F424281

General Info

Members Datasets Scaffolds Average Seq Length
367 234 734 152

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100956853|Ga0068867_1009568532
Length 168
Sequence MKVVPVTDRSGKILDEALLRASEDVHRQLRAHLPQGEGYVRRMKEVFAGGAEMASVVVDKKVVGVTVYRMLERTFSGRELYCDDLVTDSTQRSTGVGRAMMEFMEKLARERDCDTFALDSGCQRQQAHKFYFREKLTISSFHFTRTLKGQPLSERVRGLPPTGTGFNS

Samples

Sample ID Description Type Environment
1 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
232 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 1.36
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 4.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068867_100956853 3300005459 Bacteria 774
2 Ga0065712_10014536 3300005290 Bacteria 1747
3 Ga0065712_10693794 3300005290 Bacteria 549
4 Ga0070658_11078145 3300005327 Bacteria 699
5 Ga0070676_10415750 3300005328 Bacteria 939
6 Ga0070683_100071025 3300005329 Bacteria 3248
7 Ga0070690_100061645 3300005330 Bacteria 2417
8 Ga0070670_101326233 3300005331 Bacteria 659
9 Ga0068869_100325342 3300005334 Bacteria 1248
10 Ga0070680_100551933 3300005336 Bacteria 987
11 Ga0068868_100159768 3300005338 Bacteria 1860
12 Ga0068868_100161653 3300005338 Bacteria 1850
13 Ga0070660_101671763 3300005339 Unclassified 542
14 Ga0070689_100063979 3300005340 Bacteria 2862
15 Ga0070689_100190982 3300005340 Bacteria 1668
16 Ga0070689_100241480 3300005340 Bacteria 1488
17 Ga0070687_100485228 3300005343 Bacteria 829
18 Ga0070675_100008065 3300005354 Bacteria 8163
19 Ga0070671_100261822 3300005355 Bacteria 1470
20 Ga0070674_100016477 3300005356 Bacteria 4632
21 Ga0070674_100302405 3300005356 Bacteria 1276
22 Ga0070673_100058547 3300005364 Bacteria 3046
23 Ga0070673_100138116 3300005364 Bacteria 2054
24 Ga0070688_100055071 3300005365 Bacteria 2493
25 Ga0070714_100018969 3300005435 Bacteria 5596
26 Ga0070714_100788265 3300005435 Bacteria 920
27 Ga0070713_100281921 3300005436 Bacteria 1525
28 Ga0070713_101505528 3300005436 Bacteria 653
29 Ga0070701_10356777 3300005438 Bacteria 915
30 Ga0070701_10365205 3300005438 Bacteria 905
31 Ga0070711_100282577 3300005439 Bacteria 1313
32 Ga0070705_100231201 3300005440 Bacteria 1286
33 Ga0070705_100311946 3300005440 Bacteria 1132
34 Ga0070700_100965682 3300005441 Unclassified 698
35 Ga0070694_100615118 3300005444 Bacteria 876
36 Ga0070694_100615871 3300005444 Unclassified 876
37 Ga0070678_100928689 3300005456 Bacteria 797
38 Ga0070681_10128508 3300005458 Bacteria 2467
39 Ga0070681_10388358 3300005458 Bacteria 1307
40 Ga0068867_100064592 3300005459 Bacteria 2722
41 Ga0068867_100368319 3300005459 Bacteria 1204
42 Ga0068867_100895875 3300005459 Bacteria 798
43 Ga0070685_10509643 3300005466 Bacteria 853
44 Ga0070707_100749617 3300005468 Bacteria 940
45 Ga0070698_100539411 3300005471 Bacteria 1106
46 Ga0070698_100598482 3300005471 Bacteria 1043
47 Ga0070699_100159410 3300005518 Bacteria 1997
48 Ga0070684_101022457 3300005535 Bacteria 776
49 Ga0068853_100711097 3300005539 Bacteria 959
50 Ga0070672_101036803 3300005543 Bacteria 728
51 Ga0070672_101149826 3300005543 Bacteria 691
52 Ga0070695_100540393 3300005545 Bacteria 907
