F424403

General Info

Members Datasets Scaffolds Average Seq Length
367 162 734 220

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10019416|Ga0307406_100194163
Length 217
Sequence MITLYGFRTIFPEGRGETKDLRAQWALEEIGLPYRVHGLDHTGGECDGDAYRRLSPFRQVPVIDDDGFVVAESAAVVLYLAEKAGKLIPGDVQGRTRVVQWCFAATSTVEPTLVSLDIVEIFDGGNNKLKGEVRNLANRWLGGVEYRLEDREWIACADFTVADIMMAGVLRGIRKTDLMEPFPRLKAYFERCFARPAWQRTLSLYAERLGLNVDDIR

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
156 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
160 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
161 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
162 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 2.18
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10019416 3300031901 Bacteria 3989
2 Ga0070676_10001188 3300005328 Bacteria 13042
3 Ga0070676_10015695 3300005328 Bacteria 4180
4 Ga0070676_10061567 3300005328 Bacteria 2231
5 Ga0070676_10227833 3300005328 Bacteria 1234
6 Ga0070670_100000782 3300005331 Bacteria 24722
7 Ga0070670_100225186 3300005331 Bacteria 1632
8 Ga0070677_10011850 3300005333 Bacteria 3017
9 Ga0070677_10018870 3300005333 Bacteria 2491
10 Ga0070677_10065147 3300005333 Bacteria 1515
11 Ga0070677_10094637 3300005333 Bacteria 1306
12 Ga0068869_100042564 3300005334 Bacteria 3256
13 Ga0068869_100104941 3300005334 Bacteria 2143
14 Ga0068869_100257584 3300005334 Bacteria 1396
15 Ga0070666_10000601 3300005335 Bacteria 21615
16 Ga0070666_10033459 3300005335 Bacteria 3401
17 Ga0070666_10406128 3300005335 Bacteria 980
18 Ga0068868_100000894 3300005338 Bacteria 20277
19 Ga0068868_100268580 3300005338 Bacteria 1440
20 Ga0068868_100501716 3300005338 Bacteria 1063
21 Ga0070689_100023823 3300005340 Bacteria 4588
22 Ga0070689_100098171 3300005340 Bacteria 2316
23 Ga0070661_100043851 3300005344 Bacteria 3267
24 Ga0070668_100001082 3300005347 Bacteria 19162
25 Ga0070668_100238047 3300005347 Bacteria 1507
26 Ga0070668_100274548 3300005347 Bacteria 1406
27 Ga0070669_100008160 3300005353 Bacteria 7478
28 Ga0070675_100000313 3300005354 Bacteria 32680
29 Ga0070675_100001002 3300005354 Bacteria 20262
30 Ga0070675_100003747 3300005354 Bacteria 11547
31 Ga0070675_100017031 3300005354 Bacteria 5776
32 Ga0070675_100073830 3300005354 Bacteria 2832
33 Ga0070675_100086053 3300005354 Bacteria 2627
34 Ga0070675_100529973 3300005354 Bacteria 1063
35 Ga0070671_100002056 3300005355 Bacteria 15513
36 Ga0070671_100002864 3300005355 Bacteria 13423
37 Ga0070671_100009701 3300005355 Bacteria 7735
38 Ga0070671_100012744 3300005355 Bacteria 6778
39 Ga0070671_100050112 3300005355 Bacteria 3473
40 Ga0070671_100051582 3300005355 Bacteria 3421
41 Ga0070671_100167512 3300005355 Bacteria 1858
42 Ga0070674_100001289 3300005356 Bacteria 13188
43 Ga0070674_100007066 3300005356 Bacteria 6600
44 Ga0070674_100023993 3300005356 Bacteria 3956
45 Ga0070674_100085429 3300005356 Bacteria 2265
46 Ga0070673_100003349 3300005364 Bacteria 9961
47 Ga0070673_100012258 3300005364 Bacteria 5881
48 Ga0070673_100129470 3300005364 Bacteria 2115
49 Ga0070673_100544757 3300005364 Bacteria 1053
50 Ga0070667_100005884 3300005367 Bacteria 10216
51 Ga0070667_100014142 3300005367 Bacteria 6594
52 Ga0070667_100548033 3300005367 Bacteria 1063
53 Ga0070705_100227505 3300005440 Bacteria 1295
54 Ga0070700_100025391 3300005441 Bacteria 3488
55 Ga0070663_100287135 3300005455 Bacteria 1313
56 Ga0070678_100005845 3300005456 Bacteria 7157
57 Ga0070678_100058958 3300005456 Bacteria 2820
58 Ga0070678_100091608 3300005456 Bacteria 2333
59 Ga0070678_100095478 3300005456 Bacteria 2291
