F424769

General Info

Members Datasets Scaffolds Average Seq Length
368 189 736 339

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0008560|Ga0373943_0008560_2376_3512
Length 378
Sequence MYFSFLLSHSYRSQRVNLSGTKRVGQFSFCYDFRMKTTLALLLLCAVLAPAQEKHARSPENPMEHLPENIEILTHFGERADISPDNQRVAFMAKSFGDAMVIDLKTRVITCLTCNVPAAAFLRVMHLVTGDYILIGPDHFEDIQTSRSRDNELWFLSKERGTKAVRLGQKMSEGAAISKTSLKISFSQLPAQAPDLAPGTSRLIIADLDLSGRTPRLINKKTVYESKDRNCVLEAQDFHDNDRKMTFTCYEEMGPHEDASVMGIDLATAEVTNFSKAPGTYNEPEGIFPDGLYTTVEGDRQCEWLGGERGHGNIDIWKLRLEGSGKDFTRLTHFNDYEGGKASNPVVSTDGRFMAFQVGRTDDPAGVGYGVLLYWFKK

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.16
Nodule 0
Rhizoplane 2.72
Rhizosphere 92.12
Stem 0
Stem Tuber 0
Unclassified 16.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0008560 3300035170 Bacteria 4586
2 Ga0070658_10008815 3300005327 Bacteria 8108
3 Ga0070676_10007134 3300005328 Bacteria 5984
4 Ga0070683_100012335 3300005329 Bacteria 7424
5 Ga0070683_100046775 3300005329 Bacteria 3998
6 Ga0070683_100051380 3300005329 Unclassified 3817
7 Ga0070670_100498224 3300005331 Unclassified 1083
8 Ga0068869_100002880 3300005334 Bacteria 10448
9 Ga0068869_100059975 3300005334 Bacteria 2787
10 Ga0070666_10092479 3300005335 Unclassified 2079
11 Ga0070680_100015519 3300005336 Bacteria 5975
12 Ga0070680_100057671 3300005336 Bacteria 3175
13 Ga0070680_100126984 3300005336 Bacteria 2131
14 Ga0068868_100014793 3300005338 Bacteria 5760
15 Ga0068868_100034414 3300005338 Bacteria 3911
16 Ga0070660_100060612 3300005339 Bacteria 2937
17 Ga0070660_100231025 3300005339 Bacteria 1505
18 Ga0070687_100051801 3300005343 Bacteria 2127
19 Ga0070661_100067974 3300005344 Unclassified 2619
20 Ga0070661_100094740 3300005344 Bacteria 2213
21 Ga0070659_100034300 3300005366 Bacteria 3947
22 Ga0070709_10180775 3300005434 Bacteria 1481
23 Ga0070714_100458931 3300005435 Unclassified 1211
24 Ga0070713_100155185 3300005436 Bacteria 2040
25 Ga0070713_100205147 3300005436 Bacteria 1782
26 Ga0070713_100268768 3300005436 Unclassified 1561
27 Ga0070711_100000908 3300005439 Bacteria 15590
28 Ga0070711_100036162 3300005439 Bacteria 3308
29 Ga0070705_100115043 3300005440 Bacteria 1726
30 Ga0070708_100037897 3300005445 Bacteria 4208
31 Ga0070662_100065785 3300005457 Bacteria 2658
32 Ga0070662_100092871 3300005457 Unclassified 2269
33 Ga0070681_10001727 3300005458 Bacteria 19563
34 Ga0070681_10009123 3300005458 Bacteria 9746
35 Ga0070681_10028785 3300005458 Bacteria 5584
36 Ga0070681_10121473 3300005458 Bacteria 2547
37 Ga0068867_100053043 3300005459 Unclassified 2994
38 Ga0068867_100095811 3300005459 Bacteria 2258
39 Ga0070706_100037599 3300005467 Bacteria 4470
40 Ga0070707_100013763 3300005468 Bacteria 7576
41 Ga0070699_100012220 3300005518 Bacteria 7410
42 Ga0070699_100110307 3300005518 Unclassified 2415
43 Ga0070679_100069938 3300005530 Bacteria 3501
44 Ga0070679_100280453 3300005530 Bacteria 1619
45 Ga0070684_100086704 3300005535 Bacteria 2779
46 Ga0070684_100102636 3300005535 Bacteria 2557
47 Ga0070697_100009465 3300005536 Bacteria 7614
48 Ga0068853_100038415 3300005539 Bacteria 4077
49 Ga0070686_100169983 3300005544 Bacteria 1541
50 Ga0070693_100004488 3300005547 Bacteria 6605
51 Ga0070693_100199223 3300005547 Unclassified 1299
52 Ga0070665_100475430 3300005548 Unclassified 1260
53 Ga0068855_100010344 3300005563 Bacteria 11252
54 Ga0068855_100010944 3300005563 Bacteria 10950
55 Ga0068855_100081215 3300005563 Unclassified 3758
56 Ga0068855_100210440 3300005563 Bacteria 2185
57 Ga0070664_100010310 3300005564 Bacteria 7583
58 Ga0070664_100095906 3300005564 Bacteria 2573
59 Ga0070664_100122618 3300005564 Bacteria 2277
