F424371

General Info

Members Datasets Scaffolds Average Seq Length
367 197 734 320

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10235310|Ga0207652_102353102
Length 361
Sequence MTPFSGIVLALLGSMNASGHETNVDIAIVGGGPAGLSAAVWCARYLHSVAVVDSGDARNAETLKISGYLGLDPVTPADLRCRGRETCKRLGVELIDGIVLRAEKHDDDHFLLCLEGGRRVHSRRLLLAIGLRDVWPDVPGVETIYGANAHVCPDCDGYDSRGKKVVVIGNGRRAVAMALNLSTWTRDIIICTNGRPPELDEPEYAEKLDALNIPVITERVAQVCDEETRIRCLRFDGGMELDADKVFFAIGQYPADDLGVQLGCERDEEGHIAVDSHGHTSVRNVFAAGDVTPGPQLAIVAAADGATAALAMHKSLVPAERTSSDGSFAKTRSAVALRLLFCLHTNRMWSGGVEAIGLRVS

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
188 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
189 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
190 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
191 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.91
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 18.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10235310 3300025921 Bacteria 1651
2 Ga0070658_10001939 3300005327 Bacteria 17398
3 Ga0070658_10016943 3300005327 Bacteria 5832
4 Ga0070658_10102510 3300005327 Unclassified 2367
5 Ga0070658_10254716 3300005327 Bacteria 1489
6 Ga0070658_10362309 3300005327 Bacteria 1242
7 Ga0070676_10184405 3300005328 Unclassified 1359
8 Ga0070683_100001008 3300005329 Bacteria 21086
9 Ga0070683_100002528 3300005329 Bacteria 14583
10 Ga0070683_100003737 3300005329 Bacteria 12415
11 Ga0070683_100039514 3300005329 Bacteria 4332
12 Ga0070683_100050695 3300005329 Unclassified 3843
13 Ga0070683_100101677 3300005329 Unclassified 2707
14 Ga0070683_100146746 3300005329 Bacteria 2236
15 Ga0070683_100212867 3300005329 Unclassified 1836
16 Ga0070690_100070738 3300005330 Unclassified 2266
17 Ga0070670_100153421 3300005331 Bacteria 1994
18 Ga0068869_100017553 3300005334 Bacteria 4853
19 Ga0070666_10020098 3300005335 Bacteria 4315
20 Ga0070680_100000029 3300005336 Bacteria 74849
21 Ga0070680_100004923 3300005336 Bacteria 10052
22 Ga0070680_100009009 3300005336 Bacteria 7652
23 Ga0070680_100025781 3300005336 Bacteria 4700
24 Ga0070680_100347327 3300005336 Unclassified 1261
25 Ga0070682_100012122 3300005337 Bacteria 4934
26 Ga0070660_100021559 3300005339 Bacteria 4754
27 Ga0070660_100039963 3300005339 Bacteria 3567
28 Ga0070660_100067720 3300005339 Bacteria 2782
29 Ga0070660_100182197 3300005339 Unclassified 1700
30 Ga0070689_100015754 3300005340 Bacteria 5520
31 Ga0070689_100072213 3300005340 Bacteria 2697
32 Ga0070687_100023761 3300005343 Bacteria 2916
33 Ga0070661_100005905 3300005344 Bacteria 8426
34 Ga0070661_100043737 3300005344 Bacteria 3272
35 Ga0070661_100064367 3300005344 Bacteria 2694
36 Ga0070692_10013696 3300005345 Bacteria 3787
37 Ga0070692_10109094 3300005345 Bacteria 1528
38 Ga0070668_100072271 3300005347 Bacteria 2688
39 Ga0070669_100004945 3300005353 Bacteria 9627
40 Ga0070675_100002030 3300005354 Bacteria 15012
41 Ga0070675_100038709 3300005354 Bacteria 3887
42 Ga0070671_100174052 3300005355 Bacteria 1821
43 Ga0070674_100027480 3300005356 Unclassified 3729
44 Ga0070673_100025520 3300005364 Bacteria 4352
45 Ga0070673_100028500 3300005364 Bacteria 4153
46 Ga0070688_100012770 3300005365 Unclassified 4716
47 Ga0070688_100041412 3300005365 Bacteria 2827
48 Ga0070659_100007149 3300005366 Bacteria 8101
49 Ga0070659_100008266 3300005366 Bacteria 7600
50 Ga0070659_100024692 3300005366 Bacteria 4609
51 Ga0070667_100044754 3300005367 Unclassified 3719
52 Ga0070667_100066115 3300005367 Unclassified 3072
53 Ga0070667_100126496 3300005367 Bacteria 2227
54 Ga0070667_100405000 3300005367 Bacteria 1242
55 Ga0070709_10000842 3300005434 Bacteria 17172
