F425796

General Info

Members Datasets Scaffolds Average Seq Length
371 242 742 116

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_1108059|Ga0373937_1108059_286_705
Length 139
Sequence LLLIGRRIAYILQDSHRLLEEKSVLYLIIKALLSGIIVMAVSEIARRSPAFGALVVSLPLVSLLGILWLWRDTHDSARIAAHAEATFWYVLPSLPMFLAFPWMLRHGIGFWAAILGACLLTVVLYGVTVLVAARFGIRL

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
220 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
227 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
228 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
229 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
230 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
236 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
237 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
238 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
241 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
242 2643221651 Afipia sp. Root123D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.82
Nodule 0
Rhizoplane 1.89
Rhizosphere 87.33
Stem 0
Stem Tuber 0
Unclassified 5.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_1108059 3300036401 Bacteria 740
2 JGI25154J39366_1000356 3300002738 Bacteria 25874
3 JGI25159J45721_1001811 3300002987 Bacteria 8568
4 rootL2_10007162 3300003322 Bacteria 3655
5 rootH1_10249791 3300003323 Bacteria 5425
6 JGI25161J50226_1000290 3300003374 Bacteria 28301
7 Ga0055529_1000687 3300003763 Bacteria 23112
8 Ga0055526_1107197 3300003771 Bacteria 505
9 Ga0055543_1000390 3300004625 Bacteria 28339
10 Ga0065165_1003728 3300005262 Bacteria 10281
11 Ga0070658_10044204 3300005327 Bacteria 3599
12 Ga0070658_10411949 3300005327 Bacteria 1162
13 Ga0070683_100032853 3300005329 Bacteria 4729
14 Ga0070683_101647745 3300005329 Bacteria 617
15 Ga0070690_100355264 3300005330 Bacteria 1065
16 Ga0068869_100713729 3300005334 Bacteria 856
17 Ga0068868_100766390 3300005338 Bacteria 868
18 Ga0070660_100074410 3300005339 Bacteria 2658
19 Ga0070668_101246479 3300005347 Bacteria 675
20 Ga0070688_100177679 3300005365 Bacteria 1474
21 Ga0070659_100271882 3300005366 Bacteria 1408
22 Ga0070659_100385367 3300005366 Bacteria 1181
23 Ga0070667_100015213 3300005367 Bacteria 6357
24 Ga0070667_100669424 3300005367 Bacteria 959
25 Ga0070709_10118978 3300005434 Bacteria 1787
26 Ga0070709_11408611 3300005434 Bacteria 564
27 Ga0070714_101483713 3300005435 Bacteria 662
28 Ga0070713_100510948 3300005436 Bacteria 1134
29 Ga0070713_101905595 3300005436 Bacteria 577
30 Ga0070711_101464630 3300005439 Bacteria 595
31 Ga0070678_100949788 3300005456 Unclassified 788
32 Ga0070681_10217143 3300005458 Bacteria 1828
33 Ga0070685_10092545 3300005466 Unclassified 1832
34 Ga0070698_100132726 3300005471 Bacteria 2445
35 Ga0070684_100308280 3300005535 Bacteria 1453
36 Ga0070684_100510638 3300005535 Bacteria 1113
37 Ga0068853_100086050 3300005539 Bacteria 2756
38 Ga0068853_100121690 3300005539 Bacteria 2329
39 Ga0068853_100179741 3300005539 Bacteria 1918
40 Ga0070672_100114048 3300005543 Bacteria 2206
41 Ga0070696_100051304 3300005546 Bacteria 2869
42 Ga0070665_100001163 3300005548 Bacteria 32337
43 Ga0070665_100184590 3300005548 Bacteria 2086
44 Ga0070665_100398146 3300005548 Bacteria 1385
45 Ga0068855_100067603 3300005563 Bacteria 4161
46 Ga0068855_100149457 3300005563 Bacteria 2656
47 Ga0068855_100767378 3300005563 Bacteria 1027
48 Ga0068857_100495198 3300005577 Bacteria 1146
49 Ga0068854_100263822 3300005578 Bacteria 1380
50 Ga0068856_100087590 3300005614 Bacteria 3095
51 Ga0068856_100242418 3300005614 Bacteria 1818
