895
212 Ga0207645_10175015 3300025907 Bacteria 1407
213 Ga0207643_10007134 3300025908 Bacteria 5995
214 Ga0207643_10008526 3300025908 Bacteria 5498
215 Ga0207705_10124798 3300025909 Bacteria 1912
216 Ga0207654_10067181 3300025911 Bacteria 2117
217 Ga0207654_10140567 3300025911 Bacteria 1539
218 Ga0207707_10001650 3300025912 Bacteria 20597
219 Ga0207707_10014485 3300025912 Bacteria 6868
220 Ga0207695_10004336 3300025913 Bacteria 19431
221 Ga0207695_10142931 3300025913 Unclassified 2339
222 Ga0207695_10324973 3300025913 Unclassified 1428
223 Ga0207671_10043783 3300025914 Bacteria 3310
224 Ga0207660_10159125 3300025917 Bacteria 1741
225 Ga0207657_10196832 3300025919 Bacteria 1623
226 Ga0207657_10281174 3300025919 Bacteria 1321
227 Ga0207649_10011456 3300025920 Bacteria 4891
228 Ga0207649_10031660 3300025920 Bacteria 3146
229 Ga0207646_10071265 3300025922 Bacteria 3104
230 Ga0207646_10737677 3300025922 Bacteria 879
231 Ga0207694_10034885 3300025924 Bacteria 3858
232 Ga0207694_10049441 3300025924 Bacteria 3255
233 Ga0207694_10057195 3300025924 Bacteria 3031
234 Ga0207650_10009918 3300025925 Bacteria 6516
235 Ga0207659_10000251 3300025926 Bacteria 32708
236 Ga0207687_10003457 3300025927 Bacteria 10634
237 Ga0207687_10346878 3300025927 Bacteria 1208
238 Ga0207687_10420290 3300025927 Unclassified 1103
239 Ga0207687_10545733 3300025927 Unclassified 972
240 Ga0207644_10011400 3300025931 Bacteria 5881
241 Ga0207644_10019933 3300025931 Bacteria 4555
242 Ga0207644_10158924 3300025931 Bacteria 1755
243 Ga0207644_10163466 3300025931 Unclassified 1732
244 Ga0207686_10005181 3300025934 Bacteria 7003
245 Ga0207686_10015849 3300025934 Bacteria 4223
246 Ga0207686_10021131 3300025934 Bacteria 3730
247 Ga0207686_10028320 3300025934 Bacteria 3292
248 Ga0207686_10111027 3300025934 Bacteria 1849
249 Ga0207686_10530057 3300025934 Unclassified 918
250 Ga0207670_10005340 3300025936 Bacteria 7045
251 Ga0207670_10241275 3300025936 Bacteria 1392
252 Ga0207704_10049193 3300025938 Bacteria 2534
253 Ga0207691_10011456 3300025940 Bacteria 8509
254 Ga0207691_10216456 3300025940 Bacteria 1662
255 Ga0207691_10241396 3300025940 Bacteria 1562
256 Ga0207711_10001617 3300025941 Bacteria 20792
257 Ga0207711_10174282 3300025941 Bacteria 1953
258 Ga0207711_10278935 3300025941 Bacteria 1539
259 Ga0207661_10023692 3300025944 Unclassified 4642
260 Ga0207661_10025963 3300025944 Unclassified 4458
261 Ga0207661_10197092 3300025944 Archaea 1769
262 Ga0207661_10199608 3300025944 Bacteria 1758
263 Ga0207661_10247230 3300025944 Bacteria 1584
264 Ga0207679_10381112 3300025945 Unclassified 1236
265 Ga0207667_10024788 3300025949 Bacteria 6578
266 Ga0207667_10038922 3300025949 Bacteria 5071
267 Ga0207651_10002230 3300025960 Bacteria 9184
268 Ga0207651_10020297 3300025960 Bacteria 4008
269 Ga0207651_10135513 3300025960 Bacteria 1893
270 Ga0207651_10409225 3300025960 Bacteria 1155
271 Ga0207712_10209980 3300025961 Bacteria 1550
272 Ga0207677_10106077 3300026023 Bacteria 2081
273 Ga0207703_10013438 3300026035 Bacteria 6377
274 Ga0207703_10020410 3300026035 Bacteria 5181