53 Ga0070696_100154143 3300005546 Bacteria 1688
54 Ga0070696_100208570 3300005546 Bacteria 1462
55 Ga0070696_100672263 3300005546 Bacteria 841
56 Ga0070693_100004099 3300005547 Bacteria 6861
57 Ga0070693_100358644 3300005547 Bacteria 1000
58 Ga0070693_100573941 3300005547 Bacteria 811
59 Ga0070665_100950683 3300005548 Bacteria 872
60 Ga0070704_100038043 3300005549 Bacteria 3292
61 Ga0068855_100010345 3300005563 Bacteria 11251
62 Ga0068855_100101749 3300005563 Bacteria 3307
63 Ga0068855_101065531 3300005563 Bacteria 847
64 Ga0068854_101495201 3300005578 Bacteria 613
65 Ga0068856_100270952 3300005614 Bacteria 1713
66 Ga0070702_100237212 3300005615 Bacteria 1229
67 Ga0068852_100012792 3300005616 Bacteria 6393
68 Ga0068859_100234705 3300005617 Bacteria 1923
69 Ga0068859_101572847 3300005617 Bacteria 726
70 Ga0068864_101372563 3300005618 Bacteria 708
71 Ga0068864_101543532 3300005618 Bacteria 667
72 Ga0068851_10001634 3300005834 Bacteria 9838
73 Ga0068851_10165083 3300005834 Bacteria 1219
74 Ga0068863_100298711 3300005841 Bacteria 1562
75 Ga0068858_100047233 3300005842 Bacteria 3991
76 Ga0068858_100197926 3300005842 Bacteria 1899
77 Ga0068860_100639087 3300005843 Bacteria 1072
78 Ga0068860_101079703 3300005843 Bacteria 822
79 Ga0081539_10027454 3300005985 Bacteria 3606
80 Ga0070717_10449078 3300006028 Bacteria 1162
81 Ga0075364_10364134 3300006051 Bacteria 986
82 Ga0070715_10110312 3300006163 Bacteria 1297
83 Ga0070712_100510109 3300006175 Bacteria 1009
84 Ga0075366_10007028 3300006195 Bacteria 6192
85 Ga0075366_10074343 3300006195 Bacteria 2026
86 Ga0097621_100007003 3300006237 Bacteria 8028
87 Ga0097621_100105793 3300006237 Bacteria 2373
88 Ga0068871_100059325 3300006358 Bacteria 3117
89 Ga0068871_100196046 3300006358 Bacteria 1742
90 Ga0075428_100221882 3300006844 Bacteria 2041
91 Ga0075434_100163069 3300006871 Bacteria 2249
92 Ga0075434_100639114 3300006871 Bacteria 1083
93 Ga0075434_101544753 3300006871 Bacteria 673
94 Ga0068865_100529328 3300006881 Bacteria 987
95 Ga0068865_101270280 3300006881 Bacteria 654
96 Ga0068865_101325613 3300006881 Archaea 641
97 Ga0075436_100000976 3300006914 Bacteria 19195
98 Ga0097620_100234700 3300006931 Bacteria 1923
99 Ga0097620_101573055 3300006931 Bacteria 726
100 Ga0075435_101044489 3300007076 Bacteria 714
101 Ga0099794_10199218 3300007265 Bacteria 1025
102 Ga0105240_10024551 3300009093 Bacteria 7944
103 Ga0105240_10267528 3300009093 Bacteria 1970
104 Ga0111539_10039083 3300009094 Bacteria 5721
105 Ga0105245_10184816 3300009098 Bacteria 1993
106 Ga0105245_10389325 3300009098 Bacteria 1390
107 Ga0105245_11743056 3300009098 Bacteria 675
108 Ga0105245_11967892 3300009098 Bacteria 638
109 Ga0105245_12071622 3300009098 Bacteria 623
110 Ga0105247_11102464 3300009101 Bacteria 626
111 Ga0105243_10244438 3300009148 Bacteria 1599
112 Ga0105243_10541028 3300009148 Bacteria 1111
113 Ga0105241_10018819 3300009174 Bacteria 5088
114 Ga0105241_10436368 3300009174 Bacteria 1156
115 Ga0105241_10708299 3300009174 Bacteria 920
116 Ga0105242_10002333 3300009176 Bacteria 14972
117 Ga0105242_10043262 3300009176 Bacteria 3643
118 Ga0105242_10224033 3300009176 Bacteria 1682