52 Ga0068856_100460833 3300005614 Bacteria 1292
53 Ga0068864_100285934 3300005618 Bacteria 1540
54 Ga0068858_100028393 3300005842 Bacteria 5198
55 Ga0068860_100054348 3300005843 Bacteria 3806
56 Ga0081455_10000568 3300005937 Bacteria 48117
57 Ga0070712_100313099 3300006175 Unclassified 1274
58 Ga0097621_100547738 3300006237 Bacteria 1053
59 Ga0097621_101228655 3300006237 Unclassified 706
60 Ga0105240_10042270 3300009093 Bacteria 5809
61 Ga0105240_10233187 3300009093 Bacteria 2138
62 Ga0105240_10287871 3300009093 Bacteria 1885
63 Ga0105240_10538842 3300009093 Bacteria 1293
64 Ga0105240_10866476 3300009093 Bacteria 974
65 Ga0105241_10064198 3300009174 Bacteria 2834
66 Ga0105241_12399742 3300009174 Bacteria 526
67 Ga0105242_10357724 3300009176 Bacteria 1350
68 Ga0105248_10011999 3300009177 Bacteria 9555
69 Ga0105248_11391072 3300009177 Unclassified 794
70 Ga0105237_10199189 3300009545 Bacteria 2002
71 Ga0105238_10057917 3300009551 Bacteria 3884
72 Ga0105238_10169201 3300009551 Bacteria 2161
73 Ga0105238_10229760 3300009551 Bacteria 1832
74 Ga0105249_10790805 3300009553 Bacteria 1012
75 Ga0105239_10028910 3300010375 Bacteria 6093
76 Ga0105239_10088659 3300010375 Bacteria 3411
77 Ga0105239_10361176 3300010375 Bacteria 1640
78 Ga0105239_11376229 3300010375 Bacteria 814
79 Ga0105246_11609644 3300011119 Unclassified 614
80 Ga0157373_10853097 3300013100 Bacteria 674
81 Ga0157370_10019663 3300013104 Bacteria 6763
82 Ga0157370_10217625 3300013104 Bacteria 1769
83 Ga0157369_10181092 3300013105 Unclassified 2217
84 Ga0157369_10527294 3300013105 Bacteria 1222
85 Ga0157374_10058769 3300013296 Bacteria 3594
86 Ga0157378_10077387 3300013297 Bacteria 2998
87 Ga0163162_10037780 3300013306 Bacteria 4819
88 Ga0163162_10090049 3300013306 Bacteria 3149
89 Ga0157372_10034088 3300013307 Bacteria 5595
90 Ga0157372_10915888 3300013307 Bacteria 1017
91 Ga0157372_12243944 3300013307 Unclassified 627
92 Ga0163163_10000002 3300014325 Bacteria 609846
93 Ga0163163_10030266 3300014325 Bacteria 5214
94 Ga0182008_10749591 3300014497 Bacteria 562
95 Ga0157379_10671538 3300014968 Bacteria 971
96 Ga0157376_10775640 3300014969 Bacteria 970
97 Ga0157376_12397996 3300014969 Bacteria 567
98 Ga0209436_100611 3300025208 Bacteria 15291
99 Ga0209437_112368 3300025233 Bacteria 1247
100 Ga0209646_1000023 3300025246 Bacteria 441100
101 Ga0209455_1000026 3300025272 Bacteria 653778
102 Ga0209130_1000371 3300025284 Bacteria 50978
103 Ga0209564_1027589 3300025295 Bacteria 1840
104 Ga0209051_1057138 3300025303 Bacteria 1252
105 Ga0207656_10469851 3300025321 Bacteria 637
106 Ga0207680_10012045 3300025903 Bacteria 4394
107 Ga0207699_10184631 3300025906 Bacteria 1404
108 Ga0207699_10937457 3300025906 Bacteria 639
109 Ga0207705_10068773 3300025909 Bacteria 2564
110 Ga0207654_10973800 3300025911 Bacteria 616
111 Ga0207707_10203163 3300025912 Bacteria 1727
112 Ga0207695_10256846 3300025913 Bacteria 1646
113 Ga0207695_10681434 3300025913 Bacteria 909
114 Ga0207695_10700959 3300025913 Bacteria 893
115 Ga0207695_10759452 3300025913 Bacteria 850
116 Ga0207671_10457777 3300025914 Bacteria 1016
117 Ga0207693_10629828 3300025915 Bacteria 834
118 Ga0207663_10390297 3300025916 Bacteria 1062
119 Ga0207657_10019783 3300025919 Bacteria 6382
120 Ga0207652_10312531 3300025921 Bacteria 1418
121 Ga0207694_10047595 3300025924 Bacteria 3317
122 Ga0207694_10121443 3300025924 Bacteria 2086
123 Ga0207700_10064468 3300025928 Bacteria 2791
124 Ga0207664_10671329 3300025929 Bacteria 932
125 Ga0207670_11117678 3300025936 Bacteria 666