275 Ga0207703_10174098 3300026035 Unclassified 1895
276 Ga0207703_10680744 3300026035 Unclassified 977
277 Ga0207639_10087237 3300026041 Bacteria 2487
278 Ga0207708_10321999 3300026075 Bacteria 1262
279 Ga0207702_10015197 3300026078 Bacteria 6383
280 Ga0207702_10336912 3300026078 Unclassified 1440
281 Ga0207641_10049271 3300026088 Unclassified 3559
282 Ga0207641_10094577 3300026088 Bacteria 2621
283 Ga0207641_10228122 3300026088 Unclassified 1730
284 Ga0207641_10354054 3300026088 Unclassified 1400
285 Ga0207648_10072227 3300026089 Bacteria 3007
286 Ga0207648_10186331 3300026089 Bacteria 1838
287 Ga0207676_10000463 3300026095 Bacteria 34064
288 Ga0207676_10006825 3300026095 Bacteria 8086
289 Ga0207676_10257092 3300026095 Bacteria 1575
290 Ga0207676_10432119 3300026095 Bacteria 1237
291 Ga0207674_10001520 3300026116 Bacteria 29913
292 Ga0207674_10002333 3300026116 Bacteria 24011
293 Ga0207683_10041070 3300026121 Bacteria 4038
294 Ga0207698_10227442 3300026142 Bacteria 1691
295 Ga0207428_10019664 3300027907 Bacteria 5756
296 Ga0268265_10027784 3300028380 Bacteria 4042
297 Ga0265319_1023008 3300028563 Unclassified 2262
298 Ga0265338_10018468 3300028800 Bacteria 7464
299 Ga0265316_10259985 3300031344 Bacteria 1273
300 Ga0265313_10001559 3300031595 Bacteria 21271
301 Ga0265314_10007582 3300031711 Bacteria 9396
302 Ga0373934_0030683 3300035086 Bacteria 2102
303 Ga0373923_0045405 3300035111 Bacteria 1825
304 Ga0373953_0002645 3300035117 Bacteria 5426
305 Ga0373954_0001291 3300035118 Bacteria 10071
306 Ga0373954_0014557 3300035118 Bacteria 3508
307 Ga0373954_0190164 3300035118 Unclassified 1008
308 Ga0373955_0194281 3300035172 Unclassified 1207
309 Ga0373955_0247121 3300035172 Bacteria 1069
310 Ga0373931_0009212 3300035691 Unclassified 4716
311 Ga0373927_0341146 3300035695 Bacteria 987
312 Ga0373933_0007043 3300035724 Bacteria 6129
313 Ga0373933_0351725 3300035724 Bacteria 957
314 Ga0373937_0003266 3300036401 Bacteria 13605
315 Ga0373937_0024531 3300036401 Bacteria 5441
316 Ga0373937_0046740 3300036401 Bacteria 3959
317 Ga0373937_0069542 3300036401 Bacteria 3246
318 Ga0373937_0078455 3300036401 Bacteria 3052
319 Ga0373937_0105799 3300036401 Bacteria 2615
320 Ga0373937_0317131 3300036401 Unclassified 1475
321 Ga0373925_0013988 3300037068 Bacteria 5809
322 Ga0451577_0105664 3300042876 Unclassified 2517
323 Ga0451576_0040403 3300045051 Unclassified 4938
324 Ga0451576_0241026 3300045051 Unclassified 1889
325 Ga0495592_0021663 3300046454 Bacteria 4888
326 Ga0495603_0007270 3300046455 Bacteria 6653
327 Ga0495629_0041438 3300046459 Bacteria 3240
328 Ga0495580_0014089 3300046472 Bacteria 6080
329 Ga0495580_0020410 3300046472 Unclassified 4902
330 Ga0495580_0238625 3300046472 Bacteria 1247
331 Ga0495582_0002696 3300046473 Bacteria 9911
332 Ga0495582_0310508 3300046473 Unclassified 907
333 Ga0495662_0038734 3300046476 Bacteria 2304
334 Ga0495594_0017144 3300046499 Bacteria 3823
335 Ga0495618_0024830 3300046514 Bacteria 3716
336 Ga0495618_0218898 3300046514 Unclassified 1202
337 Ga0495621_0000608 3300046539 Bacteria 8970