60 Ga0070664_100217939 3300005564 Bacteria 1707
61 Ga0068857_100001196 3300005577 Bacteria 20253
62 Ga0068857_100012137 3300005577 Bacteria 7493
63 Ga0068854_100006179 3300005578 Bacteria 7603
64 Ga0068854_100012251 3300005578 Bacteria 5613
65 Ga0068854_100140282 3300005578 Bacteria 1854
66 Ga0068856_100001176 3300005614 Bacteria 27534
67 Ga0068856_100002136 3300005614 Bacteria 20486
68 Ga0068856_100005744 3300005614 Bacteria 12226
69 Ga0068856_100008720 3300005614 Bacteria 9865
70 Ga0068856_100012092 3300005614 Bacteria 8360
71 Ga0068856_100032346 3300005614 Bacteria 5120
72 Ga0068856_100107048 3300005614 Bacteria 2791
73 Ga0068852_100051583 3300005616 Bacteria 3531
74 Ga0068852_100067509 3300005616 Bacteria 3126
75 Ga0068852_100108841 3300005616 Unclassified 2515
76 Ga0068859_100117066 3300005617 Bacteria 2730
77 Ga0068864_100003981 3300005618 Bacteria 12166
78 Ga0068864_100022727 3300005618 Bacteria 5259
79 Ga0068864_100277460 3300005618 Bacteria 1563
80 Ga0068866_10017564 3300005718 Unclassified 3219
81 Ga0068866_10022351 3300005718 Bacteria 2926
82 Ga0068861_100297376 3300005719 Bacteria 1397
83 Ga0068851_10003773 3300005834 Bacteria 6777
84 Ga0068851_10071016 3300005834 Bacteria 1801
85 Ga0068858_100005827 3300005842 Bacteria 12033
86 Ga0068858_100024350 3300005842 Bacteria 5640
87 Ga0068858_100052119 3300005842 Unclassified 3785
88 Ga0068860_100002552 3300005843 Bacteria 19031
89 Ga0068860_100063270 3300005843 Bacteria 3514
90 Ga0068860_100394262 3300005843 Bacteria 1368
91 Ga0068862_100045919 3300005844 Bacteria 3728
92 Ga0070717_10011782 3300006028 Bacteria 6654
93 Ga0070717_10015748 3300006028 Bacteria 5844
94 Ga0070717_10021599 3300006028 Bacteria 5075
95 Ga0070717_10027057 3300006028 Bacteria 4582
96 Ga0070717_10035908 3300006028 Bacteria 4017
97 Ga0070717_10175607 3300006028 Bacteria 1865
98 Ga0070717_10243697 3300006028 Bacteria 1586
99 Ga0075365_10075171 3300006038 Bacteria 2279
100 Ga0075368_10042654 3300006042 Bacteria 1786
101 Ga0075364_10011650 3300006051 Bacteria 5347
102 Ga0075364_10056965 3300006051 Bacteria 2559
103 Ga0070715_10049341 3300006163 Bacteria 1803
104 Ga0070716_100073780 3300006173 Bacteria 2014
105 Ga0070712_100000430 3300006175 Bacteria 24028
106 Ga0070712_100193344 3300006175 Bacteria 1594
107 Ga0075362_10068065 3300006177 Unclassified 1621
108 Ga0075367_10003103 3300006178 Bacteria 7810
109 Ga0075367_10004165 3300006178 Bacteria 7015
110 Ga0075366_10017547 3300006195 Bacteria 4120
111 Ga0075366_10137004 3300006195 Unclassified 1478
112 Ga0097621_100000987 3300006237 Bacteria 19981
113 Ga0097621_100003780 3300006237 Bacteria 10485
114 Ga0097621_100030661 3300006237 Unclassified 4260
115 Ga0068871_100002713 3300006358 Bacteria 12083
116 Ga0068871_100005559 3300006358 Bacteria 8834
117 Ga0068871_100033615 3300006358 Bacteria 4063
118 Ga0068871_100072913 3300006358 Bacteria 2829
119 Ga0068871_100117388 3300006358 Bacteria 2244
120 Ga0068871_100140897 3300006358 Bacteria 2050
121 Ga0075430_100254207 3300006846 Bacteria 1456
122 Ga0075431_100326524 3300006847 Bacteria 1546
123 Ga0075434_100000332 3300006871 Bacteria 34006
124 Ga0075434_100127268 3300006871 Unclassified 2564
125 Ga0075434_100252681 3300006871 Bacteria 1782
126 Ga0075434_100290129 3300006871 Bacteria 1656
127 Ga0075434_100458591 3300006871 Bacteria 1296
128 Ga0068865_100037633 3300006881 Bacteria 3268
129 Ga0075436_100071949 3300006914 Unclassified 2392
130 Ga0097620_100117067 3300006931 Bacteria 2730
131 Ga0075435_100035919 3300007076 Unclassified 3935
132 Ga0105240_10011582 3300009093 Bacteria 12271