126 Ga0207691_10450061 3300025940 Bacteria 1096
127 Ga0207711_11531082 3300025941 Unclassified 610
128 Ga0207667_10047171 3300025949 Bacteria 4560
129 Ga0207667_10103129 3300025949 Bacteria 2942
130 Ga0207667_10514766 3300025949 Bacteria 1213
131 Ga0207658_10118984 3300025986 Unclassified 2102
132 Ga0207658_10634714 3300025986 Bacteria 962
133 Ga0207703_10032039 3300026035 Bacteria 4159
134 Ga0207639_10035827 3300026041 Bacteria 3674
135 Ga0207639_10654743 3300026041 Bacteria 972
136 Ga0207702_10042811 3300026078 Bacteria 3800
137 Ga0207702_10187008 3300026078 Bacteria 1911
138 Ga0207676_10121483 3300026095 Bacteria 2204
139 Ga0207674_10494093 3300026116 Bacteria 1182
140 Ga0207675_100400930 3300026118 Bacteria 1352
141 Ga0268266_10000798 3300028379 Bacteria 41871
142 Ga0268266_10085562 3300028379 Bacteria 2755
143 Ga0268266_10462575 3300028379 Bacteria 1207
144 Ga0268264_10088256 3300028381 Unclassified 2668
145 Ga0265338_10147792 3300028800 Bacteria 1831
146 Ga0265330_10003331 3300031235 Bacteria 8438
147 Ga0265330_10013391 3300031235 Bacteria 3823
148 Ga0265332_10056530 3300031238 Bacteria 1681
149 Ga0265325_10005565 3300031241 Bacteria 7774
150 Ga0265340_10004265 3300031247 Bacteria 8015
151 Ga0265339_10022090 3300031249 Bacteria 3691
152 Ga0265316_10084685 3300031344 Bacteria 2428
153 Ga0307408_100000132 3300031548 Bacteria 82821
154 Ga0265313_10028246 3300031595 Bacteria 2920
155 Ga0307508_10316072 3300031616 Bacteria 1154
156 Ga0265342_10015961 3300031712 Bacteria 4923
157 Ga0307406_10000506 3300031901 Bacteria 22379
158 Ga0373934_0019266 3300035086 Bacteria 2618
159 Ga0373923_0207302 3300035111 Bacteria 908
160 Ga0373923_0609140 3300035111 Bacteria 538
161 Ga0373936_0460394 3300035113 Bacteria 589
162 Ga0373953_0001143 3300035117 Bacteria 7540
163 Ga0373953_0002961 3300035117 Bacteria 5193
164 Ga0373954_0004638 3300035118 Bacteria 5927
165 Ga0373954_0025367 3300035118 Bacteria 2708
166 Ga0373954_0039914 3300035118 Bacteria 2186
167 Ga0373954_0048198 3300035118 Bacteria 1996
168 Ga0373956_0491810 3300035119 Bacteria 585
169 Ga0373957_0373455 3300035120 Unclassified 611
170 Ga0373960_0336446 3300035121 Bacteria 569
171 Ga0373943_0211377 3300035170 Bacteria 1077
172 Ga0373946_0029428 3300035171 Bacteria 2186
173 Ga0373955_0001448 3300035172 Bacteria 10077
174 Ga0373955_0091454 3300035172 Bacteria 1734
175 Ga0373924_0011781 3300035410 Bacteria 3254
176 Ga0373935_0185843 3300035692 Bacteria 1429
177 Ga0373927_1098419 3300035695 Unclassified 524
178 Ga0373933_0002851 3300035724 Bacteria 9651
179 Ga0373947_0022267 3300035725 Bacteria 3673
180 Ga0373937_0159444 3300036401 Bacteria 2115
181 Ga0373937_0169629 3300036401 Bacteria 2047
182 Ga0373937_0437473 3300036401 Bacteria 1241
183 Ga0373937_1035303 3300036401 Bacteria 770
184 Ga0373925_0032424 3300037068 Bacteria 3845
185 Ga0395900_0245058 3300037418 Bacteria 1796
186 Ga0395898_0067416 3300037466 Bacteria 3465
187 Ga0395898_1307687 3300037466 Bacteria 654
188 Ga0436365_1730888 3300039437 Bacteria 1494
189 Ga0451789_0594290 3300041443 Bacteria 1169
190 Ga0451793_0011978 3300041452 Bacteria 4618
191 Ga0451795_0209290 3300041456 Bacteria 550
192 Ga0451795_0630135 3300041456 Bacteria 544
193 Ga0466967_2418841 3300045976 Bacteria 520
194 Ga0495617_000002 3300046452 Bacteria 710121
195 Ga0495627_002837 3300046453 Bacteria 8019
196 Ga0495592_0309961 3300046454 Bacteria 1023
197 Ga0495603_0078409 3300046455 Bacteria 1937
198 Ga0495590_0348114 3300046457 Bacteria 563
199 Ga0495591_049076 3300046458 Bacteria 1161
200 Ga0495629_0003114 3300046459 Bacteria 12575