119 Ga0105242_10493465 3300009176 Bacteria 1163
120 Ga0105242_10495014 3300009176 Bacteria 1162
121 Ga0105248_10013501 3300009177 Bacteria 8993
122 Ga0105248_10149352 3300009177 Bacteria 2636
123 Ga0105238_10003744 3300009551 Bacteria 15118
124 Ga0105238_10261562 3300009551 Bacteria 1710
125 Ga0105238_10508191 3300009551 Bacteria 1206
126 Ga0105239_11548017 3300010375 Bacteria 766
127 Ga0157370_10002820 3300013104 Bacteria 20763
128 Ga0157369_10110917 3300013105 Bacteria 2916
129 Ga0157369_11952975 3300013105 Bacteria 595
130 Ga0157374_10244038 3300013296 Bacteria 1767
131 Ga0157378_10312477 3300013297 Bacteria 1524
132 Ga0157378_10772895 3300013297 Bacteria 985
133 Ga0163162_10152099 3300013306 Bacteria 2432
134 Ga0163162_10230571 3300013306 Bacteria 1982
135 Ga0163162_10291687 3300013306 Bacteria 1763
136 Ga0163162_10778351 3300013306 Bacteria 1075
137 Ga0157372_11072052 3300013307 Bacteria 932
138 Ga0157375_10059035 3300013308 Bacteria 3798
139 Ga0157380_10328765 3300014326 Bacteria 1421
140 Ga0157380_11694652 3300014326 Unclassified 689
141 Ga0157379_10200322 3300014968 Bacteria 1805
142 Ga0157379_10263622 3300014968 Bacteria 1566
143 Ga0157376_10097652 3300014969 Bacteria 2559
144 Ga0157376_10294582 3300014969 Bacteria 1533
145 Ga0157376_10911298 3300014969 Bacteria 898
146 Ga0213876_10189041 3300021384 Bacteria 1095
147 Ga0207656_10000748 3300025321 Bacteria 10635
148 Ga0207682_10189169 3300025893 Bacteria 943
149 Ga0207699_10024808 3300025906 Bacteria 3284
150 Ga0207699_10139056 3300025906 Bacteria 1594
151 Ga0207699_10776219 3300025906 Bacteria 704
152 Ga0207645_10456989 3300025907 Bacteria 862
153 Ga0207705_10169648 3300025909 Bacteria 1643
154 Ga0207705_10738712 3300025909 Bacteria 765
155 Ga0207654_10028248 3300025911 Bacteria 3057
156 Ga0207654_10166688 3300025911 Bacteria 1427
157 Ga0207707_10083694 3300025912 Bacteria 2786
158 Ga0207707_10092795 3300025912 Bacteria 2638
159 Ga0207695_10016007 3300025913 Bacteria 8803
160 Ga0207663_10037514 3300025916 Bacteria 2922
161 Ga0207663_10442598 3300025916 Bacteria 1001
162 Ga0207660_10901041 3300025917 Bacteria 722
163 Ga0207662_10027032 3300025918 Bacteria 3312
164 Ga0207662_10218875 3300025918 Bacteria 1239
165 Ga0207652_10074134 3300025921 Bacteria 2963
166 Ga0207646_10343508 3300025922 Bacteria 1348
167 Ga0207681_10454291 3300025923 Bacteria 1043
168 Ga0207694_10138904 3300025924 Bacteria 1953
169 Ga0207694_10459343 3300025924 Bacteria 1064
170 Ga0207659_10613242 3300025926 Bacteria 928
171 Ga0207687_10047407 3300025927 Bacteria 2979
172 Ga0207687_10453224 3300025927 Bacteria 1064
173 Ga0207700_10997598 3300025928 Bacteria 749
174 Ga0207664_10140443 3300025929 Bacteria 2043
175 Ga0207706_10639766 3300025933 Bacteria 911
176 Ga0207686_10000795 3300025934 Bacteria 19381
177 Ga0207686_10023009 3300025934 Bacteria 3594
178 Ga0207709_10024407 3300025935 Bacteria 3452
179 Ga0207709_11303272 3300025935 Unclassified 600
180 Ga0207670_10041169 3300025936 Bacteria 3037
181 Ga0207670_10279625 3300025936 Bacteria 1300
182 Ga0207670_10361936 3300025936 Bacteria 1151
183 Ga0207669_10282765 3300025937 Bacteria 1252