133 Ga0105240_10028690 3300009093 Bacteria 7262
134 Ga0105240_10107033 3300009093 Viruses 3391
135 Ga0111539_10010709 3300009094 Bacteria 11543
136 Ga0105245_10002405 3300009098 Bacteria 16925
137 Ga0105245_10030642 3300009098 Bacteria 4758
138 Ga0105245_10524608 3300009098 Bacteria 1203
139 Ga0114129_10226420 3300009147 Unclassified 2520
140 Ga0114129_10244366 3300009147 Bacteria 2412
141 Ga0105241_10025180 3300009174 Bacteria 4422
142 Ga0105242_10013969 3300009176 Bacteria 6214
143 Ga0105248_10005773 3300009177 Bacteria 13599
144 Ga0105248_10037569 3300009177 Bacteria 5418
145 Ga0105248_10093149 3300009177 Bacteria 3393
146 Ga0105237_10011879 3300009545 Bacteria 9208
147 Ga0105237_10053105 3300009545 Unclassified 4065
148 Ga0105238_10002713 3300009551 Bacteria 17625
149 Ga0105238_10053927 3300009551 Bacteria 4040
150 Ga0105238_10348231 3300009551 Bacteria 1470
151 Ga0105239_10048552 3300010375 Bacteria 4655
152 Ga0105239_10096731 3300010375 Bacteria 3262
153 Ga0105239_10113722 3300010375 Bacteria 3002
154 Ga0105239_10680271 3300010375 Bacteria 1176
155 Ga0157373_10001224 3300013100 Bacteria 19643
156 Ga0157373_10166306 3300013100 Bacteria 1552
157 Ga0157371_10007426 3300013102 Bacteria 8876
158 Ga0157371_10184421 3300013102 Bacteria 1493
159 Ga0157370_10000680 3300013104 Bacteria 42288
160 Ga0157370_10133425 3300013104 Bacteria 2316
161 Ga0157370_10325428 3300013104 Bacteria 1417
162 Ga0157369_10000226 3300013105 Bacteria 77681
163 Ga0157369_10005221 3300013105 Bacteria 15162
164 Ga0157369_10009227 3300013105 Bacteria 11284
165 Ga0157369_10009232 3300013105 Bacteria 11281
166 Ga0157369_10068363 3300013105 Bacteria 3816
167 Ga0157369_10080952 3300013105 Bacteria 3476
168 Ga0157369_10178161 3300013105 Bacteria 2237
169 Ga0157374_10000354 3300013296 Bacteria 42454
170 Ga0157374_10000422 3300013296 Bacteria 38332
171 Ga0157374_10003268 3300013296 Bacteria 13612
172 Ga0157374_10003688 3300013296 Bacteria 12873
173 Ga0157374_10005434 3300013296 Bacteria 10704
174 Ga0157374_10007151 3300013296 Bacteria 9509
175 Ga0157378_10000328 3300013297 Bacteria 46856
176 Ga0157378_10001741 3300013297 Bacteria 19520
177 Ga0157378_10013631 3300013297 Bacteria 7109
178 Ga0157378_10073452 3300013297 Bacteria 3075
179 Ga0163162_10005388 3300013306 Bacteria 12354
180 Ga0163162_10166949 3300013306 Bacteria 2325
181 Ga0163162_10207143 3300013306 Bacteria 2090
182 Ga0157372_10000321 3300013307 Bacteria 52711
183 Ga0157372_10000536 3300013307 Bacteria 41814
184 Ga0157372_10001132 3300013307 Bacteria 28947
185 Ga0157372_10001842 3300013307 Bacteria 22977
186 Ga0157372_10003983 3300013307 Bacteria 15854
187 Ga0157372_10025696 3300013307 Bacteria 6405
188 Ga0157372_10041459 3300013307 Bacteria 5091
189 Ga0157372_10074244 3300013307 Unclassified 3835
190 Ga0157372_10124995 3300013307 Bacteria 2957
191 Ga0163163_10000001 3300014325 Bacteria 622185
192 Ga0163163_10046403 3300014325 Bacteria 4268
193 Ga0157380_10021664 3300014326 Bacteria 4824
194 Ga0157379_10153057 3300014968 Bacteria 2080
195 Ga0157376_10041298 3300014969 Unclassified 3776
196 Ga0157376_10058251 3300014969 Unclassified 3235
197 Ga0157376_10101808 3300014969 Bacteria 2511
198 Ga0207656_10070812 3300025321 Bacteria 1549
199 Ga0207642_10021765 3300025899 Bacteria 2530
200 Ga0207680_10012583 3300025903 Unclassified 4315
201 Ga0207685_10034003 3300025905 Bacteria 1848
202 Ga0207699_10148310 3300025906 Bacteria 1549
203 Ga0207645_10007938 3300025907 Bacteria 7455
204 Ga0207645_10255562 3300025907 Bacteria 1160
205 Ga0207643_10032672 3300025908 Bacteria 2908
206 Ga0207705_10062444 3300025909 Bacteria 2691
207 Ga0207684_10021643 3300025910 Bacteria 5489