60 Ga0070678_100183741 3300005456 Bacteria 1714
61 Ga0070678_100248886 3300005456 Bacteria 1489
62 Ga0070662_100162297 3300005457 Bacteria 1749
63 Ga0070662_100221815 3300005457 Bacteria 1509
64 Ga0070662_100621700 3300005457 Bacteria 910
65 Ga0068867_100008386 3300005459 Bacteria 7289
66 Ga0068867_100028607 3300005459 Bacteria 4014
67 Ga0068867_100119650 3300005459 Bacteria 2033
68 Ga0068867_100152948 3300005459 Bacteria 1814
69 Ga0070706_100022100 3300005467 Bacteria 5858
70 Ga0070707_100137634 3300005468 Bacteria 2375
71 Ga0070679_100415876 3300005530 Bacteria 1290
72 Ga0068853_100233346 3300005539 Bacteria 1684
73 Ga0068853_100299143 3300005539 Bacteria 1487
74 Ga0070672_100000269 3300005543 Bacteria 29466
75 Ga0070672_100001901 3300005543 Bacteria 13082
76 Ga0070672_100003870 3300005543 Bacteria 9746
77 Ga0070672_100122325 3300005543 Bacteria 2132
78 Ga0070672_100160077 3300005543 Bacteria 1867
79 Ga0070672_100267222 3300005543 Bacteria 1443
80 Ga0070672_100411312 3300005543 Bacteria 1161
81 Ga0070672_100413145 3300005543 Bacteria 1158
82 Ga0068855_100821644 3300005563 Bacteria 986
83 Ga0068854_100284526 3300005578 Bacteria 1332
84 Ga0068852_100032617 3300005616 Bacteria 4314
85 Ga0068852_100098058 3300005616 Bacteria 2638
86 Ga0068852_100190324 3300005616 Bacteria 1936
87 Ga0068852_100207975 3300005616 Bacteria 1855
88 Ga0068852_100495157 3300005616 Bacteria 1216
89 Ga0068859_100008326 3300005617 Bacteria 10511
90 Ga0068864_100001274 3300005618 Bacteria 20945
91 Ga0068864_100014615 3300005618 Bacteria 6520
92 Ga0068864_100064179 3300005618 Bacteria 3184
93 Ga0068864_100373369 3300005618 Bacteria 1350
94 Ga0068866_10001755 3300005718 Bacteria 9123
95 Ga0068861_100004805 3300005719 Bacteria 9083
96 Ga0068861_100111109 3300005719 Bacteria 2196
97 Ga0068861_100579459 3300005719 Bacteria 1027
98 Ga0068851_10006129 3300005834 Bacteria 5486
99 Ga0068851_10057331 3300005834 Bacteria 1989
100 Ga0068851_10270466 3300005834 Bacteria 969
101 Ga0068870_10017911 3300005840 Bacteria 3410
102 Ga0068870_10046314 3300005840 Bacteria 2280
103 Ga0068870_10056076 3300005840 Bacteria 2102
104 Ga0068863_100004625 3300005841 Bacteria 13557
105 Ga0068863_100006737 3300005841 Bacteria 11264
106 Ga0068863_100011694 3300005841 Bacteria 8487
107 Ga0068863_100230864 3300005841 Bacteria 1785
108 Ga0068858_100010488 3300005842 Bacteria 8779
109 Ga0068858_100022304 3300005842 Bacteria 5912
110 Ga0068858_100439723 3300005842 Bacteria 1256
111 Ga0068860_100013104 3300005843 Bacteria 8136
112 Ga0068860_100039212 3300005843 Bacteria 4530
113 Ga0068862_100007559 3300005844 Bacteria 9008
114 Ga0068862_100339176 3300005844 Bacteria 1391
115 Ga0068862_100647644 3300005844 Bacteria 1019
116 Ga0075365_10631287 3300006038 Bacteria 757
117 Ga0097621_100005449 3300006237 Bacteria 8962
118 Ga0097621_100014693 3300006237 Bacteria 5868
119 Ga0097621_100019058 3300006237 Bacteria 5260
120 Ga0097621_100429762 3300006237 Bacteria 1187
121 Ga0068871_100001388 3300006358 Bacteria 16221
122 Ga0068871_100003920 3300006358 Bacteria 10262
123 Ga0068871_100114657 3300006358 Bacteria 2271
124 Ga0068865_100001176 3300006881 Bacteria 15211
125 Ga0068865_100028862 3300006881 Bacteria 3676
126 Ga0097620_100008327 3300006931 Bacteria 10511
127 Ga0105245_10126975 3300009098 Bacteria 2388
128 Ga0105247_10331767 3300009101 Bacteria 1064
129 Ga0105243_10010756 3300009148 Bacteria 6929
130 Ga0105242_10001252 3300009176 Bacteria 20020
131 Ga0105242_10028228 3300009176 Bacteria 4466
132 Ga0105248_10010512 3300009177 Bacteria 10193
133 Ga0105248_10021874 3300009177 Bacteria 7086