201 Ga0495629_0141609 3300046459 Bacteria 1673
202 Ga0495638_0097368 3300046460 Bacteria 1764
203 Ga0495651_0098867 3300046462 Bacteria 2176
204 Ga0495651_0113552 3300046462 Bacteria 1999
205 Ga0495653_0007589 3300046463 Bacteria 8868
206 Ga0495653_0028013 3300046463 Bacteria 4509
207 Ga0495605_0006745 3300046474 Bacteria 6564
208 Ga0495605_0076030 3300046474 Bacteria 1578
209 Ga0495664_0725821 3300046477 Bacteria 586
210 Ga0495584_0002044 3300046491 Bacteria 11603
211 Ga0495585_0085821 3300046492 Bacteria 1701
212 Ga0495585_0092102 3300046492 Bacteria 1631
213 Ga0495594_0007313 3300046499 Bacteria 5680
214 Ga0495596_0005819 3300046500 Bacteria 5772
215 Ga0495607_0011620 3300046501 Bacteria 5852
216 Ga0495607_0045884 3300046501 Bacteria 2568
217 Ga0495583_0003328 3300046506 Bacteria 12444
218 Ga0495606_0035289 3300046507 Bacteria 3420
219 Ga0495608_0031319 3300046511 Bacteria 3596
220 Ga0495608_0061566 3300046511 Bacteria 2467
221 Ga0495616_0000276 3300046513 Bacteria 41682
222 Ga0495616_0004348 3300046513 Bacteria 8939
223 Ga0495616_0160732 3300046513 Bacteria 1010
224 Ga0495618_0056411 3300046514 Bacteria 2487
225 Ga0495618_0197242 3300046514 Bacteria 1275
226 Ga0495618_0285541 3300046514 Bacteria 1028
227 Ga0495628_0012166 3300046516 Bacteria 7252
228 Ga0495628_0297473 3300046516 Bacteria 1195
229 Ga0495628_0373038 3300046516 Bacteria 1046
230 Ga0495630_0048202 3300046517 Bacteria 3188
231 Ga0495631_0008825 3300046518 Bacteria 5061
232 Ga0495631_0058478 3300046518 Bacteria 1676
233 Ga0495632_0003587 3300046519 Bacteria 10927
234 Ga0495644_0003419 3300046523 Bacteria 6283
235 Ga0495644_0040029 3300046523 Bacteria 1767
236 Ga0495648_0000193 3300046524 Bacteria 70395
237 Ga0495648_0020510 3300046524 Bacteria 4607
238 Ga0495648_0278258 3300046524 Bacteria 794
239 Ga0495642_0002852 3300046528 Bacteria 6896
240 Ga0495642_0042474 3300046528 Bacteria 1852
241 Ga0495642_0227086 3300046528 Bacteria 815
242 Ga0495652_0056914 3300046529 Bacteria 3318
243 Ga0495652_0171763 3300046529 Bacteria 1672
244 Ga0495654_0094851 3300046530 Bacteria 1380
245 Ga0495640_0053772 3300046533 Bacteria 2760
246 Ga0495640_0148305 3300046533 Bacteria 1508
247 Ga0495586_0087873 3300046535 Bacteria 1714
248 Ga0495587_0055558 3300046536 Bacteria 2331
249 Ga0495587_0074136 3300046536 Bacteria 1976
250 Ga0495609_0067236 3300046538 Bacteria 1578
251 Ga0495597_0022980 3300046542 Bacteria 2887
252 Ga0495597_0378207 3300046542 Bacteria 540
253 Ga0495645_0133154 3300046543 Bacteria 1740
254 Ga0495622_0005704 3300046557 Bacteria 5775
255 Ga0495622_0148663 3300046557 Bacteria 1061
256 Ga0495633_0193962 3300046558 Bacteria 933
257 Ga0495633_0203242 3300046558 Bacteria 909
258 Ga0495667_0000340 3300046559 Bacteria 29603
259 Ga0495667_0077697 3300046559 Bacteria 2159
260 Ga0495656_0006257 3300046615 Bacteria 4168
261 Ga0495668_0001068 3300046616 Bacteria 28928
262 Ga0495668_0006070 3300046616 Bacteria 8001
263 Ga0495668_0181966 3300046616 Bacteria 1151
264 Ga0495634_0004607 3300046642 Bacteria 10766
265 Ga0495634_0066505 3300046642 Bacteria 2386
266 Ga0495634_0463464 3300046642 Bacteria 746
267 Ga0495611_0008299 3300046648 Bacteria 4400
268 Ga0495611_0060878 3300046648 Bacteria 1715
269 Ga0495611_0417771 3300046648 Bacteria 612
270 Ga0495625_0021684 3300046660 Bacteria 4941
271 Ga0495625_0066005 3300046660 Bacteria 2550
272 Ga0495635_0010223 3300046663 Bacteria 6562
273 Ga0495635_0017331 3300046663 Bacteria 5032
274 Ga0495635_0200320 3300046663 Bacteria 1354
275 Ga0495661_0021701 3300046665 Bacteria 4182