338 Ga0495621_0004092 3300046539 Bacteria 4063
339 Ga0495634_0055614 3300046642 Bacteria 2646
340 Ga0495659_0018623 3300046664 Bacteria 2315
341 Ga0495659_0077375 3300046664 Bacteria 1256
342 Ga0495588_0003706 3300046674 Bacteria 6691
343 Ga0495599_0023562 3300046678 Bacteria 3849
344 Ga0495658_0057067 3300046683 Bacteria 2229
345 Ga0495658_0057617 3300046683 Bacteria 2220
346 Ga0495658_0116140 3300046683 Bacteria 1614
347 Ga0495658_0144689 3300046683 Bacteria 1456
348 Ga0495669_0035768 3300046684 Bacteria 2193
349 Ga0495613_0034453 3300046689 Bacteria 3760
350 Ga0495613_0058813 3300046689 Unclassified 2820
351 Ga0495613_0132850 3300046689 Bacteria 1782
352 Ga0495636_0003219 3300047318 Bacteria 6332
353 Ga0495674_0017256 3300047319 Bacteria 6716
354 Ga0495677_0012601 3300047445 Unclassified 3082
355 Ga0495684_0203685 3300047471 Bacteria 1458
356 Ga0495602_0046621 3300048088 Bacteria 3913
357 Ga0496112_0429159 3300048915 Bacteria 1260
358 Ga0501068_0265178 3300049584 Bacteria 1096
359 nmdc:mga05p37_212283_c1 3300050507 Unclassified 2339
360 nmdc:mga05p37_35152_c1 3300050507 Bacteria 6143
361 nmdc:mga05p37_3758_c1 3300050507 Bacteria 17772
362 nmdc:mga05p37_418951_c1 3300050507 Bacteria 1559
363 nmdc:mga05p37_64961_c1 3300050507 Unclassified 4491
364 nmdc:mga08y16_175472_c1 3300050511 Bacteria 2225
365 nmdc:mga08y16_189902_c1 3300050511 Bacteria 2131
366 nmdc:mga0n895_121113_c1 3300050512 Bacteria 2638
367 nmdc:mga0n895_454100_c1 3300050512 Bacteria 1294
368 nmdc:mga0n895_84300_c1 3300050512 Bacteria 3171
369 nmdc:mga0rr50_50626_c1 3300050513 Bacteria 3078
370 nmdc:mga0rr50_77687_c1 3300050513 Bacteria 2552
371 nmdc:mga0rr50_80617_c1 3300050513 Unclassified 2510
372 nmdc:mga0a205_116358_c1 3300050515 Unclassified 2572
373 nmdc:mga0a205_178306_c1 3300050515 Bacteria 2020
374 nmdc:mga0a205_33748_c1 3300050515 Unclassified 4907
375 nmdc:mga0a205_400793_c1 3300050515 Unclassified 1236
376 nmdc:mga0a205_72322_c1 3300050515 Bacteria 3331
377 Ga0105243_10031132
378 Ga0065704_10005945
379 Ga0065715_10256234
380 Ga0070658_10160490
381 Ga0070676_10057636
382 Ga0070676_10353771
383 Ga0070683_100065250
384 Ga0070683_100222424
385 Ga0070683_100231047
386 Ga0070683_100322547
387 Ga0070670_100003391
388 Ga0070666_10038698
389 Ga0070680_100535568
390 Ga0068868_100038774
391 Ga0070689_100024118
392 Ga0070689_100638290
393 Ga0070691_10006581
394 Ga0070687_100024751
395 Ga0070661_100001592
396 Ga0070661_100053062
397 Ga0070669_100269669
398 Ga0070675_100002358
399 Ga0070671_100006329
400 Ga0070671_100009793
401 Ga0070671_100017807
402 Ga0070673_100012113
403 Ga0070673_100040705
404 Ga0070688_100025582
405 Ga0070688_100060726
406 Ga0070688_100164146
407 Ga0070688_100250331
408 Ga0070667_100025023
409 Ga0070667_100177238
410 Ga0070709_10420846
411 Ga0070713_100012377
412 Ga0070701_10086014
413 Ga0070711_100062231
414 Ga0070711_100075450
415 Ga0070705_100001283
416 Ga0070705_100189061
417 Ga0070694_100019559
418 Ga0070694_100054922
419 Ga0070694_100130161
420 Ga0070678_100066132
421 Ga0070681_10006223
422 Ga0070681_10127031