208 Ga0207654_10070660 3300025911 Bacteria 2073
209 Ga0207654_10130956 3300025911 Bacteria 1588
210 Ga0207707_10003239 3300025912 Bacteria 14458
211 Ga0207707_10003505 3300025912 Bacteria 13892
212 Ga0207707_10079433 3300025912 Bacteria 2864
213 Ga0207695_10002288 3300025913 Bacteria 28621
214 Ga0207695_10026176 3300025913 Bacteria 6512
215 Ga0207695_10116664 3300025913 Bacteria 2643
216 Ga0207671_10223237 3300025914 Unclassified 1476
217 Ga0207693_10000500 3300025915 Bacteria 35438
218 Ga0207693_10113145 3300025915 Bacteria 2129
219 Ga0207693_10206611 3300025915 Bacteria 1544
220 Ga0207663_10007538 3300025916 Bacteria 5648
221 Ga0207663_10059734 3300025916 Bacteria 2413
222 Ga0207660_10099380 3300025917 Unclassified 2171
223 Ga0207660_10110904 3300025917 Bacteria 2064
224 Ga0207662_10164929 3300025918 Unclassified 1418
225 Ga0207657_10046368 3300025919 Bacteria 3807
226 Ga0207649_10046743 3300025920 Unclassified 2661
227 Ga0207652_10014962 3300025921 Bacteria 6293
228 Ga0207646_10014223 3300025922 Bacteria 7565
229 Ga0207681_10140365 3300025923 Bacteria 1799
230 Ga0207694_10001427 3300025924 Bacteria 20483
231 Ga0207694_10026334 3300025924 Bacteria 4423
232 Ga0207687_10035675 3300025927 Unclassified 3384
233 Ga0207700_10001153 3300025928 Bacteria 15186
234 Ga0207700_10368141 3300025928 Bacteria 1254
235 Ga0207664_10015159 3300025929 Bacteria 5585
236 Ga0207706_10169619 3300025933 Bacteria 1918
237 Ga0207686_10023149 3300025934 Bacteria 3584
238 Ga0207686_10040918 3300025934 Unclassified 2822
239 Ga0207709_10043485 3300025935 Bacteria 2708
240 Ga0207665_10019141 3300025939 Unclassified 4499
241 Ga0207665_10033955 3300025939 Bacteria 3384
242 Ga0207711_10015938 3300025941 Bacteria 6234
243 Ga0207711_10031683 3300025941 Bacteria 4465
244 Ga0207711_10125099 3300025941 Bacteria 2299
245 Ga0207689_10026913 3300025942 Bacteria 4814
246 Ga0207689_10040436 3300025942 Bacteria 3859
247 Ga0207661_10074582 3300025944 Unclassified 2781
248 Ga0207679_10017126 3300025945 Unclassified 4825
249 Ga0207679_10138232 3300025945 Bacteria 1965
250 Ga0207679_10161481 3300025945 Bacteria 1835
251 Ga0207679_10326555 3300025945 Bacteria 1330
252 Ga0207667_10000934 3300025949 Bacteria 37249
253 Ga0207667_10013442 3300025949 Bacteria 9368
254 Ga0207667_10056465 3300025949 Bacteria 4125
255 Ga0207668_10121330 3300025972 Unclassified 1980
256 Ga0207640_10053746 3300025981 Bacteria 2630
257 Ga0207640_10077701 3300025981 Bacteria 2257
258 Ga0207640_10238934 3300025981 Bacteria 1403
259 Ga0207677_10008724 3300026023 Bacteria 5676
260 Ga0207677_10046707 3300026023 Bacteria 2901
261 Ga0207703_10013654 3300026035 Bacteria 6329
262 Ga0207703_10051370 3300026035 Bacteria 3340
263 Ga0207703_10052293 3300026035 Bacteria 3316
264 Ga0207703_10112092 3300026035 Unclassified 2330
265 Ga0207639_10210420 3300026041 Bacteria 1674
266 Ga0207702_10002369 3300026078 Bacteria 17997
267 Ga0207702_10010326 3300026078 Bacteria 7822
268 Ga0207702_10016542 3300026078 Bacteria 6104
269 Ga0207702_10020949 3300026078 Bacteria 5411
270 Ga0207702_10117546 3300026078 Bacteria 2374
271 Ga0207702_10177363 3300026078 Bacteria 1959
272 Ga0207702_10320273 3300026078 Unclassified 1476
273 Ga0207648_10005191 3300026089 Bacteria 13189
274 Ga0207648_10046654 3300026089 Bacteria 3799
275 Ga0207648_10053711 3300026089 Unclassified 3521
276 Ga0207674_10001650 3300026116 Bacteria 28701
277 Ga0207674_10253365 3300026116 Bacteria 1707
278 Ga0207674_10365009 3300026116 Bacteria 1396
279 Ga0207698_10033805 3300026142 Bacteria 3720
280 Ga0207698_10045100 3300026142 Bacteria 3318