134 Ga0105248_10119066 3300009177 Bacteria 2978
135 Ga0105248_10152163 3300009177 Bacteria 2610
136 Ga0105248_10183775 3300009177 Bacteria 2356
137 Ga0105248_10250748 3300009177 Bacteria 1993
138 Ga0105248_10627359 3300009177 Bacteria 1213
139 Ga0105238_10619735 3300009551 Bacteria 1091
140 Ga0105249_10002712 3300009553 Bacteria 15297
141 Ga0157374_10031035 3300013296 Bacteria 4852
142 Ga0157374_10126362 3300013296 Bacteria 2472
143 Ga0157378_10022298 3300013297 Bacteria 5574
144 Ga0157378_10073025 3300013297 Bacteria 3083
145 Ga0163162_10009730 3300013306 Bacteria 9357
146 Ga0163162_10009797 3300013306 Bacteria 9323
147 Ga0163162_10100614 3300013306 Bacteria 2982
148 Ga0163162_10190494 3300013306 Bacteria 2178
149 Ga0163162_10500216 3300013306 Bacteria 1346
150 Ga0163162_10757016 3300013306 Bacteria 1090
151 Ga0157375_10000903 3300013308 Bacteria 25828
152 Ga0157375_10003327 3300013308 Bacteria 13921
153 Ga0157375_10006940 3300013308 Bacteria 9887
154 Ga0157375_10011616 3300013308 Bacteria 7781
155 Ga0157375_10135492 3300013308 Bacteria 2586
156 Ga0157375_10181547 3300013308 Bacteria 2256
157 Ga0163163_10004721 3300014325 Bacteria 11674
158 Ga0157380_10041889 3300014326 Bacteria 3576
159 Ga0157380_10174819 3300014326 Bacteria 1880
160 Ga0157380_10305379 3300014326 Bacteria 1468
161 Ga0182008_10000332 3300014497 Bacteria 37231
162 Ga0157377_10038596 3300014745 Bacteria 2638
163 Ga0157379_10011263 3300014968 Bacteria 7792
164 Ga0157379_11134915 3300014968 Bacteria 750
165 Ga0157376_10015296 3300014969 Bacteria 5792
166 Ga0157376_10027752 3300014969 Bacteria 4491
167 Ga0157376_10060019 3300014969 Bacteria 3192
168 Ga0157376_10089597 3300014969 Bacteria 2660
169 Ga0157376_10252036 3300014969 Bacteria 1649
170 Ga0163161_10002122 3300017792 Bacteria 14344
171 Ga0163161_10169446 3300017792 Bacteria 1669
172 Ga0163161_10187964 3300017792 Bacteria 1587
173 Ga0207673_1006378 3300025290 Bacteria 1458
174 Ga0207656_10010018 3300025321 Bacteria 3534
175 Ga0207656_10117458 3300025321 Bacteria 1235
176 Ga0207653_10035528 3300025885 Bacteria 1622
177 Ga0207682_10021742 3300025893 Bacteria 2525
178 Ga0207682_10041050 3300025893 Bacteria 1887
179 Ga0207682_10104568 3300025893 Bacteria 1241
180 Ga0207682_10151166 3300025893 Bacteria 1047
181 Ga0207688_10021962 3300025901 Bacteria 3490
182 Ga0207688_10207113 3300025901 Bacteria 1177
183 Ga0207680_10003983 3300025903 Bacteria 6976
184 Ga0207680_10016878 3300025903 Bacteria 3845
185 Ga0207680_10067893 3300025903 Bacteria 2198
186 Ga0207645_10009644 3300025907 Bacteria 6669
187 Ga0207645_10015250 3300025907 Bacteria 5114
188 Ga0207643_10036472 3300025908 Bacteria 2758
189 Ga0207643_10039666 3300025908 Bacteria 2649
190 Ga0207643_10212882 3300025908 Bacteria 1180
191 Ga0207705_10027020 3300025909 Bacteria 4091
192 Ga0207657_10550021 3300025919 Bacteria 902
193 Ga0207652_10025831 3300025921 Bacteria 4887
194 Ga0207646_10364962 3300025922 Bacteria 1304
195 Ga0207681_10001477 3300025923 Bacteria 15154
196 Ga0207650_10001723 3300025925 Bacteria 15546
197 Ga0207650_10004838 3300025925 Bacteria 9201
198 Ga0207650_10117276 3300025925 Bacteria 2069
199 Ga0207650_10201143 3300025925 Bacteria 1596
200 Ga0207650_10209688 3300025925 Bacteria 1564
201 Ga0207659_10002717 3300025926 Bacteria 10546
202 Ga0207659_10123630 3300025926 Bacteria 1986
203 Ga0207659_10159494 3300025926 Bacteria 1769
204 Ga0207659_10337700 3300025926 Bacteria 1247
205 Ga0207659_10556620 3300025926 Bacteria 975
206 Ga0207687_10473141 3300025927 Bacteria 1042
207 Ga0207644_10008447 3300025931 Bacteria 6738