276 Ga0495661_0030640 3300046665 Bacteria 3422
277 Ga0495661_0043334 3300046665 Bacteria 2767
278 Ga0495661_0215664 3300046665 Bacteria 997
279 Ga0495661_0340219 3300046665 Bacteria 741
280 Ga0495588_0013677 3300046674 Bacteria 3869
281 Ga0495588_0014357 3300046674 Bacteria 3790
282 Ga0495657_0076053 3300046675 Bacteria 2181
283 Ga0495657_0121518 3300046675 Bacteria 1644
284 Ga0495599_0001834 3300046678 Bacteria 12326
285 Ga0495623_0008930 3300046679 Bacteria 6507
286 Ga0495623_0058747 3300046679 Bacteria 2417
287 Ga0495646_0096151 3300046680 Bacteria 1703
288 Ga0495658_0630882 3300046683 Bacteria 686
289 Ga0495669_0002499 3300046684 Bacteria 7504
290 Ga0495669_0032255 3300046684 Bacteria 2302
291 Ga0495613_0056123 3300046689 Bacteria 2893
292 Ga0495613_0755944 3300046689 Bacteria 637
293 Ga0495613_0849891 3300046689 Unclassified 593
294 Ga0495613_1048044 3300046689 Bacteria 522
295 Ga0495624_0080888 3300046690 Bacteria 2013
296 Ga0495670_0018588 3300046691 Bacteria 3422
297 Ga0495670_0077085 3300046691 Bacteria 1694
298 Ga0495670_0215820 3300046691 Bacteria 1018
299 Ga0495671_0004188 3300046692 Bacteria 8688
300 Ga0495671_0015685 3300046692 Bacteria 4054
301 Ga0495671_0232883 3300046692 Bacteria 890
302 Ga0495600_0051239 3300046809 Bacteria 2694
303 Ga0495600_0193947 3300046809 Bacteria 1305
304 Ga0495660_0005828 3300046810 Bacteria 7352
305 Ga0495660_0089132 3300046810 Bacteria 1606
306 Ga0495581_0097020 3300047315 Bacteria 1712
307 Ga0495581_0851523 3300047315 Bacteria 522
308 Ga0495604_0107140 3300047317 Bacteria 2043
309 Ga0495604_0130094 3300047317 Bacteria 1810
310 Ga0495674_0002440 3300047319 Bacteria 18166
311 Ga0495674_0057262 3300047319 Bacteria 3411
312 Ga0495672_0097261 3300047320 Bacteria 1603
313 Ga0495672_0124456 3300047320 Bacteria 1365
314 Ga0495676_0000092 3300047321 Bacteria 66361
315 Ga0495676_0287802 3300047321 Bacteria 1111
316 Ga0495675_0020239 3300047444 Bacteria 4230
317 Ga0495675_0042032 3300047444 Bacteria 2911
318 Ga0495677_0000807 3300047445 Bacteria 12654
319 Ga0495677_0001844 3300047445 Bacteria 8468
320 Ga0495677_0096784 3300047445 Bacteria 1115
321 Ga0495684_0008414 3300047471 Bacteria 7992
322 Ga0495684_0042171 3300047471 Bacteria 3495
323 Ga0495684_0076918 3300047471 Bacteria 2534
324 Ga0495684_0080430 3300047471 Bacteria 2474
325 Ga0495686_0039004 3300047472 Bacteria 3037
326 Ga0495593_0010334 3300047673 Bacteria 5395
327 Ga0495602_0130695 3300048088 Bacteria 2003
328 Ga0495626_0027595 3300048091 Bacteria 2760
329 Ga0495626_0029825 3300048091 Bacteria 2636
330 Ga0495626_0434840 3300048091 Bacteria 505
331 Ga0496102_0000159 3300048905 Bacteria 91043
332 Ga0496103_0098236 3300048906 Bacteria 1851
333 Ga0496110_0566530 3300048913 Bacteria 1032
334 Ga0496118_0564931 3300048921 Bacteria 552
335 Ga0496121_0655030 3300048924 Bacteria 639
336 Ga0496124_0615862 3300048927 Bacteria 703
337 Ga0496126_0467907 3300048929 Bacteria 1012
338 Ga0501032_0228072 3300049569 Unclassified 1211
339 Ga0501037_0378129 3300049573 Unclassified 974
340 Ga0501038_0298733 3300049574 Unclassified 1264
341 Ga0501039_0248595 3300049575 Unclassified 1398
342 Ga0501043_0237881 3300049579 Bacteria 1405
343 Ga0501207_016330 3300049654 Bacteria 1150
344 Ga0501230_151041 3300049667 Unclassified 527
345 Ga0501035_0439531 3300049822 Bacteria 1081
346 Ga0495601_0279805 3300053077 Bacteria 1088
347 Ga0495601_0443789 3300053077 Bacteria 839
348 Ga0495612_0036933 3300053078 Bacteria 1983
349 Ga0495612_0078061 3300053078 Bacteria 1388
350 Ga0495595_0011500 3300053084 Bacteria 3701
351 Ga0495595_0038788 3300053084 Bacteria 2171