56 Ga0070714_100079317 3300005435 Bacteria 2855
57 Ga0070714_100351999 3300005435 Bacteria 1383
58 Ga0070714_100480514 3300005435 Bacteria 1183
59 Ga0070708_100000022 3300005445 Bacteria 113297
60 Ga0070663_100033121 3300005455 Bacteria 3567
61 Ga0070681_10000825 3300005458 Bacteria 25873
62 Ga0070681_10036199 3300005458 Unclassified 4958
63 Ga0070681_10126562 3300005458 Bacteria 2487
64 Ga0068867_100002993 3300005459 Bacteria 11910
65 Ga0070685_10026762 3300005466 Bacteria 3181
66 Ga0070685_10040691 3300005466 Unclassified 2646
67 Ga0070706_100138640 3300005467 Bacteria 2270
68 Ga0070707_100073791 3300005468 Bacteria 3290
69 Ga0070698_100075704 3300005471 Bacteria 3370
70 Ga0070679_100000638 3300005530 Bacteria 29762
71 Ga0070679_100000849 3300005530 Bacteria 26631
72 Ga0070679_100005120 3300005530 Bacteria 12116
73 Ga0070679_100014349 3300005530 Bacteria 7609
74 Ga0070679_100171881 3300005530 Unclassified 2140
75 Ga0070679_100266450 3300005530 Bacteria 1668
76 Ga0070679_100575447 3300005530 Bacteria 1070
77 Ga0070684_100004600 3300005535 Bacteria 10522
78 Ga0070684_100011375 3300005535 Bacteria 7088
79 Ga0070684_100058205 3300005535 Bacteria 3377
80 Ga0070684_100062828 3300005535 Bacteria 3254
81 Ga0070684_100424672 3300005535 Bacteria 1227
82 Ga0070684_100608090 3300005535 Bacteria 1017
83 Ga0068853_100076875 3300005539 Bacteria 2916
84 Ga0070672_100191319 3300005543 Unclassified 1708
85 Ga0070672_100213074 3300005543 Bacteria 1618
86 Ga0070696_100001523 3300005546 Bacteria 15200
87 Ga0070693_100007276 3300005547 Bacteria 5404
88 Ga0068855_100379921 3300005563 Bacteria 1551
89 Ga0068855_100462452 3300005563 Bacteria 1383
90 Ga0070664_100006441 3300005564 Bacteria 9466
91 Ga0070664_100021192 3300005564 Bacteria 5354
92 Ga0070664_100056915 3300005564 Bacteria 3323
93 Ga0070664_100073365 3300005564 Bacteria 2936
94 Ga0070664_100227238 3300005564 Bacteria 1672
95 Ga0068857_100083161 3300005577 Bacteria 2859
96 Ga0068854_100089468 3300005578 Bacteria 2288
97 Ga0068856_100007165 3300005614 Bacteria 10874
98 Ga0068856_100030344 3300005614 Bacteria 5285
99 Ga0068856_100071291 3300005614 Bacteria 3439
100 Ga0070702_100009869 3300005615 Bacteria 4687
101 Ga0068852_100137122 3300005616 Bacteria 2260
102 Ga0068859_100005632 3300005617 Bacteria 12768
103 Ga0068859_100205863 3300005617 Unclassified 2053
104 Ga0068861_100437360 3300005719 Unclassified 1169
105 Ga0068851_10061170 3300005834 Bacteria 1930
106 Ga0068851_10062595 3300005834 Bacteria 1909
107 Ga0068870_10021728 3300005840 Bacteria 3144
108 Ga0068863_100008540 3300005841 Bacteria 10007
109 Ga0068858_100029402 3300005842 Bacteria 5102
110 Ga0068858_100156135 3300005842 Unclassified 2147
111 Ga0068858_100358708 3300005842 Bacteria 1397
112 Ga0068860_100040758 3300005843 Bacteria 4437
113 Ga0068860_100061444 3300005843 Bacteria 3570
114 Ga0068862_100132318 3300005844 Bacteria 2207
115 Ga0081455_10184503 3300005937 Bacteria 1577
116 Ga0070716_100021989 3300006173 Bacteria 3367
117 Ga0070712_100096954 3300006175 Unclassified 2172
118 Ga0097621_100026692 3300006237 Bacteria 4534
119 Ga0097621_100221771 3300006237 Bacteria 1648
120 Ga0075430_100023304 3300006846 Bacteria 5268
121 Ga0075430_100115732 3300006846 Bacteria 2234
122 Ga0075431_100019872 3300006847 Bacteria 6858
123 Ga0075431_100037056 3300006847 Bacteria 5024
124 Ga0075434_100192468 3300006871 Bacteria 2060
125 Ga0068865_100028361 3300006881 Unclassified 3706
126 Ga0097620_100005633 3300006931 Bacteria 12768
127 Ga0097620_100205859 3300006931 Unclassified 2053
128 Ga0097620_100436501 3300006931 Unclassified 1406