208 Ga0207644_10010858 3300025931 Bacteria 6012
209 Ga0207644_10013519 3300025931 Bacteria 5445
210 Ga0207644_10027651 3300025931 Bacteria 3920
211 Ga0207644_10068902 3300025931 Bacteria 2582
212 Ga0207690_10056051 3300025932 Bacteria 2657
213 Ga0207706_10002140 3300025933 Bacteria 19325
214 Ga0207706_10084223 3300025933 Bacteria 2795
215 Ga0207706_10599348 3300025933 Bacteria 946
216 Ga0207686_10004423 3300025934 Bacteria 7538
217 Ga0207686_10023858 3300025934 Bacteria 3536
218 Ga0207709_10013525 3300025935 Bacteria 4502
219 Ga0207670_10010123 3300025936 Bacteria 5415
220 Ga0207669_10001724 3300025937 Bacteria 9276
221 Ga0207669_10035192 3300025937 Bacteria 2846
222 Ga0207669_10121998 3300025937 Bacteria 1771
223 Ga0207669_10274390 3300025937 Bacteria 1268
224 Ga0207669_10580874 3300025937 Bacteria 908
225 Ga0207691_10000561 3300025940 Bacteria 37149
226 Ga0207691_10001853 3300025940 Bacteria 20653
227 Ga0207691_10002998 3300025940 Bacteria 16478
228 Ga0207691_10004263 3300025940 Bacteria 13884
229 Ga0207691_10084760 3300025940 Bacteria 2844
230 Ga0207691_10113701 3300025940 Bacteria 2405
231 Ga0207691_10154534 3300025940 Bacteria 2016
232 Ga0207691_10271441 3300025940 Bacteria 1460
233 Ga0207691_10284296 3300025940 Bacteria 1423
234 Ga0207691_10397469 3300025940 Bacteria 1176
235 Ga0207711_10003696 3300025941 Bacteria 13197
236 Ga0207711_10018995 3300025941 Bacteria 5718
237 Ga0207711_10027733 3300025941 Bacteria 4759
238 Ga0207711_10051330 3300025941 Bacteria 3531
239 Ga0207711_10082162 3300025941 Bacteria 2816
240 Ga0207711_10240193 3300025941 Bacteria 1661
241 Ga0207711_10457197 3300025941 Bacteria 1189
242 Ga0207711_10567155 3300025941 Bacteria 1059
243 Ga0207689_10005534 3300025942 Bacteria 11278
244 Ga0207689_10008100 3300025942 Bacteria 9165
245 Ga0207689_10016164 3300025942 Bacteria 6321
246 Ga0207679_10077976 3300025945 Bacteria 2522
247 Ga0207679_10643357 3300025945 Bacteria 959
248 Ga0207667_10951393 3300025949 Bacteria 848
249 Ga0207651_10000419 3300025960 Bacteria 18093
250 Ga0207651_10014085 3300025960 Bacteria 4604
251 Ga0207651_10099203 3300025960 Bacteria 2156
252 Ga0207651_10510251 3300025960 Bacteria 1041
253 Ga0207668_10081342 3300025972 Bacteria 2349
254 Ga0207658_10005062 3300025986 Bacteria 9072
255 Ga0207658_10060640 3300025986 Bacteria 2823
256 Ga0207658_10273316 3300025986 Bacteria 1445
257 Ga0207658_10431109 3300025986 Bacteria 1164
258 Ga0207677_10001933 3300026023 Bacteria 10964
259 Ga0207677_10066751 3300026023 Bacteria 2517
260 Ga0207677_10091420 3300026023 Bacteria 2214
261 Ga0207677_10514262 3300026023 Bacteria 1037
262 Ga0207703_10003054 3300026035 Bacteria 14158
263 Ga0207703_10008559 3300026035 Bacteria 8077
264 Ga0207703_10252535 3300026035 Bacteria 1590
265 Ga0207639_10137574 3300026041 Bacteria 2031
266 Ga0207639_10250911 3300026041 Bacteria 1543
267 Ga0207678_10081214 3300026067 Bacteria 2775
268 Ga0207708_10218341 3300026075 Bacteria 1527
269 Ga0207641_10004384 3300026088 Bacteria 12234
270 Ga0207641_10007331 3300026088 Bacteria 9185
271 Ga0207641_10014146 3300026088 Bacteria 6540
272 Ga0207641_10091155 3300026088 Bacteria 2667
273 Ga0207641_10305174 3300026088 Bacteria 1505
274 Ga0207641_10672506 3300026088 Bacteria 1018
275 Ga0207648_10001824 3300026089 Bacteria 23286
276 Ga0207648_10007948 3300026089 Bacteria 10345
277 Ga0207648_10026600 3300026089 Bacteria 5139
278 Ga0207648_10039109 3300026089 Bacteria 4171
279 Ga0207648_10083543 3300026089 Bacteria 2785
280 Ga0207648_10657576 3300026089 Bacteria 969