184 Ga0207669_10317711 3300025937 Bacteria 1191
185 Ga0207704_10065825 3300025938 Bacteria 2271
186 Ga0207665_10005065 3300025939 Bacteria 8797
187 Ga0207691_10007647 3300025940 Bacteria 10401
188 Ga0207691_10567061 3300025940 Bacteria 962
189 Ga0207711_10034934 3300025941 Bacteria 4258
190 Ga0207711_10104993 3300025941 Bacteria 2505
191 Ga0207711_10216143 3300025941 Bacteria 1752
192 Ga0207689_10094414 3300025942 Bacteria 2456
193 Ga0207689_10812543 3300025942 Bacteria 789
194 Ga0207661_10131800 3300025944 Bacteria 2142
195 Ga0207667_10058429 3300025949 Bacteria 4045
196 Ga0207667_10128885 3300025949 Bacteria 2606
197 Ga0207667_10273938 3300025949 Bacteria 1725
198 Ga0207667_10987646 3300025949 Bacteria 830
199 Ga0207651_10099715 3300025960 Bacteria 2152
200 Ga0207651_10180092 3300025960 Bacteria 1676
201 Ga0207640_10584677 3300025981 Bacteria 943
202 Ga0207677_10016538 3300026023 Bacteria 4373
203 Ga0207677_10161128 3300026023 Bacteria 1743
204 Ga0207677_10377471 3300026023 Bacteria 1195
205 Ga0207703_10217068 3300026035 Bacteria 1708
206 Ga0207703_10299185 3300026035 Bacteria 1467
207 Ga0207708_10123924 3300026075 Bacteria 2016
208 Ga0207641_10186817 3300026088 Bacteria 1902
209 Ga0207648_10135430 3300026089 Bacteria 2170
210 Ga0207648_10332067 3300026089 Bacteria 1368
211 Ga0207648_10941143 3300026089 Bacteria 808
212 Ga0207676_10185428 3300026095 Bacteria 1826
213 Ga0207674_10762340 3300026116 Bacteria 934
214 Ga0207683_10682295 3300026121 Bacteria 952
215 Ga0207683_10754297 3300026121 Bacteria 903
216 Ga0207698_10004318 3300026142 Bacteria 8650
217 Ga0268266_10138355 3300028379 Bacteria 2183
218 Ga0265325_10315480 3300031241 Bacteria 695
219 Ga0265340_10204189 3300031247 Bacteria 888
220 Ga0265339_10110194 3300031249 Bacteria 1425
221 Ga0265342_10146182 3300031712 Bacteria 1316
222 Ga0307410_11002810 3300031852 Bacteria 720
223 Ga0307412_10286399 3300031911 Bacteria 1296
224 Ga0307409_100085685 3300031995 Bacteria 2562
225 Ga0307416_100098249 3300032002 Bacteria 2539
226 Ga0307416_100624187 3300032002 Bacteria 1160
227 Ga0307416_101001275 3300032002 Bacteria 939
228 Ga0307416_101905951 3300032002 Bacteria 698
229 Ga0307415_100815471 3300032126 Bacteria 853
230 Ga0373928_0014821 3300035084 Bacteria 1581
231 Ga0373934_0001439 3300035086 Bacteria 8711
232 Ga0373934_0208302 3300035086 Bacteria 805
233 Ga0373923_0107615 3300035111 Bacteria 1235
234 Ga0373945_0034587 3300035116 Bacteria 1802
235 Ga0373954_0011566 3300035118 Bacteria 3913
236 Ga0373954_0015289 3300035118 Bacteria 3430
237 Ga0373954_0023378 3300035118 Bacteria 2810
238 Ga0373956_0290354 3300035119 Bacteria 778
239 Ga0373957_0000943 3300035120 Bacteria 7638
240 Ga0373957_0135814 3300035120 Bacteria 1003
241 Ga0373943_0302079 3300035170 Bacteria 909
242 Ga0373946_0035670 3300035171 Bacteria 2014
243 Ga0373955_0000913 3300035172 Bacteria 12711
244 Ga0373955_0259735 3300035172 Bacteria 1043
245 Ga0373924_0020859 3300035410 Bacteria 2550
246 Ga0373924_0077442 3300035410 Bacteria 1410
247 Ga0373931_0227965 3300035691 Bacteria 1124
248 Ga0373935_0017964 3300035692 Bacteria 4298
249 Ga0373935_0084231 3300035692 Bacteria 2071