352 Ga0495619_0003325 3300053085 Bacteria 10391
353 Ga0495619_0053276 3300053085 Bacteria 2676
354 Ga0500647_0034915 3300053091 Bacteria 2403
355 Ga0500566_0000020 3300053094 Bacteria 83462
356 Ga0500640_002493 3300053095 Bacteria 6110
357 Ga0500572_000468 3300053111 Bacteria 14051
358 Ga0500591_006414 3300053115 Bacteria 5351
359 Ga0500608_070680 3300053122 Bacteria 1660
360 Ga0500614_007356 3300053123 Bacteria 2320
361 Ga0500559_0002379 3300053136 Bacteria 9793
362 Ga0500590_039382 3300053148 Bacteria 2437
363 Ga0500603_000219 3300053150 Bacteria 15061
364 Ga0500630_000308 3300053159 Bacteria 20300
365 Ga0500638_008888 3300053162 Bacteria 4310
366 Ga0500639_000066 3300053163 Bacteria 47938
367 Ga0500639_067663 3300053163 Bacteria 1827
368 Ga0500637_0028596 3300053178 Bacteria 3085
369 Ga0500576_081315 3300053725 Bacteria 1368
370 Ga0500596_000033 3300053735 Bacteria 18734
371 2644287085 2643221651 Bacteria 4798932
372 Ga0373937_1108059
373 JGI25154J39366_1000356
374 JGI25159J45721_1001811
375 rootL2_10007162
376 rootH1_10249791
377 JGI25161J50226_1000290
378 Ga0055529_1000687
379 Ga0055526_1107197
380 Ga0055543_1000390
381 Ga0065165_1003728
382 Ga0070658_10044204
383 Ga0070658_10411949
384 Ga0070683_100032853
385 Ga0070683_101647745
386 Ga0070690_100355264
387 Ga0068869_100713729
388 Ga0068868_100766390
389 Ga0070660_100074410
390 Ga0070668_101246479
391 Ga0070688_100177679
392 Ga0070659_100271882
393 Ga0070659_100385367
394 Ga0070667_100015213
395 Ga0070667_100669424
396 Ga0070709_10118978
397 Ga0070709_11408611
398 Ga0070714_101483713
399 Ga0070713_100510948
400 Ga0070713_101905595
401 Ga0070711_101464630
402 Ga0070678_100949788
403 Ga0070681_10217143
404 Ga0070685_10092545
405 Ga0070698_100132726
406 Ga0070684_100308280
407 Ga0070684_100510638
408 Ga0068853_100086050
409 Ga0068853_100121690
410 Ga0068853_100179741
411 Ga0070672_100114048
412 Ga0070696_100051304
413 Ga0070665_100001163
414 Ga0070665_100184590
415 Ga0070665_100398146
416 Ga0068855_100067603
417 Ga0068855_100149457
418 Ga0068855_100767378
419 Ga0068857_100495198
420 Ga0068854_100263822
421 Ga0068856_100087590
422 Ga0068856_100242418
423 Ga0068856_100460833
424 Ga0068864_100285934
425 Ga0068858_100028393
426 Ga0068860_100054348
427 Ga0081455_10000568
428 Ga0070712_100313099
429 Ga0097621_100547738
430 Ga0097621_101228655
431 Ga0105240_10042270
432 Ga0105240_10233187
433 Ga0105240_10287871
434 Ga0105240_10538842
435 Ga0105240_10866476
436 Ga0105241_10064198
437 Ga0105241_12399742
438 Ga0105242_10357724
439 Ga0105248_10011999
440 Ga0105248_11391072
441 Ga0105237_10199189
442 Ga0105238_10057917
443 Ga0105238_10169201
444 Ga0105238_10229760
445 Ga0105249_10790805
446 Ga0105239_10028910
447 Ga0105239_10088659
448 Ga0105239_10361176
449 Ga0105239_11376229
450 Ga0105246_11609644
451 Ga0157373_10853097
452 Ga0157370_10019663
453 Ga0157370_10217625
454 Ga0157369_10181092
455 Ga0157369_10527294
456 Ga0157374_10058769
457 Ga0157378_10077387
458 Ga0163162_10037780
459 Ga0163162_10090049
460 Ga0157372_10034088
461 Ga0157372_10915888
462 Ga0157372_12243944
463 Ga0163163_10000002
464 Ga0163163_10030266
465 Ga0182008_10749591
466 Ga0157379_10671538
467 Ga0157376_10775640
468 Ga0157376_12397996
469 Ga0209436_100611
470 Ga0209437_112368
471 Ga0209646_1000023
472 Ga0209455_1000026
473 Ga0209130_1000371
474 Ga0209564_1027589
475 Ga0209051_1057138
476 Ga0207656_10469851
477 Ga0207680_10012045
478 Ga0207699_10184631
479 Ga0207699_10937457
480 Ga0207705_10068773
481 Ga0207654_10973800
482 Ga0207707_10203163