281 Ga0207676_10000748 3300026095 Bacteria 25484
282 Ga0207676_10001930 3300026095 Bacteria 15137
283 Ga0207676_10022160 3300026095 Bacteria 4671
284 Ga0207676_10026141 3300026095 Bacteria 4339
285 Ga0207676_10322603 3300026095 Bacteria 1418
286 Ga0207675_100001089 3300026118 Bacteria 26890
287 Ga0207675_100209129 3300026118 Bacteria 1876
288 Ga0207675_100241311 3300026118 Bacteria 1746
289 Ga0207683_10005208 3300026121 Bacteria 11169
290 Ga0207683_10005275 3300026121 Bacteria 11092
291 Ga0207683_10010765 3300026121 Bacteria 7798
292 Ga0207683_10050842 3300026121 Bacteria 3631
293 Ga0207683_10146049 3300026121 Bacteria 2133
294 Ga0207683_10325032 3300026121 Bacteria 1409
295 Ga0207698_10006027 3300026142 Bacteria 7537
296 Ga0207698_10018941 3300026142 Bacteria 4701
297 Ga0207698_10072874 3300026142 Bacteria 2732
298 Ga0207698_10189531 3300026142 Bacteria 1830
299 Ga0268266_10537458 3300028379 Bacteria 1119
300 Ga0268265_10010615 3300028380 Bacteria 6221
301 Ga0268265_10272129 3300028380 Bacteria 1511
302 Ga0268264_10077849 3300028381 Bacteria 2825
303 Ga0268264_10533994 3300028381 Bacteria 1148
304 Ga0307515_10004568 3300028794 Bacteria 28508
305 Ga0307515_10197180 3300028794 Bacteria 1902
306 Ga0265338_10093070 3300028800 Bacteria 2484
307 Ga0265328_10002492 3300031239 Bacteria 8258
308 Ga0265320_10010481 3300031240 Bacteria 5518
309 Ga0265339_10013330 3300031249 Bacteria 4985
310 Ga0265314_10002984 3300031711 Bacteria 16760
311 Ga0265342_10002366 3300031712 Bacteria 16335
312 Ga0307405_10191906 3300031731 Bacteria 1476
313 Ga0307412_10050440 3300031911 Bacteria 2746
314 Ga0307415_100006219 3300032126 Bacteria 6416
315 Ga0307415_100023638 3300032126 Bacteria 3820
316 Ga0373943_0017524 3300035170 Bacteria 3277
317 Ga0373961_0000003 3300035241 Bacteria 149339
318 Ga0373927_0081993 3300035695 Bacteria 2091
319 Ga0373937_0030021 3300036401 Bacteria 4924
320 Ga0373937_0996186 3300036401 Bacteria 787
321 Ga0373925_0028037 3300037068 Bacteria 4124
322 Ga0373925_0299053 3300037068 Bacteria 1299
323 Ga0395905_0003793 3300037471 Bacteria 15982
324 Ga0451804_0323430 3300041463 Bacteria 755
325 Ga0451845_0917903 3300041501 Bacteria 1089
326 Ga0451853_1601767 3300041512 Bacteria 1088
327 Ga0439445_0091112 3300042004 Bacteria 859
328 Ga0439458_0018426 3300042157 Bacteria 1601
329 Ga0439434_0097506 3300042435 Bacteria 945
330 Ga0495603_0225881 3300046455 Bacteria 1080
331 Ga0495590_0003483 3300046457 Bacteria 6425
332 Ga0495629_0184135 3300046459 Bacteria 1447
333 Ga0495580_0236428 3300046472 Bacteria 1253
334 Ga0495618_0162605 3300046514 Bacteria 1423
335 Ga0495628_0308087 3300046516 Bacteria 1171
336 Ga0495632_0036841 3300046519 Bacteria 2486
337 Ga0495587_0030604 3300046536 Bacteria 3264
338 Ga0495598_0017917 3300046537 Bacteria 1833
339 Ga0495645_0037495 3300046543 Bacteria 3534
340 Ga0495645_0062075 3300046543 Bacteria 2707
341 Ga0495667_0408160 3300046559 Bacteria 855
342 Ga0495658_0012852 3300046683 Bacteria 4252
343 Ga0495684_0076402 3300047471 Bacteria 2544
344 Ga0495686_0000478 3300047472 Bacteria 59593
345 Ga0495686_0036192 3300047472 Bacteria 3169
346 Ga0495615_0118272 3300048090 Bacteria 764
347 Ga0496104_0101046 3300048907 Bacteria 2761
348 Ga0496105_0240350 3300048908 Bacteria 1470
349 Ga0496108_0077662 3300048911 Bacteria 2809
350 Ga0496108_0195421 3300048911 Bacteria 1754
351 Ga0496109_0092973 3300048912 Bacteria 2790
352 Ga0496109_0134884 3300048912 Bacteria 2306
353 Ga0496114_0495324 3300048917 Bacteria 1081
354 Ga0501257_064002 3300049686 Bacteria 932
355 nmdc:mga0qj67_230567_c1 3300050509 Bacteria 1502