250 Ga0373927_0156269 3300035695 Bacteria 1494
251 Ga0373933_0067899 3300035724 Bacteria 2164
252 Ga0373933_0069410 3300035724 Bacteria 2142
253 Ga0373933_0132452 3300035724 Bacteria 1568
254 Ga0373947_0262370 3300035725 Bacteria 1145
255 Ga0373937_0003301 3300036401 Bacteria 13542
256 Ga0373937_0171389 3300036401 Bacteria 2036
257 Ga0373937_0264750 3300036401 Bacteria 1621
258 Ga0436365_1465206 3300039437 Bacteria 1699
259 Ga0451798_0604106 3300041458 Bacteria 544
260 Ga0451853_0391126 3300041512 Bacteria 681
261 Ga0439452_117150 3300042010 Bacteria 568
262 Ga0439446_0015767 3300042156 Unclassified 2099
263 Ga0495592_0027621 3300046454 Bacteria 4300
264 Ga0495592_0031538 3300046454 Bacteria 4005
265 Ga0495592_0149180 3300046454 Bacteria 1619
266 Ga0495603_0359103 3300046455 Bacteria 836
267 Ga0495641_0060743 3300046461 Bacteria 1707
268 Ga0495651_0079704 3300046462 Bacteria 2474
269 Ga0495653_0006644 3300046463 Bacteria 9491
270 Ga0495653_0028060 3300046463 Bacteria 4505
271 Ga0495580_0124987 3300046472 Bacteria 1785
272 Ga0495662_0166036 3300046476 Bacteria 1088
273 Ga0495664_0345630 3300046477 Bacteria 896
274 Ga0495608_0009946 3300046511 Bacteria 6640
275 Ga0495608_0373031 3300046511 Bacteria 875
276 Ga0495618_0113039 3300046514 Bacteria 1738
277 Ga0495618_0864711 3300046514 Bacteria 523
278 Ga0495628_0055102 3300046516 Bacteria 3132
279 Ga0495628_0641978 3300046516 Bacteria 754
280 Ga0495630_0020407 3300046517 Bacteria 4885
281 Ga0495630_0150410 3300046517 Bacteria 1771
282 Ga0495652_0040522 3300046529 Bacteria 4026
283 Ga0495652_0608425 3300046529 Bacteria 744
284 Ga0495640_0249639 3300046533 Bacteria 1111
285 Ga0495586_0036526 3300046535 Bacteria 2637
286 Ga0495587_0007056 3300046536 Bacteria 7293
287 Ga0495587_0325908 3300046536 Bacteria 857
288 Ga0495587_0498356 3300046536 Bacteria 673
289 Ga0495598_0353514 3300046537 Bacteria 566
290 Ga0495621_0009748 3300046539 Bacteria 2927
291 Ga0495645_0003047 3300046543 Bacteria 11345
292 Ga0495622_0099014 3300046557 Bacteria 1337
293 Ga0495667_0007458 3300046559 Bacteria 7415
294 Ga0495667_0106387 3300046559 Bacteria 1813
295 Ga0495634_0167253 3300046642 Bacteria 1383
296 Ga0495635_0058990 3300046663 Bacteria 2639
297 Ga0495657_0022301 3300046675 Bacteria 4538
298 Ga0495657_0038045 3300046675 Bacteria 3312
299 Ga0495599_0003247 3300046678 Bacteria 9467
300 Ga0495599_0039851 3300046678 Bacteria 2951
301 Ga0495599_0524460 3300046678 Bacteria 695
302 Ga0495623_0032710 3300046679 Bacteria 3341
303 Ga0495646_0406934 3300046680 Bacteria 707
304 Ga0495658_0086697 3300046683 Bacteria 1848
305 Ga0495613_0129912 3300046689 Bacteria 1804
306 Ga0495613_0957859 3300046689 Unclassified 551
307 Ga0495624_0395077 3300046690 Bacteria 830
308 Ga0495600_0133272 3300046809 Bacteria 1614
309 Ga0495581_0326853 3300047315 Bacteria 896
310 Ga0495604_0556063 3300047317 Bacteria 739
311 Ga0495674_0027318 3300047319 Bacteria 5215
312 Ga0495680_0200021 3300047322 Bacteria 1433
313 Ga0495680_0270263 3300047322 Bacteria 1200
314 Ga0495675_0092380 3300047444 Bacteria 1899
315 Ga0495675_0247924 3300047444 Bacteria 1070