281 Ga0207698_10147434 3300026142 Unclassified 2037
282 Ga0268266_10026976 3300028379 Bacteria 4887
283 Ga0268266_10466492 3300028379 Unclassified 1202
284 Ga0268264_10017075 3300028381 Bacteria 5944
285 Ga0268264_10087272 3300028381 Bacteria 2682
286 Ga0265338_10026484 3300028800 Bacteria 5845
287 Ga0265332_10003652 3300031238 Bacteria 7371
288 Ga0265325_10001034 3300031241 Bacteria 20055
289 Ga0265329_10007456 3300031242 Unclassified 4228
290 Ga0265316_10008025 3300031344 Bacteria 9854
291 Ga0265314_10000139 3300031711 Bacteria 108861
292 Ga0265342_10002531 3300031712 Bacteria 15727
293 Ga0373938_0058931 3300034957 Unclassified 894
294 Ga0373956_0003436 3300035119 Bacteria 6378
295 Ga0373943_0124865 3300035170 Bacteria 1371
296 Ga0373955_0008877 3300035172 Bacteria 4688
297 Ga0373931_0021882 3300035691 Bacteria 3212
298 Ga0373935_0059740 3300035692 Bacteria 2438
299 Ga0373927_0005639 3300035695 Bacteria 8603
300 Ga0373933_0008229 3300035724 Bacteria 5691
301 Ga0373947_0005771 3300035725 Bacteria 7223
302 Ga0373947_0084125 3300035725 Unclassified 1974
303 Ga0373937_0002484 3300036401 Bacteria 15325
304 Ga0373937_0026444 3300036401 Bacteria 5245
305 Ga0373937_0054376 3300036401 Bacteria 3674
306 Ga0373937_0149818 3300036401 Unclassified 2185
307 Ga0373937_0170078 3300036401 Bacteria 2045
308 Ga0373937_0452774 3300036401 Bacteria 1219
309 Ga0373925_0065271 3300037068 Bacteria 2742
310 Ga0373925_0092981 3300037068 Unclassified 2308
311 Ga0373925_0239222 3300037068 Bacteria 1453
312 Ga0395900_0128215 3300037418 Bacteria 2601
313 Ga0395898_0240909 3300037466 Bacteria 1725
314 Ga0451576_0004212 3300045051 Bacteria 18913
315 Ga0451576_0026942 3300045051 Bacteria 6176
316 Ga0451576_0332595 3300045051 Unclassified 1590
317 Ga0495651_0045434 3300046462 Bacteria 3403
318 Ga0495580_0010300 3300046472 Bacteria 7291
319 Ga0495628_0159464 3300046516 Unclassified 1715
320 Ga0495667_0010600 3300046559 Bacteria 6236
321 Ga0495657_0191208 3300046675 Unclassified 1251
322 Ga0495604_0045548 3300047317 Bacteria 3423
323 Ga0495674_0077463 3300047319 Bacteria 2859
324 Ga0495602_0138286 3300048088 Bacteria 1932
325 Ga0496104_0043521 3300048907 Bacteria 4217
326 Ga0496104_0538352 3300048907 Unclassified 1079
327 Ga0496105_0012572 3300048908 Bacteria 6707
328 Ga0496105_0157597 3300048908 Bacteria 1864
329 Ga0496107_0122615 3300048910 Unclassified 1915
330 Ga0496112_0019605 3300048915 Bacteria 6387
331 Ga0496112_0033419 3300048915 Bacteria 5001
332 Ga0496112_0147584 3300048915 Bacteria 2320
333 Ga0496114_0001704 3300048917 Bacteria 16678
334 Ga0496115_0004387 3300048918 Bacteria 10214
335 Ga0501034_0006509 3300049571 Bacteria 12562
336 Ga0501037_0132693 3300049573 Bacteria 1785
337 Ga0501047_0106426 3300049581 Bacteria 2685
338 Ga0501070_0042613 3300049586 Bacteria 3780
339 Ga0501035_0074617 3300049822 Bacteria 3000
340 Ga0501044_0016229 3300049823 Bacteria 8005
341 nmdc:mga00v17_10273_c1 3300050491 Bacteria 5104
342 nmdc:mga00v17_149968_c1 3300050491 Bacteria 1498
343 nmdc:mga00v17_17435_c1 3300050491 Bacteria 4066
344 nmdc:mga0yw44_126006_c1 3300050492 Bacteria 1654
345 nmdc:mga0yw44_93937_c1 3300050492 Bacteria 1900
346 nmdc:mga0k408_8791_c1 3300050493 Bacteria 5434
347 nmdc:mga06z11_105935_c1 3300050494 Unclassified 1550
348 nmdc:mga04h51_55914_c1 3300050495 Unclassified 1338
349 nmdc:mga04h51_66318_c1 3300050495 Unclassified 1250
350 nmdc:mga07m45_20872_c1 3300050496 Unclassified 2585
351 nmdc:mga05p37_255612_c1 3300050507 Bacteria 2099
352 nmdc:mga05p37_355047_c1 3300050507 Bacteria 1725
353 nmdc:mga0qj67_312741_c1 3300050509 Bacteria 1272
354 nmdc:mga06r32_477510_c1 3300050510 Bacteria 1225