129 Ga0075435_100025630 3300007076 Bacteria 4591
130 Ga0105240_10072276 3300009093 Bacteria 4263
131 Ga0105240_10098333 3300009093 Bacteria 3564
132 Ga0105240_10184113 3300009093 Bacteria 2462
133 Ga0105245_10258170 3300009098 Bacteria 1695
134 Ga0105242_10004378 3300009176 Bacteria 10986
135 Ga0105242_10010408 3300009176 Bacteria 7135
136 Ga0105242_10011514 3300009176 Bacteria 6802
137 Ga0105242_10211249 3300009176 Bacteria 1730
138 Ga0105248_10046071 3300009177 Bacteria 4888
139 Ga0105248_10071808 3300009177 Unclassified 3889
140 Ga0105248_10116265 3300009177 Bacteria 3017
141 Ga0105248_10140132 3300009177 Bacteria 2728
142 Ga0105248_10255923 3300009177 Unclassified 1971
143 Ga0105238_10096216 3300009551 Bacteria 2947
144 Ga0105238_10595713 3300009551 Unclassified 1113
145 Ga0105249_10310343 3300009553 Unclassified 1585
146 Ga0105249_10368395 3300009553 Bacteria 1460
147 Ga0105246_10003763 3300011119 Bacteria 9195
148 Ga0157373_10020566 3300013100 Bacteria 4795
149 Ga0157371_10003337 3300013102 Bacteria 14646
150 Ga0157371_10126464 3300013102 Unclassified 1818
151 Ga0157371_10353144 3300013102 Bacteria 1070
152 Ga0157370_10002249 3300013104 Bacteria 23463
153 Ga0157370_10022009 3300013104 Bacteria 6347
154 Ga0157370_10455213 3300013104 Unclassified 1176
155 Ga0157369_10024759 3300013105 Bacteria 6669
156 Ga0157369_10026277 3300013105 Bacteria 6459
157 Ga0157374_10009123 3300013296 Bacteria 8501
158 Ga0157372_10006934 3300013307 Bacteria 12056
159 Ga0157372_10015067 3300013307 Bacteria 8276
160 Ga0157372_10040714 3300013307 Bacteria 5134
161 Ga0157372_10049931 3300013307 Bacteria 4654
162 Ga0157372_10059468 3300013307 Unclassified 4274
163 Ga0157372_10238240 3300013307 Unclassified 2111
164 Ga0157372_10268987 3300013307 Bacteria 1980
165 Ga0157372_10291582 3300013307 Bacteria 1897
166 Ga0157372_10295835 3300013307 Unclassified 1883
167 Ga0157372_10370964 3300013307 Bacteria 1668
168 Ga0157375_10040205 3300013308 Bacteria 4506
169 Ga0157375_10131718 3300013308 Bacteria 2620
170 Ga0157375_10134256 3300013308 Bacteria 2597
171 Ga0157375_10220054 3300013308 Unclassified 2057
172 Ga0157375_10344661 3300013308 Bacteria 1655
173 Ga0163163_10459615 3300014325 Bacteria 1333
174 Ga0157377_10003193 3300014745 Bacteria 7391
175 Ga0157377_10026740 3300014745 Bacteria 3091
176 Ga0157376_10027240 3300014969 Bacteria 4528
177 Ga0157376_10099176 3300014969 Bacteria 2541
178 Ga0213876_10053422 3300021384 Bacteria 2134
179 Ga0207656_10034290 3300025321 Bacteria 2119
180 Ga0207656_10077749 3300025321 Unclassified 1486
181 Ga0207680_10012126 3300025903 Bacteria 4382
182 Ga0207699_10008306 3300025906 Bacteria 5117
183 Ga0207645_10035655 3300025907 Unclassified 3193
184 Ga0207645_10077119 3300025907 Bacteria 2135
185 Ga0207645_10238160 3300025907 Bacteria 1202
186 Ga0207705_10021425 3300025909 Bacteria 4612
187 Ga0207705_10030318 3300025909 Bacteria 3859
188 Ga0207705_10120630 3300025909 Bacteria 1945
189 Ga0207705_10152615 3300025909 Unclassified 1731
190 Ga0207705_10263793 3300025909 Bacteria 1316
191 Ga0207705_10284489 3300025909 Bacteria 1266
192 Ga0207684_10104210 3300025910 Bacteria 2425
193 Ga0207707_10000714 3300025912 Bacteria 32936
194 Ga0207707_10004108 3300025912 Bacteria 12898
195 Ga0207707_10126176 3300025912 Bacteria 2238
196 Ga0207695_10002428 3300025913 Bacteria 27592
197 Ga0207693_10133610 3300025915 Unclassified 1950
198 Ga0207663_10091530 3300025916 Unclassified 2020
199 Ga0207660_10000190 3300025917 Bacteria 38999
200 Ga0207660_10003615 3300025917 Bacteria 10077
201 Ga0207660_10111314 3300025917 Unclassified 2061
202 Ga0207657_10002599 3300025919 Bacteria 19538