483 Ga0207695_10256846
484 Ga0207695_10681434
485 Ga0207695_10700959
486 Ga0207695_10759452
487 Ga0207671_10457777
488 Ga0207693_10629828
489 Ga0207663_10390297
490 Ga0207657_10019783
491 Ga0207652_10312531
492 Ga0207694_10047595
493 Ga0207694_10121443
494 Ga0207700_10064468
495 Ga0207664_10671329
496 Ga0207670_11117678
497 Ga0207691_10450061
498 Ga0207711_11531082
499 Ga0207667_10047171
500 Ga0207667_10103129
501 Ga0207667_10514766
502 Ga0207658_10118984
503 Ga0207658_10634714
504 Ga0207703_10032039
505 Ga0207639_10035827
506 Ga0207639_10654743
507 Ga0207702_10042811
508 Ga0207702_10187008
509 Ga0207676_10121483
510 Ga0207674_10494093
511 Ga0207675_100400930
512 Ga0268266_10000798
513 Ga0268266_10085562
514 Ga0268266_10462575
515 Ga0268264_10088256
516 Ga0265338_10147792
517 Ga0265330_10003331
518 Ga0265330_10013391
519 Ga0265332_10056530
520 Ga0265325_10005565
521 Ga0265340_10004265
522 Ga0265339_10022090
523 Ga0265316_10084685
524 Ga0307408_100000132
525 Ga0265313_10028246
526 Ga0307508_10316072
527 Ga0265342_10015961
528 Ga0307406_10000506
529 Ga0373934_0019266
530 Ga0373923_0207302
531 Ga0373923_0609140
532 Ga0373936_0460394
533 Ga0373953_0001143
534 Ga0373953_0002961
535 Ga0373954_0004638
536 Ga0373954_0025367
537 Ga0373954_0039914
538 Ga0373954_0048198
539 Ga0373956_0491810
540 Ga0373957_0373455
541 Ga0373960_0336446
542 Ga0373943_0211377
543 Ga0373946_0029428
544 Ga0373955_0001448
545 Ga0373955_0091454
546 Ga0373924_0011781
547 Ga0373935_0185843
548 Ga0373927_1098419
549 Ga0373933_0002851
550 Ga0373947_0022267
551 Ga0373937_0159444
552 Ga0373937_0169629
553 Ga0373937_0437473
554 Ga0373937_1035303
555 Ga0373925_0032424
556 Ga0395900_0245058
557 Ga0395898_0067416
558 Ga0395898_1307687
559 Ga0436365_1730888
560 Ga0451789_0594290
561 Ga0451793_0011978
562 Ga0451795_0209290
563 Ga0451795_0630135
564 Ga0466967_2418841
565 Ga0495617_000002
566 Ga0495627_002837
567 Ga0495592_0309961
568 Ga0495603_0078409
569 Ga0495590_0348114
570 Ga0495591_049076
571 Ga0495629_0003114
572 Ga0495629_0141609
573 Ga0495638_0097368
574 Ga0495651_0098867
575 Ga0495651_0113552
576 Ga0495653_0007589
577 Ga0495653_0028013
578 Ga0495605_0006745
579 Ga0495605_0076030
580 Ga0495664_0725821
581 Ga0495584_0002044
582 Ga0495585_0085821
583 Ga0495585_0092102
584 Ga0495594_0007313
585 Ga0495596_0005819
586 Ga0495607_0011620
587 Ga0495607_0045884
588 Ga0495583_0003328
589 Ga0495606_0035289
590 Ga0495608_0031319
591 Ga0495608_0061566
592 Ga0495616_0000276
593 Ga0495616_0004348
594 Ga0495616_0160732
595 Ga0495618_0056411
596 Ga0495618_0197242
597 Ga0495618_0285541
598 Ga0495628_0012166
599 Ga0495628_0297473
600 Ga0495628_0373038
601 Ga0495630_0048202
602 Ga0495631_0008825
603 Ga0495631_0058478
604 Ga0495632_0003587
605 Ga0495644_0003419
606 Ga0495644_0040029
607 Ga0495648_0000193
608 Ga0495648_0020510
609 Ga0495648_0278258
610 Ga0495642_0002852
611 Ga0495642_0042474
612 Ga0495642_0227086
613 Ga0495652_0056914
614 Ga0495652_0171763
615 Ga0495654_0094851
616 Ga0495640_0053772
617 Ga0495640_0148305
618 Ga0495586_0087873
619 Ga0495587_0055558
620 Ga0495587_0074136
621 Ga0495609_0067236
622 Ga0495597_0022980
623 Ga0495597_0378207
624 Ga0495645_0133154
625 Ga0495622_0005704
626 Ga0495622_0148663
627 Ga0495633_0193962
628 Ga0495633_0203242
629 Ga0495667_0000340
630 Ga0495667_0077697
631 Ga0495656_0006257
632 Ga0495668_0001068
633 Ga0495668_0006070
634 Ga0495668_0181966
635 Ga0495634_0004607
636 Ga0495634_0066505
637 Ga0495634_0463464
638 Ga0495611_0008299
639 Ga0495611_0060878
640 Ga0495611_0417771
641 Ga0495625_0021684