355 nmdc:mga08y16_39709_c1 3300050511 Unclassified 4936
356 nmdc:mga0n895_118103_c1 3300050512 Unclassified 2672
357 nmdc:mga0n895_135_c1 3300050512 Bacteria 44252
358 nmdc:mga0n895_288346_c1 3300050512 Bacteria 1664
359 nmdc:mga0n895_554401_c1 3300050512 Bacteria 1155
360 nmdc:mga0rr50_166_c1 3300050513 Bacteria 35244
361 nmdc:mga08x19_54199_c1 3300050514 Unclassified 2581
362 nmdc:mga08x19_85104_c1 3300050514 Bacteria 2080
363 nmdc:mga08x19_86123_c1 3300050514 Bacteria 2068
364 nmdc:mga0a205_1682_c1 3300050515 Bacteria 19080
365 nmdc:mga0a205_245876_c1 3300050515 Bacteria 1669
366 Ga0495601_0108606 3300053077 Bacteria 1795
367 Ga0495619_0000592 3300053085 Bacteria 24059
368 Ga0495619_0022895 3300053085 Unclassified 4000
369 Ga0373943_0008560
370 Ga0070658_10008815
371 Ga0070676_10007134
372 Ga0070683_100012335
373 Ga0070683_100046775
374 Ga0070683_100051380
375 Ga0070670_100498224
376 Ga0068869_100002880
377 Ga0068869_100059975
378 Ga0070666_10092479
379 Ga0070680_100015519
380 Ga0070680_100057671
381 Ga0070680_100126984
382 Ga0068868_100014793
383 Ga0068868_100034414
384 Ga0070660_100060612
385 Ga0070660_100231025
386 Ga0070687_100051801
387 Ga0070661_100067974
388 Ga0070661_100094740
389 Ga0070659_100034300
390 Ga0070709_10180775
391 Ga0070714_100458931
392 Ga0070713_100155185
393 Ga0070713_100205147
394 Ga0070713_100268768
395 Ga0070711_100000908
396 Ga0070711_100036162
397 Ga0070705_100115043
398 Ga0070708_100037897
399 Ga0070662_100065785
400 Ga0070662_100092871
401 Ga0070681_10001727
402 Ga0070681_10009123
403 Ga0070681_10028785
404 Ga0070681_10121473
405 Ga0068867_100053043
406 Ga0068867_100095811
407 Ga0070706_100037599
408 Ga0070707_100013763
409 Ga0070699_100012220
410 Ga0070699_100110307
411 Ga0070679_100069938
412 Ga0070679_100280453
413 Ga0070684_100086704
414 Ga0070684_100102636
415 Ga0070697_100009465
416 Ga0068853_100038415
417 Ga0070686_100169983
418 Ga0070693_100004488
419 Ga0070693_100199223
420 Ga0070665_100475430
421 Ga0068855_100010344
422 Ga0068855_100010944
423 Ga0068855_100081215
424 Ga0068855_100210440
425 Ga0070664_100010310
426 Ga0070664_100095906
427 Ga0070664_100122618
428 Ga0070664_100217939
429 Ga0068857_100001196
430 Ga0068857_100012137
431 Ga0068854_100006179
432 Ga0068854_100012251
433 Ga0068854_100140282
434 Ga0068856_100001176
435 Ga0068856_100002136
436 Ga0068856_100005744
437 Ga0068856_100008720
438 Ga0068856_100012092
439 Ga0068856_100032346
440 Ga0068856_100107048
441 Ga0068852_100051583
442 Ga0068852_100067509
443 Ga0068852_100108841
444 Ga0068859_100117066
445 Ga0068864_100003981
446 Ga0068864_100022727
447 Ga0068864_100277460
448 Ga0068866_10017564
449 Ga0068866_10022351
450 Ga0068861_100297376
451 Ga0068851_10003773
452 Ga0068851_10071016
453 Ga0068858_100005827
454 Ga0068858_100024350
455 Ga0068858_100052119
456 Ga0068860_100002552
457 Ga0068860_100063270
458 Ga0068860_100394262
459 Ga0068862_100045919
460 Ga0070717_10011782
461 Ga0070717_10015748
462 Ga0070717_10021599
463 Ga0070717_10027057
464 Ga0070717_10035908
465 Ga0070717_10175607
466 Ga0070717_10243697
467 Ga0075365_10075171
468 Ga0075368_10042654
469 Ga0075364_10011650
470 Ga0075364_10056965
471 Ga0070715_10049341
472 Ga0070716_100073780
473 Ga0070712_100000430
474 Ga0070712_100193344
475 Ga0075362_10068065
476 Ga0075367_10003103
477 Ga0075367_10004165
478 Ga0075366_10017547
479 Ga0075366_10137004
480 Ga0097621_100000987
481 Ga0097621_100003780
482 Ga0097621_100030661
483 Ga0068871_100002713
484 Ga0068871_100005559
485 Ga0068871_100033615
486 Ga0068871_100072913
487 Ga0068871_100117388
488 Ga0068871_100140897