356 nmdc:mga08y16_347134_c1 3300050511 Bacteria 1525
357 nmdc:mga08y16_438074_c1 3300050511 Bacteria 1334
358 nmdc:mga08y16_800976_c1 3300050511 Bacteria 935
359 Ga0495601_0257519 3300053077 Bacteria 1139
360 Ga0500635_0088779 3300053080 Bacteria 1121
361 Ga0495595_0341625 3300053084 Bacteria 755
362 Ga0495619_0036989 3300053085 Bacteria 3180
363 Ga0500566_0023579 3300053094 Bacteria 3613
364 Ga0500555_011100 3300053103 Bacteria 2588
365 Ga0500603_001803 3300053150 Bacteria 4810
366 Ga0500639_141842 3300053163 Bacteria 1122
367 Ga0590075_033779 3300059424 Bacteria 1299
368 Ga0307406_10019416
369 Ga0070676_10001188
370 Ga0070676_10015695
371 Ga0070676_10061567
372 Ga0070676_10227833
373 Ga0070670_100000782
374 Ga0070670_100225186
375 Ga0070677_10011850
376 Ga0070677_10018870
377 Ga0070677_10065147
378 Ga0070677_10094637
379 Ga0068869_100042564
380 Ga0068869_100104941
381 Ga0068869_100257584
382 Ga0070666_10000601
383 Ga0070666_10033459
384 Ga0070666_10406128
385 Ga0068868_100000894
386 Ga0068868_100268580
387 Ga0068868_100501716
388 Ga0070689_100023823
389 Ga0070689_100098171
390 Ga0070661_100043851
391 Ga0070668_100001082
392 Ga0070668_100238047
393 Ga0070668_100274548
394 Ga0070669_100008160
395 Ga0070675_100000313
396 Ga0070675_100001002
397 Ga0070675_100003747
398 Ga0070675_100017031
399 Ga0070675_100073830
400 Ga0070675_100086053
401 Ga0070675_100529973
402 Ga0070671_100002056
403 Ga0070671_100002864
404 Ga0070671_100009701
405 Ga0070671_100012744
406 Ga0070671_100050112
407 Ga0070671_100051582
408 Ga0070671_100167512
409 Ga0070674_100001289
410 Ga0070674_100007066
411 Ga0070674_100023993
412 Ga0070674_100085429
413 Ga0070673_100003349
414 Ga0070673_100012258
415 Ga0070673_100129470
416 Ga0070673_100544757
417 Ga0070667_100005884
418 Ga0070667_100014142
419 Ga0070667_100548033
420 Ga0070705_100227505
421 Ga0070700_100025391
422 Ga0070663_100287135
423 Ga0070678_100005845
424 Ga0070678_100058958
425 Ga0070678_100091608
426 Ga0070678_100095478
427 Ga0070678_100183741
428 Ga0070678_100248886
429 Ga0070662_100162297
430 Ga0070662_100221815
431 Ga0070662_100621700
432 Ga0068867_100008386
433 Ga0068867_100028607
434 Ga0068867_100119650
435 Ga0068867_100152948
436 Ga0070706_100022100
437 Ga0070707_100137634
438 Ga0070679_100415876
439 Ga0068853_100233346
440 Ga0068853_100299143
441 Ga0070672_100000269
442 Ga0070672_100001901
443 Ga0070672_100003870
444 Ga0070672_100122325
445 Ga0070672_100160077
446 Ga0070672_100267222
447 Ga0070672_100411312
448 Ga0070672_100413145
449 Ga0068855_100821644
450 Ga0068854_100284526
451 Ga0068852_100032617
452 Ga0068852_100098058
453 Ga0068852_100190324
454 Ga0068852_100207975
455 Ga0068852_100495157
456 Ga0068859_100008326
457 Ga0068864_100001274
458 Ga0068864_100014615
459 Ga0068864_100064179
460 Ga0068864_100373369
461 Ga0068866_10001755
462 Ga0068861_100004805
463 Ga0068861_100111109
464 Ga0068861_100579459
465 Ga0068851_10006129
466 Ga0068851_10057331
467 Ga0068851_10270466
468 Ga0068870_10017911
469 Ga0068870_10046314
470 Ga0068870_10056076
471 Ga0068863_100004625
472 Ga0068863_100006737
473 Ga0068863_100011694
474 Ga0068863_100230864
475 Ga0068858_100010488
476 Ga0068858_100022304
477 Ga0068858_100439723
478 Ga0068860_100013104
479 Ga0068860_100039212
480 Ga0068862_100007559
481 Ga0068862_100339176
482 Ga0068862_100647644
483 Ga0075365_10631287
484 Ga0097621_100005449
485 Ga0097621_100014693
486 Ga0097621_100019058
487 Ga0097621_100429762
488 Ga0068871_100001388
489 Ga0068871_100003920
490 Ga0068871_100114657
491 Ga0068865_100001176
492 Ga0068865_100028862