203 Ga0207657_10033750 3300025919 Bacteria 4610
204 Ga0207657_10144954 3300025919 Bacteria 1938
205 Ga0207649_10065863 3300025920 Bacteria 2295
206 Ga0207649_10219963 3300025920 Bacteria 1352
207 Ga0207652_10000326 3300025921 Bacteria 49276
208 Ga0207652_10035518 3300025921 Unclassified 4207
209 Ga0207652_10170501 3300025921 Unclassified 1953
210 Ga0207652_10326408 3300025921 Bacteria 1385
211 Ga0207652_10342325 3300025921 Unclassified 1350
212 Ga0207646_10111626 3300025922 Bacteria 2454
213 Ga0207646_10146651 3300025922 Bacteria 2126
214 Ga0207681_10006597 3300025923 Bacteria 7127
215 Ga0207694_10137481 3300025924 Bacteria 1963
216 Ga0207659_10014469 3300025926 Bacteria 5090
217 Ga0207659_10188875 3300025926 Bacteria 1638
218 Ga0207687_10009067 3300025927 Bacteria 6507
219 Ga0207700_10063504 3300025928 Unclassified 2809
220 Ga0207700_10401395 3300025928 Bacteria 1201
221 Ga0207664_10456976 3300025929 Bacteria 1140
222 Ga0207690_10022472 3300025932 Bacteria 3925
223 Ga0207690_10032032 3300025932 Bacteria 3370
224 Ga0207690_10075894 3300025932 Bacteria 2332
225 Ga0207706_10143544 3300025933 Bacteria 2100
226 Ga0207686_10004267 3300025934 Bacteria 7662
227 Ga0207670_10044187 3300025936 Bacteria 2947
228 Ga0207704_10030474 3300025938 Bacteria 3024
229 Ga0207665_10098831 3300025939 Unclassified 2034
230 Ga0207691_10007226 3300025940 Bacteria 10712
231 Ga0207691_10014612 3300025940 Bacteria 7483
232 Ga0207691_10035246 3300025940 Bacteria 4647
233 Ga0207691_10197800 3300025940 Unclassified 1750
234 Ga0207711_10142030 3300025941 Bacteria 2161
235 Ga0207711_10293380 3300025941 Unclassified 1499
236 Ga0207711_10324866 3300025941 Bacteria 1422
237 Ga0207689_10002486 3300025942 Bacteria 17118
238 Ga0207689_10046307 3300025942 Unclassified 3595
239 Ga0207661_10004559 3300025944 Bacteria 9716
240 Ga0207661_10011309 3300025944 Bacteria 6461
241 Ga0207661_10021048 3300025944 Bacteria 4884
242 Ga0207661_10036812 3300025944 Unclassified 3823
243 Ga0207661_10044087 3300025944 Bacteria 3523
244 Ga0207661_10044124 3300025944 Bacteria 3522
245 Ga0207661_10047777 3300025944 Unclassified 3399
246 Ga0207661_10069895 3300025944 Bacteria 2864
247 Ga0207661_10262019 3300025944 Bacteria 1540
248 Ga0207661_10268799 3300025944 Bacteria 1521
249 Ga0207679_10007328 3300025945 Bacteria 6992
250 Ga0207679_10010063 3300025945 Bacteria 6077
251 Ga0207679_10335089 3300025945 Bacteria 1314
252 Ga0207679_10459768 3300025945 Bacteria 1130
253 Ga0207667_10033812 3300025949 Bacteria 5493
254 Ga0207667_10213194 3300025949 Bacteria 1979
255 Ga0207651_10007761 3300025960 Bacteria 5735
256 Ga0207651_10018689 3300025960 Bacteria 4133
257 Ga0207712_10108833 3300025961 Bacteria 2075
258 Ga0207668_10173119 3300025972 Bacteria 1695
259 Ga0207658_10143366 3300025986 Unclassified 1937
260 Ga0207658_10202330 3300025986 Bacteria 1659
261 Ga0207658_10202539 3300025986 Unclassified 1658
262 Ga0207703_10023160 3300026035 Bacteria 4877
263 Ga0207703_10076821 3300026035 Bacteria 2771
264 Ga0207703_10302145 3300026035 Bacteria 1460
265 Ga0207639_10048512 3300026041 Bacteria 3214
266 Ga0207639_10359593 3300026041 Bacteria 1302
267 Ga0207678_10000564 3300026067 Bacteria 33856
268 Ga0207702_10005618 3300026078 Bacteria 10942
269 Ga0207702_10126922 3300026078 Unclassified 2291
270 Ga0207702_10529693 3300026078 Bacteria 1151
271 Ga0207641_10012787 3300026088 Bacteria 6880
272 Ga0207648_10067206 3300026089 Bacteria 3126
273 Ga0207648_10072260 3300026089 Unclassified 3007
274 Ga0207676_10207840 3300026095 Bacteria 1734
275 Ga0207674_10001547 3300026116 Bacteria 29625