316 Ga0495675_0360626 3300047444 Bacteria 853
317 Ga0495602_0042906 3300048088 Bacteria 4117
318 Ga0496104_0016330 3300048907 Bacteria 6742
319 Ga0496105_0530211 3300048908 Bacteria 921
320 Ga0496109_1172071 3300048912 Bacteria 705
321 Ga0496110_0108277 3300048913 Bacteria 2495
322 Ga0501031_0027831 3300049568 Bacteria 3684
323 Ga0501032_0090517 3300049569 Bacteria 2030
324 Ga0501032_0189922 3300049569 Bacteria 1343
325 Ga0501033_0288353 3300049570 Unclassified 1157
326 Ga0501034_0245725 3300049571 Bacteria 1734
327 Ga0501037_0808796 3300049573 Unclassified 618
328 Ga0501037_0970581 3300049573 Unclassified 554
329 Ga0501038_0133379 3300049574 Bacteria 2036
330 Ga0501038_0945782 3300049574 Unclassified 634
331 Ga0501039_0519674 3300049575 Bacteria 935
332 Ga0501040_0006269 3300049576 Bacteria 7722
333 Ga0501041_0418277 3300049577 Unclassified 850
334 Ga0501046_0032300 3300049580 Bacteria 4238
335 Ga0501047_0194907 3300049581 Bacteria 1888
336 Ga0501047_0233130 3300049581 Bacteria 1693
337 Ga0501068_0001496 3300049584 Bacteria 12438
338 Ga0501070_0185446 3300049586 Bacteria 1711
339 Ga0501071_1043837 3300049587 Unclassified 631
340 Ga0501073_0048877 3300049589 Bacteria 2967
341 Ga0501073_0915833 3300049589 Unclassified 603
342 Ga0501074_0051062 3300049590 Bacteria 2984
343 Ga0501074_0213255 3300049590 Bacteria 1375
344 Ga0501079_0392080 3300049741 Bacteria 1089
345 Ga0501080_0005922 3300049742 Bacteria 10952
346 Ga0501080_0384855 3300049742 Bacteria 1263
347 Ga0501080_1661920 3300049742 Unclassified 539
348 Ga0501081_0199072 3300049743 Bacteria 1452
349 Ga0501083_0013256 3300049744 Bacteria 5763
350 Ga0501083_0021320 3300049744 Bacteria 4502
351 Ga0501035_0028234 3300049822 Bacteria 5122
352 Ga0501044_0007844 3300049823 Bacteria 11737
353 Ga0501044_0869416 3300049823 Bacteria 777
354 Ga0501045_0014606 3300049824 Bacteria 5568
355 nmdc:mga00v17_369042_c1 3300050491 Bacteria 933
356 nmdc:mga0k408_249737_c1 3300050493 Bacteria 1059
357 nmdc:mga08y16_152417_c1 3300050511 Bacteria 2403
358 nmdc:mga0n895_134175_c1 3300050512 Bacteria 2501
359 nmdc:mga0n895_282547_c1 3300050512 Bacteria 1683
360 nmdc:mga0n895_879743_c1 3300050512 Bacteria 882
361 nmdc:mga0rr50_641188_c1 3300050513 Bacteria 906
362 nmdc:mga08x19_1888_c1 3300050514 Bacteria 12828
363 nmdc:mga0sz30_34142_c1 3300050516 Bacteria 2116
364 Ga0495601_0001183 3300053077 Bacteria 14278
365 Ga0495601_0012477 3300053077 Bacteria 5097
366 Ga0495595_0530669 3300053084 Bacteria 600
367 Ga0495619_0398521 3300053085 Bacteria 950
368 Ga0068867_100956853
369 Ga0065712_10014536
370 Ga0065712_10693794
371 Ga0070658_11078145
372 Ga0070676_10415750
373 Ga0070683_100071025
374 Ga0070690_100061645
375 Ga0070670_101326233
376 Ga0068869_100325342
377 Ga0070680_100551933
378 Ga0068868_100159768
379 Ga0068868_100161653
380 Ga0070660_101671763
381 Ga0070689_100063979
382 Ga0070689_100190982
383 Ga0070689_100241480
384 Ga0070687_100485228
385 Ga0070675_100008065
386 Ga0070671_100261822
387 Ga0070674_100016477
388 Ga0070674_100302405
389 Ga0070673_100058547
390 Ga0070673_100138116
391 Ga0070688_100055071
392 Ga0070714_100018969
393 Ga0070714_100788265