489 Ga0075430_100254207
490 Ga0075431_100326524
491 Ga0075434_100000332
492 Ga0075434_100127268
493 Ga0075434_100252681
494 Ga0075434_100290129
495 Ga0075434_100458591
496 Ga0068865_100037633
497 Ga0075436_100071949
498 Ga0097620_100117067
499 Ga0075435_100035919
500 Ga0105240_10011582
501 Ga0105240_10028690
502 Ga0105240_10107033
503 Ga0111539_10010709
504 Ga0105245_10002405
505 Ga0105245_10030642
506 Ga0105245_10524608
507 Ga0114129_10226420
508 Ga0114129_10244366
509 Ga0105241_10025180
510 Ga0105242_10013969
511 Ga0105248_10005773
512 Ga0105248_10037569
513 Ga0105248_10093149
514 Ga0105237_10011879
515 Ga0105237_10053105
516 Ga0105238_10002713
517 Ga0105238_10053927
518 Ga0105238_10348231
519 Ga0105239_10048552
520 Ga0105239_10096731
521 Ga0105239_10113722
522 Ga0105239_10680271
523 Ga0157373_10001224
524 Ga0157373_10166306
525 Ga0157371_10007426
526 Ga0157371_10184421
527 Ga0157370_10000680
528 Ga0157370_10133425
529 Ga0157370_10325428
530 Ga0157369_10000226
531 Ga0157369_10005221
532 Ga0157369_10009227
533 Ga0157369_10009232
534 Ga0157369_10068363
535 Ga0157369_10080952
536 Ga0157369_10178161
537 Ga0157374_10000354
538 Ga0157374_10000422
539 Ga0157374_10003268
540 Ga0157374_10003688
541 Ga0157374_10005434
542 Ga0157374_10007151
543 Ga0157378_10000328
544 Ga0157378_10001741
545 Ga0157378_10013631
546 Ga0157378_10073452
547 Ga0163162_10005388
548 Ga0163162_10166949
549 Ga0163162_10207143
550 Ga0157372_10000321
551 Ga0157372_10000536
552 Ga0157372_10001132
553 Ga0157372_10001842
554 Ga0157372_10003983
555 Ga0157372_10025696
556 Ga0157372_10041459
557 Ga0157372_10074244
558 Ga0157372_10124995
559 Ga0163163_10000001
560 Ga0163163_10046403
561 Ga0157380_10021664
562 Ga0157379_10153057
563 Ga0157376_10041298
564 Ga0157376_10058251
565 Ga0157376_10101808
566 Ga0207656_10070812
567 Ga0207642_10021765
568 Ga0207680_10012583
569 Ga0207685_10034003
570 Ga0207699_10148310
571 Ga0207645_10007938
572 Ga0207645_10255562
573 Ga0207643_10032672
574 Ga0207705_10062444
575 Ga0207684_10021643
576 Ga0207654_10070660
577 Ga0207654_10130956
578 Ga0207707_10003239
579 Ga0207707_10003505
580 Ga0207707_10079433
581 Ga0207695_10002288
582 Ga0207695_10026176
583 Ga0207695_10116664
584 Ga0207671_10223237
585 Ga0207693_10000500
586 Ga0207693_10113145
587 Ga0207693_10206611
588 Ga0207663_10007538
589 Ga0207663_10059734
590 Ga0207660_10099380
591 Ga0207660_10110904
592 Ga0207662_10164929
593 Ga0207657_10046368
594 Ga0207649_10046743
595 Ga0207652_10014962
596 Ga0207646_10014223
597 Ga0207681_10140365
598 Ga0207694_10001427
599 Ga0207694_10026334
600 Ga0207687_10035675
601 Ga0207700_10001153
602 Ga0207700_10368141
603 Ga0207664_10015159
604 Ga0207706_10169619
605 Ga0207686_10023149
606 Ga0207686_10040918
607 Ga0207709_10043485
608 Ga0207665_10019141
609 Ga0207665_10033955
610 Ga0207711_10015938
611 Ga0207711_10031683
612 Ga0207711_10125099
613 Ga0207689_10026913
614 Ga0207689_10040436
615 Ga0207661_10074582
616 Ga0207679_10017126
617 Ga0207679_10138232
618 Ga0207679_10161481
619 Ga0207679_10326555
620 Ga0207667_10000934
621 Ga0207667_10013442
622 Ga0207667_10056465
623 Ga0207668_10121330
624 Ga0207640_10053746
625 Ga0207640_10077701
626 Ga0207640_10238934
627 Ga0207677_10008724
628 Ga0207677_10046707
629 Ga0207703_10013654
630 Ga0207703_10051370
631 Ga0207703_10052293
632 Ga0207703_10112092
633 Ga0207639_10210420
634 Ga0207702_10002369
635 Ga0207702_10010326
636 Ga0207702_10016542
637 Ga0207702_10020949
638 Ga0207702_10117546
639 Ga0207702_10177363
640 Ga0207702_10320273
641 Ga0207648_10005191
642 Ga0207648_10046654
643 Ga0207648_10053711
644 Ga0207674_10001650