276 Ga0207674_10007327 3300026116 Bacteria 12849
277 Ga0207674_10018765 3300026116 Archaea 7505
278 Ga0207674_10101490 3300026116 Bacteria 2858
279 Ga0207683_10221294 3300026121 Bacteria 1725
280 Ga0207683_10221993 3300026121 Unclassified 1722
281 Ga0207698_10028679 3300026142 Bacteria 3973
282 Ga0207698_10109701 3300026142 Bacteria 2310
283 Ga0268265_10141618 3300028380 Unclassified 2014
284 Ga0307413_10150153 3300031824 Bacteria 1622
285 Ga0307413_10152264 3300031824 Bacteria 1613
286 Ga0307413_10180623 3300031824 Bacteria 1504
287 Ga0307407_10170246 3300031903 Bacteria 1434
288 Ga0307409_100113381 3300031995 Bacteria 2278
289 Ga0307416_100089950 3300032002 Bacteria 2630
290 Ga0307411_10044652 3300032005 Bacteria 2845
291 Ga0307415_100063133 3300032126 Bacteria 2572
292 Ga0373934_0015221 3300035086 Bacteria 2917
293 Ga0373955_0001517 3300035172 Bacteria 9913
294 Ga0373931_0034105 3300035691 Bacteria 2640
295 Ga0373927_0029344 3300035695 Unclassified 3584
296 Ga0373927_0045431 3300035695 Bacteria 2841
297 Ga0373933_0008013 3300035724 Bacteria 5764
298 Ga0373937_0000680 3300036401 Bacteria 29596
299 Ga0373937_0038268 3300036401 Bacteria 4372
300 Ga0373925_0015671 3300037068 Bacteria 5485
301 Ga0395905_0108577 3300037471 Bacteria 2605
302 Ga0436365_0936634 3300039437 Bacteria 3207
303 Ga0466961_0127802 3300044693 Bacteria 1594
304 Ga0466963_0006471 3300044694 Bacteria 6930
305 Ga0451576_0038349 3300045051 Bacteria 5071
306 Ga0451576_0369222 3300045051 Bacteria 1503
307 Ga0451576_0480355 3300045051 Bacteria 1305
308 Ga0466967_0043685 3300045976 Bacteria 3882
309 Ga0466967_0047051 3300045976 Bacteria 3759
310 Ga0495629_0020364 3300046459 Unclassified 4738
311 Ga0495651_0065832 3300046462 Bacteria 2767
312 Ga0495580_0038111 3300046472 Unclassified 3445
313 Ga0495582_0018543 3300046473 Unclassified 3804
314 Ga0495594_0013708 3300046499 Bacteria 4237
315 Ga0495652_0030337 3300046529 Bacteria 4743
316 Ga0495586_0052129 3300046535 Bacteria 2215
317 Ga0495587_0000626 3300046536 Bacteria 23805
318 Ga0495587_0192233 3300046536 Bacteria 1155
319 Ga0495645_0000347 3300046543 Bacteria 32813
320 Ga0495667_0004541 3300046559 Bacteria 9373
321 Ga0495657_0065668 3300046675 Bacteria 2386
322 Ga0495599_0002652 3300046678 Bacteria 10434
323 Ga0495623_0044051 3300046679 Bacteria 2837
324 Ga0495658_0036927 3300046683 Unclassified 2699
325 Ga0495658_0065322 3300046683 Bacteria 2099
326 Ga0495613_0055989 3300046689 Bacteria 2896
327 Ga0495600_0010119 3300046809 Bacteria 5847
328 Ga0495600_0042561 3300046809 Unclassified 2961
329 Ga0495581_0021208 3300047315 Unclassified 3768
330 Ga0495636_0141406 3300047318 Bacteria 1075
331 Ga0495675_0009038 3300047444 Bacteria 6194
332 Ga0495675_0253694 3300047444 Bacteria 1055
333 Ga0495684_0072943 3300047471 Bacteria 2608
334 Ga0495602_0350636 3300048088 Bacteria 1065
335 Ga0495602_0374138 3300048088 Bacteria 1022
336 Ga0496101_0034136 3300048904 Bacteria 3592
337 Ga0496108_0075824 3300048911 Bacteria 2842
338 Ga0496109_0059284 3300048912 Unclassified 3497
339 Ga0496112_0017568 3300048915 Bacteria 6724
340 Ga0496112_0067035 3300048915 Bacteria 3542
341 Ga0496113_0031667 3300048916 Bacteria 3840
342 Ga0496113_0036929 3300048916 Bacteria 3582
343 Ga0501031_0291315 3300049568 Bacteria 1058
344 Ga0501034_0065897 3300049571 Unclassified 3636
345 Ga0501039_0148818 3300049575 Unclassified 1840
346 Ga0501040_0035303 3300049576 Bacteria 3390
347 Ga0501043_0062536 3300049579 Unclassified 2923
348 Ga0501047_0111887 3300049581 Unclassified 2613
349 Ga0501048_0156090 3300049582 Bacteria 1614
350 Ga0501071_0173842 3300049587 Bacteria 1613
351 Ga0501072_0175345 3300049588 Bacteria 1710