423 Ga0070681_10342372
424 Ga0068867_100070795
425 Ga0068867_100135607
426 Ga0068867_100169528
427 Ga0070707_100026412
428 Ga0070707_100053908
429 Ga0070707_100105034
430 Ga0070707_100170533
431 Ga0070698_100028550
432 Ga0070699_100003725
433 Ga0070699_100009237
434 Ga0070679_100001380
435 Ga0070684_100014336
436 Ga0070684_100031178
437 Ga0070684_100034355
438 Ga0070684_100125976
439 Ga0070684_100125982
440 Ga0070684_100356009
441 Ga0070684_100411987
442 Ga0070697_100191054
443 Ga0070672_100000492
444 Ga0070672_100267741
445 Ga0070695_100000040
446 Ga0070695_100017605
447 Ga0070696_100011888
448 Ga0070696_100021687
449 Ga0070696_100026946
450 Ga0070704_100113584
451 Ga0070704_100177594
452 Ga0068855_100032315
453 Ga0068855_100034343
454 Ga0068855_100177721
455 Ga0068855_100348290
456 Ga0068855_100367359
457 Ga0070664_100000375
458 Ga0070664_100621154
459 Ga0068857_100157174
460 Ga0068854_100133344
461 Ga0068856_100010295
462 Ga0068856_100033036
463 Ga0068856_100111778
464 Ga0068856_100136149
465 Ga0068856_100953465
466 Ga0070702_100032657
467 Ga0070702_100080344
468 Ga0070702_100149068
469 Ga0070702_100342208
470 Ga0068852_100048043
471 Ga0068859_100040877
472 Ga0068859_100100431
473 Ga0068859_100271493
474 Ga0068859_100623691
475 Ga0068859_101021654
476 Ga0068864_100000266
477 Ga0068864_100036731
478 Ga0068864_100157607
479 Ga0068864_100236838
480 Ga0068864_100390601
481 Ga0068864_100486979
482 Ga0068861_100108075
483 Ga0068870_10015205
484 Ga0068870_10045948
485 Ga0068863_100016677
486 Ga0068863_100068294
487 Ga0068863_100134672
488 Ga0068863_100402784
489 Ga0068858_100034217
490 Ga0068858_100080825
491 Ga0068858_100087019
492 Ga0068860_100028562
493 Ga0081539_10108193
494 Ga0075432_10012326
495 Ga0097621_100090231
496 Ga0097621_100208946
497 Ga0097621_100270567
498 Ga0068871_100046657
499 Ga0068871_100108726
500 Ga0068871_100335501
501 Ga0075428_100005989
502 Ga0075431_100114121
503 Ga0075433_10007809
504 Ga0075433_10069962
505 Ga0075433_10071665
506 Ga0075433_10163142
507 Ga0075433_10197483
508 Ga0075434_100017355
509 Ga0075434_100019256
510 Ga0075434_100022837
511 Ga0075434_100081530
512 Ga0075434_100351838
513 Ga0075429_100130298
514 Ga0075429_100237096
515 Ga0068865_100116178
516 Ga0075436_100058860
517 Ga0097620_100040879
518 Ga0097620_100100430
519 Ga0097620_100271488
520 Ga0097620_100623764
521 Ga0097620_101021658
522 Ga0075435_100008907
523 Ga0075435_100075476
524 Ga0075435_100204490
525 Ga0075435_100252014
526 Ga0105240_10006183
527 Ga0105240_10041845
528 Ga0105240_10050375
529 Ga0105240_10055604
530 Ga0111539_10227710
531 Ga0111539_10541026
532 Ga0105245_10383280
533 Ga0114129_10002091
534 Ga0114129_10003679
535 Ga0114129_10011081
536 Ga0114129_10014604
537 Ga0114129_10232677
538 Ga0114129_10277847
539 Ga0105241_10006364
540 Ga0105241_10105902
541 Ga0105241_10236017
542 Ga0105242_10048706
543 Ga0105242_10077510
544 Ga0105242_10174697
545 Ga0105242_10423995
546 Ga0105248_10005808
547 Ga0105248_10022724
548 Ga0105248_10047891
549 Ga0105248_10275847
550 Ga0105248_10674704
551 Ga0105237_10059513
552 Ga0105237_10631743