493 Ga0097620_100008327
494 Ga0105245_10126975
495 Ga0105247_10331767
496 Ga0105243_10010756
497 Ga0105242_10001252
498 Ga0105242_10028228
499 Ga0105248_10010512
500 Ga0105248_10021874
501 Ga0105248_10119066
502 Ga0105248_10152163
503 Ga0105248_10183775
504 Ga0105248_10250748
505 Ga0105248_10627359
506 Ga0105238_10619735
507 Ga0105249_10002712
508 Ga0157374_10031035
509 Ga0157374_10126362
510 Ga0157378_10022298
511 Ga0157378_10073025
512 Ga0163162_10009730
513 Ga0163162_10009797
514 Ga0163162_10100614
515 Ga0163162_10190494
516 Ga0163162_10500216
517 Ga0163162_10757016
518 Ga0157375_10000903
519 Ga0157375_10003327
520 Ga0157375_10006940
521 Ga0157375_10011616
522 Ga0157375_10135492
523 Ga0157375_10181547
524 Ga0163163_10004721
525 Ga0157380_10041889
526 Ga0157380_10174819
527 Ga0157380_10305379
528 Ga0182008_10000332
529 Ga0157377_10038596
530 Ga0157379_10011263
531 Ga0157379_11134915
532 Ga0157376_10015296
533 Ga0157376_10027752
534 Ga0157376_10060019
535 Ga0157376_10089597
536 Ga0157376_10252036
537 Ga0163161_10002122
538 Ga0163161_10169446
539 Ga0163161_10187964
540 Ga0207673_1006378
541 Ga0207656_10010018
542 Ga0207656_10117458
543 Ga0207653_10035528
544 Ga0207682_10021742
545 Ga0207682_10041050
546 Ga0207682_10104568
547 Ga0207682_10151166
548 Ga0207688_10021962
549 Ga0207688_10207113
550 Ga0207680_10003983
551 Ga0207680_10016878
552 Ga0207680_10067893
553 Ga0207645_10009644
554 Ga0207645_10015250
555 Ga0207643_10036472
556 Ga0207643_10039666
557 Ga0207643_10212882
558 Ga0207705_10027020
559 Ga0207657_10550021
560 Ga0207652_10025831
561 Ga0207646_10364962
562 Ga0207681_10001477
563 Ga0207650_10001723
564 Ga0207650_10004838
565 Ga0207650_10117276
566 Ga0207650_10201143
567 Ga0207650_10209688
568 Ga0207659_10002717
569 Ga0207659_10123630
570 Ga0207659_10159494
571 Ga0207659_10337700
572 Ga0207659_10556620
573 Ga0207687_10473141
574 Ga0207644_10008447
575 Ga0207644_10010858
576 Ga0207644_10013519
577 Ga0207644_10027651
578 Ga0207644_10068902
579 Ga0207690_10056051
580 Ga0207706_10002140
581 Ga0207706_10084223
582 Ga0207706_10599348
583 Ga0207686_10004423
584 Ga0207686_10023858
585 Ga0207709_10013525
586 Ga0207670_10010123
587 Ga0207669_10001724
588 Ga0207669_10035192
589 Ga0207669_10121998
590 Ga0207669_10274390
591 Ga0207669_10580874
592 Ga0207691_10000561
593 Ga0207691_10001853
594 Ga0207691_10002998
595 Ga0207691_10004263
596 Ga0207691_10084760
597 Ga0207691_10113701
598 Ga0207691_10154534
599 Ga0207691_10271441
600 Ga0207691_10284296
601 Ga0207691_10397469
602 Ga0207711_10003696
603 Ga0207711_10018995
604 Ga0207711_10027733
605 Ga0207711_10051330
606 Ga0207711_10082162
607 Ga0207711_10240193
608 Ga0207711_10457197
609 Ga0207711_10567155
610 Ga0207689_10005534
611 Ga0207689_10008100
612 Ga0207689_10016164
613 Ga0207679_10077976
614 Ga0207679_10643357
615 Ga0207667_10951393
616 Ga0207651_10000419
617 Ga0207651_10014085
618 Ga0207651_10099203
619 Ga0207651_10510251
620 Ga0207668_10081342
621 Ga0207658_10005062
622 Ga0207658_10060640
623 Ga0207658_10273316
624 Ga0207658_10431109
625 Ga0207677_10001933
626 Ga0207677_10066751
627 Ga0207677_10091420
628 Ga0207677_10514262
629 Ga0207703_10003054
630 Ga0207703_10008559
631 Ga0207703_10252535
632 Ga0207639_10137574
633 Ga0207639_10250911
634 Ga0207678_10081214
635 Ga0207708_10218341
636 Ga0207641_10004384
637 Ga0207641_10007331
638 Ga0207641_10014146
639 Ga0207641_10091155
640 Ga0207641_10305174
641 Ga0207641_10672506
642 Ga0207648_10001824
643 Ga0207648_10007948
644 Ga0207648_10026600
645 Ga0207648_10039109
646 Ga0207648_10083543
647 Ga0207648_10657576