352 Ga0501072_0379951 3300049588 Bacteria 1121
353 Ga0501073_0224653 3300049589 Bacteria 1297
354 Ga0501074_0279796 3300049590 Bacteria 1186
355 Ga0501224_000855 3300049664 Unclassified 3898
356 Ga0501243_000360 3300049675 Bacteria 6000
357 Ga0501249_019842 3300049679 Bacteria 1460
358 Ga0501259_002964 3300049688 Bacteria 2722
359 Ga0501221_000882 3300049704 Unclassified 4909
360 Ga0501079_0086818 3300049741 Bacteria 2422
361 Ga0501268_000130 3300049765 Bacteria 6513
362 Ga0501035_0011276 3300049822 Bacteria 8282
363 nmdc:mga0qj67_108679_c1 3300050509 Bacteria 2238
364 nmdc:mga0qj67_23043_c1 3300050509 Bacteria 4786
365 nmdc:mga06r32_20974_c1 3300050510 Bacteria 6025
366 nmdc:mga06r32_7335_c1 3300050510 Bacteria 9918
367 nmdc:mga0n895_109176_c1 3300050512 Bacteria 2782
368 Ga0207652_10235310
369 Ga0070658_10001939
370 Ga0070658_10016943
371 Ga0070658_10102510
372 Ga0070658_10254716
373 Ga0070658_10362309
374 Ga0070676_10184405
375 Ga0070683_100001008
376 Ga0070683_100002528
377 Ga0070683_100003737
378 Ga0070683_100039514
379 Ga0070683_100050695
380 Ga0070683_100101677
381 Ga0070683_100146746
382 Ga0070683_100212867
383 Ga0070690_100070738
384 Ga0070670_100153421
385 Ga0068869_100017553
386 Ga0070666_10020098
387 Ga0070680_100000029
388 Ga0070680_100004923
389 Ga0070680_100009009
390 Ga0070680_100025781
391 Ga0070680_100347327
392 Ga0070682_100012122
393 Ga0070660_100021559
394 Ga0070660_100039963
395 Ga0070660_100067720
396 Ga0070660_100182197
397 Ga0070689_100015754
398 Ga0070689_100072213
399 Ga0070687_100023761
400 Ga0070661_100005905
401 Ga0070661_100043737
402 Ga0070661_100064367
403 Ga0070692_10013696
404 Ga0070692_10109094
405 Ga0070668_100072271
406 Ga0070669_100004945
407 Ga0070675_100002030
408 Ga0070675_100038709
409 Ga0070671_100174052
410 Ga0070674_100027480
411 Ga0070673_100025520
412 Ga0070673_100028500
413 Ga0070688_100012770
414 Ga0070688_100041412
415 Ga0070659_100007149
416 Ga0070659_100008266
417 Ga0070659_100024692
418 Ga0070667_100044754
419 Ga0070667_100066115
420 Ga0070667_100126496
421 Ga0070667_100405000
422 Ga0070709_10000842
423 Ga0070714_100079317
424 Ga0070714_100351999
425 Ga0070714_100480514
426 Ga0070708_100000022
427 Ga0070663_100033121
428 Ga0070681_10000825
429 Ga0070681_10036199
430 Ga0070681_10126562
431 Ga0068867_100002993
432 Ga0070685_10026762
433 Ga0070685_10040691
434 Ga0070706_100138640
435 Ga0070707_100073791
436 Ga0070698_100075704
437 Ga0070679_100000638
438 Ga0070679_100000849
439 Ga0070679_100005120
440 Ga0070679_100014349
441 Ga0070679_100171881
442 Ga0070679_100266450
443 Ga0070679_100575447
444 Ga0070684_100004600
445 Ga0070684_100011375
446 Ga0070684_100058205
447 Ga0070684_100062828
448 Ga0070684_100424672
449 Ga0070684_100608090
450 Ga0068853_100076875
451 Ga0070672_100191319
452 Ga0070672_100213074
453 Ga0070696_100001523
454 Ga0070693_100007276
455 Ga0068855_100379921
456 Ga0068855_100462452
457 Ga0070664_100006441
458 Ga0070664_100021192
459 Ga0070664_100056915
460 Ga0070664_100073365
461 Ga0070664_100227238
462 Ga0068857_100083161
463 Ga0068854_100089468
464 Ga0068856_100007165
465 Ga0068856_100030344
466 Ga0068856_100071291
467 Ga0070702_100009869
468 Ga0068852_100137122
469 Ga0068859_100005632
470 Ga0068859_100205863
471 Ga0068861_100437360
472 Ga0068851_10061170
473 Ga0068851_10062595
474 Ga0068870_10021728
475 Ga0068863_100008540
476 Ga0068858_100029402
477 Ga0068858_100156135
478 Ga0068858_100358708
479 Ga0068860_100040758
480 Ga0068860_100061444
481 Ga0068862_100132318
482 Ga0081455_10184503
483 Ga0070716_100021989
484 Ga0070712_100096954