645 Ga0207674_10253365
646 Ga0207674_10365009
647 Ga0207698_10033805
648 Ga0207698_10045100
649 Ga0207698_10147434
650 Ga0268266_10026976
651 Ga0268266_10466492
652 Ga0268264_10017075
653 Ga0268264_10087272
654 Ga0265338_10026484
655 Ga0265332_10003652
656 Ga0265325_10001034
657 Ga0265329_10007456
658 Ga0265316_10008025
659 Ga0265314_10000139
660 Ga0265342_10002531
661 Ga0373938_0058931
662 Ga0373956_0003436
663 Ga0373943_0124865
664 Ga0373955_0008877
665 Ga0373931_0021882
666 Ga0373935_0059740
667 Ga0373927_0005639
668 Ga0373933_0008229
669 Ga0373947_0005771
670 Ga0373947_0084125
671 Ga0373937_0002484
672 Ga0373937_0026444
673 Ga0373937_0054376
674 Ga0373937_0149818
675 Ga0373937_0170078
676 Ga0373937_0452774
677 Ga0373925_0065271
678 Ga0373925_0092981
679 Ga0373925_0239222
680 Ga0395900_0128215
681 Ga0395898_0240909
682 Ga0451576_0004212
683 Ga0451576_0026942
684 Ga0451576_0332595
685 Ga0495651_0045434
686 Ga0495580_0010300
687 Ga0495628_0159464
688 Ga0495667_0010600
689 Ga0495657_0191208
690 Ga0495604_0045548
691 Ga0495674_0077463
692 Ga0495602_0138286
693 Ga0496104_0043521
694 Ga0496104_0538352
695 Ga0496105_0012572
696 Ga0496105_0157597
697 Ga0496107_0122615
698 Ga0496112_0019605
699 Ga0496112_0033419
700 Ga0496112_0147584
701 Ga0496114_0001704
702 Ga0496115_0004387
703 Ga0501034_0006509
704 Ga0501037_0132693
705 Ga0501047_0106426
706 Ga0501070_0042613
707 Ga0501035_0074617
708 Ga0501044_0016229
709 nmdc:mga00v17_10273_c1
710 nmdc:mga00v17_149968_c1
711 nmdc:mga00v17_17435_c1
712 nmdc:mga0yw44_126006_c1
713 nmdc:mga0yw44_93937_c1
714 nmdc:mga0k408_8791_c1
715 nmdc:mga06z11_105935_c1
716 nmdc:mga04h51_55914_c1
717 nmdc:mga04h51_66318_c1
718 nmdc:mga07m45_20872_c1
719 nmdc:mga05p37_255612_c1
720 nmdc:mga05p37_355047_c1
721 nmdc:mga0qj67_312741_c1
722 nmdc:mga06r32_477510_c1
723 nmdc:mga08y16_39709_c1
724 nmdc:mga0n895_118103_c1
725 nmdc:mga0n895_135_c1
726 nmdc:mga0n895_288346_c1
727 nmdc:mga0n895_554401_c1
728 nmdc:mga0rr50_166_c1
729 nmdc:mga08x19_54199_c1
730 nmdc:mga08x19_85104_c1
731 nmdc:mga08x19_86123_c1
732 nmdc:mga0a205_1682_c1
733 nmdc:mga0a205_245876_c1
734 Ga0495601_0108606
735 Ga0495619_0000592
736 Ga0495619_0022895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ww7-assembly1.cif.gz_C crystal structure of the computationally designed pizza2 protein 0.756 40 121
3soq-assembly1.cif.gz_A the structure of the first ywtd beta propeller domain of lrp6 in complex with a dkk1 peptide 0.7407 40 290
5b4x-assembly2.cif.gz_D crystal structure of the apoer2 ectodomain in complex with the reelin r56 fragment 0.7248 40 296
6rem-assembly1.cif.gz_A crystal structure of pizza6-sh with sulphate ion 0.7241 33 336
6rem-assembly1.cif.gz_A crystal structure of pizza6-sh with sulphate ion 0.7141 33 336
ID Description Score Start End Superfamily
6h15A02 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7537 40 292 2.120.10.30
1c5kA02 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7419 40 295 2.120.10.30
af_Q9VXM0_1217_1524_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7393 40 294 2.120.10.30
af_K7UGU4_148_363_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7378 94 320 2.120.10.30
af_Q9NZR2_516_835_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7375 40 293 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A2V9FY69-F1-model_v4 Uncharacterized protein 0.9903 65 336
AF-A0A3N5MLR0-F1-model_v4 Uncharacterized protein 0.9892 34 336
AF-A0A2V9H8B8-F1-model_v4 Uncharacterized protein 0.9873 29 211
AF-A0A2V8FU64-F1-model_v4 Uncharacterized protein 0.9872 112 336
AF-A0A514ZZ94-F1-model_v4 Uncharacterized protein 0.9854 17 336

Map