648 Ga0207676_10000748
649 Ga0207676_10001930
650 Ga0207676_10022160
651 Ga0207676_10026141
652 Ga0207676_10322603
653 Ga0207675_100001089
654 Ga0207675_100209129
655 Ga0207675_100241311
656 Ga0207683_10005208
657 Ga0207683_10005275
658 Ga0207683_10010765
659 Ga0207683_10050842
660 Ga0207683_10146049
661 Ga0207683_10325032
662 Ga0207698_10006027
663 Ga0207698_10018941
664 Ga0207698_10072874
665 Ga0207698_10189531
666 Ga0268266_10537458
667 Ga0268265_10010615
668 Ga0268265_10272129
669 Ga0268264_10077849
670 Ga0268264_10533994
671 Ga0307515_10004568
672 Ga0307515_10197180
673 Ga0265338_10093070
674 Ga0265328_10002492
675 Ga0265320_10010481
676 Ga0265339_10013330
677 Ga0265314_10002984
678 Ga0265342_10002366
679 Ga0307405_10191906
680 Ga0307412_10050440
681 Ga0307415_100006219
682 Ga0307415_100023638
683 Ga0373943_0017524
684 Ga0373961_0000003
685 Ga0373927_0081993
686 Ga0373937_0030021
687 Ga0373937_0996186
688 Ga0373925_0028037
689 Ga0373925_0299053
690 Ga0395905_0003793
691 Ga0451804_0323430
692 Ga0451845_0917903
693 Ga0451853_1601767
694 Ga0439445_0091112
695 Ga0439458_0018426
696 Ga0439434_0097506
697 Ga0495603_0225881
698 Ga0495590_0003483
699 Ga0495629_0184135
700 Ga0495580_0236428
701 Ga0495618_0162605
702 Ga0495628_0308087
703 Ga0495632_0036841
704 Ga0495587_0030604
705 Ga0495598_0017917
706 Ga0495645_0037495
707 Ga0495645_0062075
708 Ga0495667_0408160
709 Ga0495658_0012852
710 Ga0495684_0076402
711 Ga0495686_0000478
712 Ga0495686_0036192
713 Ga0495615_0118272
714 Ga0496104_0101046
715 Ga0496105_0240350
716 Ga0496108_0077662
717 Ga0496108_0195421
718 Ga0496109_0092973
719 Ga0496109_0134884
720 Ga0496114_0495324
721 Ga0501257_064002
722 nmdc:mga0qj67_230567_c1
723 nmdc:mga08y16_347134_c1
724 nmdc:mga08y16_438074_c1
725 nmdc:mga08y16_800976_c1
726 Ga0495601_0257519
727 Ga0500635_0088779
728 Ga0495595_0341625
729 Ga0495619_0036989
730 Ga0500566_0023579
731 Ga0500555_011100
732 Ga0500603_001803
733 Ga0500639_141842
734 Ga0590075_033779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

2

82

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

21

83

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

132

191

0.91

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

120

200

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

106

196

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

21

87

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.8953 2 211
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.8707 2 212
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.8656 2 211
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.8541 2 213
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.8509 2 212
ID Description Score Start End Superfamily
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9113 89 202 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9112 89 202 1.20.1050.10
3lq7C02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9053 89 202 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8822 89 202 1.20.1050.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8822 89 202 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7Y4T7F7-F1-model_v4 Glutathione S-transferase family protein 0.8996 60 212 GO:0016740
AF-A0A531M6P3-F1-model_v4 Glutathione S-transferase family protein 0.8934 87 210 GO:0016740
AF-A0A7Y4T7F7-F1-model_v4 Glutathione S-transferase family protein 0.8832 60 212 GO:0016740
AF-A0A0K1EPI3-F1-model_v4 Glutathione S-transferase 0.8788 1 219 GO:0016740
AF-A0A0K1EPI3-F1-model_v4 Glutathione S-transferase 0.875 1 219 GO:0016740

Map