642 Ga0495625_0066005
643 Ga0495635_0010223
644 Ga0495635_0017331
645 Ga0495635_0200320
646 Ga0495661_0021701
647 Ga0495661_0030640
648 Ga0495661_0043334
649 Ga0495661_0215664
650 Ga0495661_0340219
651 Ga0495588_0013677
652 Ga0495588_0014357
653 Ga0495657_0076053
654 Ga0495657_0121518
655 Ga0495599_0001834
656 Ga0495623_0008930
657 Ga0495623_0058747
658 Ga0495646_0096151
659 Ga0495658_0630882
660 Ga0495669_0002499
661 Ga0495669_0032255
662 Ga0495613_0056123
663 Ga0495613_0755944
664 Ga0495613_0849891
665 Ga0495613_1048044
666 Ga0495624_0080888
667 Ga0495670_0018588
668 Ga0495670_0077085
669 Ga0495670_0215820
670 Ga0495671_0004188
671 Ga0495671_0015685
672 Ga0495671_0232883
673 Ga0495600_0051239
674 Ga0495600_0193947
675 Ga0495660_0005828
676 Ga0495660_0089132
677 Ga0495581_0097020
678 Ga0495581_0851523
679 Ga0495604_0107140
680 Ga0495604_0130094
681 Ga0495674_0002440
682 Ga0495674_0057262
683 Ga0495672_0097261
684 Ga0495672_0124456
685 Ga0495676_0000092
686 Ga0495676_0287802
687 Ga0495675_0020239
688 Ga0495675_0042032
689 Ga0495677_0000807
690 Ga0495677_0001844
691 Ga0495677_0096784
692 Ga0495684_0008414
693 Ga0495684_0042171
694 Ga0495684_0076918
695 Ga0495684_0080430
696 Ga0495686_0039004
697 Ga0495593_0010334
698 Ga0495602_0130695
699 Ga0495626_0027595
700 Ga0495626_0029825
701 Ga0495626_0434840
702 Ga0496102_0000159
703 Ga0496103_0098236
704 Ga0496110_0566530
705 Ga0496118_0564931
706 Ga0496121_0655030
707 Ga0496124_0615862
708 Ga0496126_0467907
709 Ga0501032_0228072
710 Ga0501037_0378129
711 Ga0501038_0298733
712 Ga0501039_0248595
713 Ga0501043_0237881
714 Ga0501207_016330
715 Ga0501230_151041
716 Ga0501035_0439531
717 Ga0495601_0279805
718 Ga0495601_0443789
719 Ga0495612_0036933
720 Ga0495612_0078061
721 Ga0495595_0011500
722 Ga0495595_0038788
723 Ga0495619_0003325
724 Ga0495619_0053276
725 Ga0500647_0034915
726 Ga0500566_0000020
727 Ga0500640_002493
728 Ga0500572_000468
729 Ga0500591_006414
730 Ga0500608_070680
731 Ga0500614_007356
732 Ga0500559_0002379
733 Ga0500590_039382
734 Ga0500603_000219
735 Ga0500630_000308
736 Ga0500638_008888
737 Ga0500639_000066
738 Ga0500639_067663
739 Ga0500637_0028596
740 Ga0500576_081315
741 Ga0500596_000033
742 2644287085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fn3-assembly1.cif.gz_C cryo-em structure of gamma secretase in class 1 of the apo- state ensemble 0.6138 38 111
5fn3-assembly1.cif.gz_C cryo-em structure of gamma secretase in class 1 of the apo- state ensemble 0.4254 38 111
5h5u-assembly1.cif.gz_4 mechanistic insights into the alternative translation termination by arfa and rf2 0.3238 17 110
5h5u-assembly1.cif.gz_4 mechanistic insights into the alternative translation termination by arfa and rf2 0.2689 17 110
ID Description Score Start End Superfamily
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7195 5 112 1.10.10.1740
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.701 5 112 1.10.10.1740
af_Q2FUQ7_4_112_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6984 5 112 1.10.10.1740
af_Q2FUQ6_7_117_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6797 5 112 1.10.10.1740
af_A0A1D8PST6_1_104_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.649 66 110 1.10.10.1740
ID Description Score Start End GO Terms
AF-V1DD11-F1-model_v4 deleted 0.9935 1 116
AF-A0A5F2AZQ4-F1-model_v4 DUF3147 family protein 0.9932 1 116 GO:0016020
AF-A0A2D7KX27-F1-model_v4 DUF3147 family protein 0.9868 1 116 GO:0016020
AF-V1DD11-F1-model_v4 deleted 0.985 1 116
AF-A0A2E3D9C0-F1-model_v4 DUF3147 family protein 0.9837 1 116 GO:0016020

Map