485 Ga0097621_100026692
486 Ga0097621_100221771
487 Ga0075430_100023304
488 Ga0075430_100115732
489 Ga0075431_100019872
490 Ga0075431_100037056
491 Ga0075434_100192468
492 Ga0068865_100028361
493 Ga0097620_100005633
494 Ga0097620_100205859
495 Ga0097620_100436501
496 Ga0075435_100025630
497 Ga0105240_10072276
498 Ga0105240_10098333
499 Ga0105240_10184113
500 Ga0105245_10258170
501 Ga0105242_10004378
502 Ga0105242_10010408
503 Ga0105242_10011514
504 Ga0105242_10211249
505 Ga0105248_10046071
506 Ga0105248_10071808
507 Ga0105248_10116265
508 Ga0105248_10140132
509 Ga0105248_10255923
510 Ga0105238_10096216
511 Ga0105238_10595713
512 Ga0105249_10310343
513 Ga0105249_10368395
514 Ga0105246_10003763
515 Ga0157373_10020566
516 Ga0157371_10003337
517 Ga0157371_10126464
518 Ga0157371_10353144
519 Ga0157370_10002249
520 Ga0157370_10022009
521 Ga0157370_10455213
522 Ga0157369_10024759
523 Ga0157369_10026277
524 Ga0157374_10009123
525 Ga0157372_10006934
526 Ga0157372_10015067
527 Ga0157372_10040714
528 Ga0157372_10049931
529 Ga0157372_10059468
530 Ga0157372_10238240
531 Ga0157372_10268987
532 Ga0157372_10291582
533 Ga0157372_10295835
534 Ga0157372_10370964
535 Ga0157375_10040205
536 Ga0157375_10131718
537 Ga0157375_10134256
538 Ga0157375_10220054
539 Ga0157375_10344661
540 Ga0163163_10459615
541 Ga0157377_10003193
542 Ga0157377_10026740
543 Ga0157376_10027240
544 Ga0157376_10099176
545 Ga0213876_10053422
546 Ga0207656_10034290
547 Ga0207656_10077749
548 Ga0207680_10012126
549 Ga0207699_10008306
550 Ga0207645_10035655
551 Ga0207645_10077119
552 Ga0207645_10238160
553 Ga0207705_10021425
554 Ga0207705_10030318
555 Ga0207705_10120630
556 Ga0207705_10152615
557 Ga0207705_10263793
558 Ga0207705_10284489
559 Ga0207684_10104210
560 Ga0207707_10000714
561 Ga0207707_10004108
562 Ga0207707_10126176
563 Ga0207695_10002428
564 Ga0207693_10133610
565 Ga0207663_10091530
566 Ga0207660_10000190
567 Ga0207660_10003615
568 Ga0207660_10111314
569 Ga0207657_10002599
570 Ga0207657_10033750
571 Ga0207657_10144954
572 Ga0207649_10065863
573 Ga0207649_10219963
574 Ga0207652_10000326
575 Ga0207652_10035518
576 Ga0207652_10170501
577 Ga0207652_10326408
578 Ga0207652_10342325
579 Ga0207646_10111626
580 Ga0207646_10146651
581 Ga0207681_10006597
582 Ga0207694_10137481
583 Ga0207659_10014469
584 Ga0207659_10188875
585 Ga0207687_10009067
586 Ga0207700_10063504
587 Ga0207700_10401395
588 Ga0207664_10456976
589 Ga0207690_10022472
590 Ga0207690_10032032
591 Ga0207690_10075894
592 Ga0207706_10143544
593 Ga0207686_10004267
594 Ga0207670_10044187
595 Ga0207704_10030474
596 Ga0207665_10098831
597 Ga0207691_10007226
598 Ga0207691_10014612
599 Ga0207691_10035246
600 Ga0207691_10197800
601 Ga0207711_10142030
602 Ga0207711_10293380
603 Ga0207711_10324866
604 Ga0207689_10002486
605 Ga0207689_10046307
606 Ga0207661_10004559
607 Ga0207661_10011309
608 Ga0207661_10021048
609 Ga0207661_10036812
610 Ga0207661_10044087
611 Ga0207661_10044124
612 Ga0207661_10047777
613 Ga0207661_10069895
614 Ga0207661_10262019
615 Ga0207661_10268799
616 Ga0207679_10007328
617 Ga0207679_10010063
618 Ga0207679_10335089
619 Ga0207679_10459768
620 Ga0207667_10033812
621 Ga0207667_10213194
622 Ga0207651_10007761
623 Ga0207651_10018689
624 Ga0207712_10108833
625 Ga0207668_10173119
626 Ga0207658_10143366
627 Ga0207658_10202330
628 Ga0207658_10202539
629 Ga0207703_10023160
630 Ga0207703_10076821
631 Ga0207703_10302145
632 Ga0207639_10048512
633 Ga0207639_10359593
634 Ga0207678_10000564
635 Ga0207702_10005618
636 Ga0207702_10126922
637 Ga0207702_10529693
638 Ga0207641_10012787
639 Ga0207648_10067206
640 Ga0207648_10072260
641 Ga0207676_10207840