553 Ga0105238_10006512
554 Ga0105238_10016341
555 Ga0105238_10028785
556 Ga0105238_10168955
557 Ga0105249_10054499
558 Ga0105239_10004784
559 Ga0105239_10151319
560 Ga0105239_10169859
561 Ga0105246_10076513
562 Ga0105246_10165152
563 Ga0157373_10272515
564 Ga0157371_10055514
565 Ga0157370_10032070
566 Ga0157369_10035247
567 Ga0157369_10043975
568 Ga0157369_10253603
569 Ga0157374_10088961
570 Ga0163162_10002636
571 Ga0163162_10265749
572 Ga0157372_10726177
573 Ga0157372_10737976
574 Ga0157375_10003478
575 Ga0157375_10022220
576 Ga0157375_10082672
577 Ga0163163_10029784
578 Ga0163163_10083691
579 Ga0163163_10629341
580 Ga0157377_10027942
581 Ga0157377_10059221
582 Ga0157376_10312351
583 Ga0157376_10615901
584 Ga0207688_10157704
585 Ga0207680_10028390
586 Ga0207699_10284780
587 Ga0207645_10024668
588 Ga0207645_10175015
589 Ga0207643_10007134
590 Ga0207643_10008526
591 Ga0207705_10124798
592 Ga0207654_10067181
593 Ga0207654_10140567
594 Ga0207707_10001650
595 Ga0207707_10014485
596 Ga0207695_10004336
597 Ga0207695_10142931
598 Ga0207695_10324973
599 Ga0207671_10043783
600 Ga0207660_10159125
601 Ga0207657_10196832
602 Ga0207657_10281174
603 Ga0207649_10011456
604 Ga0207649_10031660
605 Ga0207646_10071265
606 Ga0207646_10737677
607 Ga0207694_10034885
608 Ga0207694_10049441
609 Ga0207694_10057195
610 Ga0207650_10009918
611 Ga0207659_10000251
612 Ga0207687_10003457
613 Ga0207687_10346878
614 Ga0207687_10420290
615 Ga0207687_10545733
616 Ga0207644_10011400
617 Ga0207644_10019933
618 Ga0207644_10158924
619 Ga0207644_10163466
620 Ga0207686_10005181
621 Ga0207686_10015849
622 Ga0207686_10021131
623 Ga0207686_10028320
624 Ga0207686_10111027
625 Ga0207686_10530057
626 Ga0207670_10005340
627 Ga0207670_10241275
628 Ga0207704_10049193
629 Ga0207691_10011456
630 Ga0207691_10216456
631 Ga0207691_10241396
632 Ga0207711_10001617
633 Ga0207711_10174282
634 Ga0207711_10278935
635 Ga0207661_10023692
636 Ga0207661_10025963
637 Ga0207661_10197092
638 Ga0207661_10199608
639 Ga0207661_10247230
640 Ga0207679_10381112
641 Ga0207667_10024788
642 Ga0207667_10038922
643 Ga0207651_10002230
644 Ga0207651_10020297
645 Ga0207651_10135513
646 Ga0207651_10409225
647 Ga0207712_10209980
648 Ga0207677_10106077
649 Ga0207703_10013438
650 Ga0207703_10020410
651 Ga0207703_10174098
652 Ga0207703_10680744
653 Ga0207639_10087237
654 Ga0207708_10321999
655 Ga0207702_10015197
656 Ga0207702_10336912
657 Ga0207641_10049271
658 Ga0207641_10094577
659 Ga0207641_10228122
660 Ga0207641_10354054
661 Ga0207648_10072227
662 Ga0207648_10186331
663 Ga0207676_10000463
664 Ga0207676_10006825
665 Ga0207676_10257092
666 Ga0207676_10432119
667 Ga0207674_10001520
668 Ga0207674_10002333
669 Ga0207683_10041070
670 Ga0207698_10227442
671 Ga0207428_10019664
672 Ga0268265_10027784
673 Ga0265319_1023008
674 Ga0265338_10018468
675 Ga0265316_10259985
676 Ga0265313_10001559
677 Ga0265314_10007582
678 Ga0373934_0030683
679 Ga0373923_0045405
680 Ga0373953_0002645
681 Ga0373954_0001291
682 Ga0373954_0014557
683 Ga0373954_0190164
684 Ga0373955_0194281
685 Ga0373955_0247121
686 Ga0373931_0009212
687 Ga0373927_0341146
688 Ga0373933_0007043
689 Ga0373933_0351725
690 Ga0373937_0003266
691 Ga0373937_0024531
692 Ga0373937_0046740
693 Ga0373937_0069542
694 Ga0373937_0078455
695 Ga0373937_0105799
696 Ga0373937_0317131
697 Ga0373925_0013988
698 Ga0451577_0105664
699 Ga0451576_0040403
700 Ga0451576_0241026
701 Ga0495592_0021663
702 Ga0495603_0007270
703 Ga0495629_0041438
704 Ga0495580_0014089
705 Ga0495580_0020410
706 Ga0495580_0238625
707 Ga0495582_0002696
708 Ga0495582_0310508
709 Ga0495662_0038734
710 Ga0495594_0017144
711 Ga0495618_0024830
712 Ga0495618_0218898
713 Ga0495621_0000608
714 Ga0495621_0004092
715 Ga0495634_0055614
716 Ga0495659_0018623
717 Ga0495659_0077375
718 Ga0495588_0003706
719 Ga0495599_0023562
720 Ga0495658_0057067
721 Ga0495658_0057617
722 Ga0495658_0116140
723 Ga0495658_0144689
724 Ga0495669_0035768
725 Ga0495613_0034453
726 Ga0495613_0058813
727 Ga0495613_0132850
728 Ga0495636_0003219
729 Ga0495674_0017256
730 Ga0495677_0012601
731 Ga0495684_0203685
732 Ga0495602_0046621
733 Ga0496112_0429159
734 Ga0501068_0265178
735 nmdc:mga05p37_212283_c1
736 nmdc:mga05p37_35152_c1
737 nmdc:mga05p37_3758_c1
738 nmdc:mga05p37_418951_c1
739 nmdc:mga05p37_64961_c1
740 nmdc:mga08y16_175472_c1
741 nmdc:mga08y16_189902_c1
742 nmdc:mga0n895_121113_c1
743 nmdc:mga0n895_454100_c1
744 nmdc:mga0n895_84300_c1
745 nmdc:mga0rr50_50626_c1
746 nmdc:mga0rr50_77687_c1
747 nmdc:mga0rr50_80617_c1
748 nmdc:mga0a205_116358_c1
749 nmdc:mga0a205_178306_c1
750 nmdc:mga0a205_33748_c1
751 nmdc:mga0a205_400793_c1
752 nmdc:mga0a205_72322_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eej-assembly1.cif.gz_B streptomyces bingchenggensis aldolase-dehydratase in covalent complex with dienone product. 0.6098 38 268
5upb-assembly1.cif.gz_D swit_4259, an acetoacetate decarboxylase-like enzyme from sphingomonas wittichii rw1 0.6078 38 267
4jmc-assembly1.cif.gz_A-2 enduracididine biosynthesis enzyme mppr complexed with pyruvate 0.6052 27 266
4jm3-assembly1.cif.gz_B enduracididine biosynthesis enzyme mppr with hepes buffer bound 0.5901 27 268
4zbo-assembly1.cif.gz_D streptomyces bingchenggensis acetoacetate decarboxylase in non-covalent complex with potassium formate 0.5867 38 268
ID Description Score Start End Superfamily
af_O53564_9_236_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.6008 36 267 2.40.400.10
4jmcB00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.6003 27 266 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.5997 39 262 2.40.400.10
4zbtD00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.5897 36 268 2.40.400.10
af_O53564_9_236_2.40.400.10 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.5776 36 267 2.40.400.10
ID Description Score Start End GO Terms
AF-A0A2V8LNR3-F1-model_v4 Uncharacterized protein 0.9871 29 268
AF-A0A2V8DJD8-F1-model_v4 Uncharacterized protein 0.9646 118 268
AF-A0A4P5WG30-F1-model_v4 Uncharacterized protein 0.9519 28 268
AF-A0A537APD4-F1-model_v4 Uncharacterized protein 0.948 29 268
AF-A0A2V7H8K3-F1-model_v4 Uncharacterized protein 0.9343 27 268

Map