642 Ga0207674_10001547
643 Ga0207674_10007327
644 Ga0207674_10018765
645 Ga0207674_10101490
646 Ga0207683_10221294
647 Ga0207683_10221993
648 Ga0207698_10028679
649 Ga0207698_10109701
650 Ga0268265_10141618
651 Ga0307413_10150153
652 Ga0307413_10152264
653 Ga0307413_10180623
654 Ga0307407_10170246
655 Ga0307409_100113381
656 Ga0307416_100089950
657 Ga0307411_10044652
658 Ga0307415_100063133
659 Ga0373934_0015221
660 Ga0373955_0001517
661 Ga0373931_0034105
662 Ga0373927_0029344
663 Ga0373927_0045431
664 Ga0373933_0008013
665 Ga0373937_0000680
666 Ga0373937_0038268
667 Ga0373925_0015671
668 Ga0395905_0108577
669 Ga0436365_0936634
670 Ga0466961_0127802
671 Ga0466963_0006471
672 Ga0451576_0038349
673 Ga0451576_0369222
674 Ga0451576_0480355
675 Ga0466967_0043685
676 Ga0466967_0047051
677 Ga0495629_0020364
678 Ga0495651_0065832
679 Ga0495580_0038111
680 Ga0495582_0018543
681 Ga0495594_0013708
682 Ga0495652_0030337
683 Ga0495586_0052129
684 Ga0495587_0000626
685 Ga0495587_0192233
686 Ga0495645_0000347
687 Ga0495667_0004541
688 Ga0495657_0065668
689 Ga0495599_0002652
690 Ga0495623_0044051
691 Ga0495658_0036927
692 Ga0495658_0065322
693 Ga0495613_0055989
694 Ga0495600_0010119
695 Ga0495600_0042561
696 Ga0495581_0021208
697 Ga0495636_0141406
698 Ga0495675_0009038
699 Ga0495675_0253694
700 Ga0495684_0072943
701 Ga0495602_0350636
702 Ga0495602_0374138
703 Ga0496101_0034136
704 Ga0496108_0075824
705 Ga0496109_0059284
706 Ga0496112_0017568
707 Ga0496112_0067035
708 Ga0496113_0031667
709 Ga0496113_0036929
710 Ga0501031_0291315
711 Ga0501034_0065897
712 Ga0501039_0148818
713 Ga0501040_0035303
714 Ga0501043_0062536
715 Ga0501047_0111887
716 Ga0501048_0156090
717 Ga0501071_0173842
718 Ga0501072_0175345
719 Ga0501072_0379951
720 Ga0501073_0224653
721 Ga0501074_0279796
722 Ga0501224_000855
723 Ga0501243_000360
724 Ga0501249_019842
725 Ga0501259_002964
726 Ga0501221_000882
727 Ga0501079_0086818
728 Ga0501268_000130
729 Ga0501035_0011276
730 nmdc:mga0qj67_108679_c1
731 nmdc:mga0qj67_23043_c1
732 nmdc:mga06r32_20974_c1
733 nmdc:mga06r32_7335_c1
734 nmdc:mga0n895_109176_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

25

71

0.88

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

24

305

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mig-assembly1.cif.gz_A pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.998 22 50
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9971 22 50
4mig-assembly1.cif.gz_C pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9956 22 50
4mig-assembly1.cif.gz_B pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9943 22 50
4mif-assembly1.cif.gz_B pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9915 22 50
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.976 24 52 3.50.50.60
4ntdA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9028 134 244 3.50.50.60
4fk1D02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8913 134 245 3.50.50.60
af_Q04601_13_227_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8878 94 121 2.130.10.10
4ntdA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8877 134 244 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6N7PYE4-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9573 19 313 GO:0016491
AF-A0A2V7WME6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9568 21 324 GO:0016491
AF-A0A7W0RSJ1-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9527 93 320 GO:0016491
AF-A0A7V8XNW7-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.949 72 313 GO:0016491
AF-A0A537JQP4-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.947 149 312 GO:0016491

Map