394 Ga0070713_100281921
395 Ga0070713_101505528
396 Ga0070701_10356777
397 Ga0070701_10365205
398 Ga0070711_100282577
399 Ga0070705_100231201
400 Ga0070705_100311946
401 Ga0070700_100965682
402 Ga0070694_100615118
403 Ga0070694_100615871
404 Ga0070678_100928689
405 Ga0070681_10128508
406 Ga0070681_10388358
407 Ga0068867_100064592
408 Ga0068867_100368319
409 Ga0068867_100895875
410 Ga0070685_10509643
411 Ga0070707_100749617
412 Ga0070698_100539411
413 Ga0070698_100598482
414 Ga0070699_100159410
415 Ga0070684_101022457
416 Ga0068853_100711097
417 Ga0070672_101036803
418 Ga0070672_101149826
419 Ga0070695_100540393
420 Ga0070696_100154143
421 Ga0070696_100208570
422 Ga0070696_100672263
423 Ga0070693_100004099
424 Ga0070693_100358644
425 Ga0070693_100573941
426 Ga0070665_100950683
427 Ga0070704_100038043
428 Ga0068855_100010345
429 Ga0068855_100101749
430 Ga0068855_101065531
431 Ga0068854_101495201
432 Ga0068856_100270952
433 Ga0070702_100237212
434 Ga0068852_100012792
435 Ga0068859_100234705
436 Ga0068859_101572847
437 Ga0068864_101372563
438 Ga0068864_101543532
439 Ga0068851_10001634
440 Ga0068851_10165083
441 Ga0068863_100298711
442 Ga0068858_100047233
443 Ga0068858_100197926
444 Ga0068860_100639087
445 Ga0068860_101079703
446 Ga0081539_10027454
447 Ga0070717_10449078
448 Ga0075364_10364134
449 Ga0070715_10110312
450 Ga0070712_100510109
451 Ga0075366_10007028
452 Ga0075366_10074343
453 Ga0097621_100007003
454 Ga0097621_100105793
455 Ga0068871_100059325
456 Ga0068871_100196046
457 Ga0075428_100221882
458 Ga0075434_100163069
459 Ga0075434_100639114
460 Ga0075434_101544753
461 Ga0068865_100529328
462 Ga0068865_101270280
463 Ga0068865_101325613
464 Ga0075436_100000976
465 Ga0097620_100234700
466 Ga0097620_101573055
467 Ga0075435_101044489
468 Ga0099794_10199218
469 Ga0105240_10024551
470 Ga0105240_10267528
471 Ga0111539_10039083
472 Ga0105245_10184816
473 Ga0105245_10389325
474 Ga0105245_11743056
475 Ga0105245_11967892
476 Ga0105245_12071622
477 Ga0105247_11102464
478 Ga0105243_10244438
479 Ga0105243_10541028
480 Ga0105241_10018819
481 Ga0105241_10436368
482 Ga0105241_10708299
483 Ga0105242_10002333
484 Ga0105242_10043262
485 Ga0105242_10224033
486 Ga0105242_10493465
487 Ga0105242_10495014
488 Ga0105248_10013501
489 Ga0105248_10149352
490 Ga0105238_10003744
491 Ga0105238_10261562
492 Ga0105238_10508191
493 Ga0105239_11548017
494 Ga0157370_10002820
495 Ga0157369_10110917
496 Ga0157369_11952975
497 Ga0157374_10244038
498 Ga0157378_10312477
499 Ga0157378_10772895
500 Ga0163162_10152099
501 Ga0163162_10230571
502 Ga0163162_10291687
503 Ga0163162_10778351
504 Ga0157372_11072052
505 Ga0157375_10059035
506 Ga0157380_10328765
507 Ga0157380_11694652
508 Ga0157379_10200322
509 Ga0157379_10263622
510 Ga0157376_10097652
511 Ga0157376_10294582
512 Ga0157376_10911298
513 Ga0213876_10189041
514 Ga0207656_10000748
515 Ga0207682_10189169
516 Ga0207699_10024808
517 Ga0207699_10139056
518 Ga0207699_10776219
519 Ga0207645_10456989
520 Ga0207705_10169648
521 Ga0207705_10738712
522 Ga0207654_10028248
523 Ga0207654_10166688
524 Ga0207707_10083694
525 Ga0207707_10092795
526 Ga0207695_10016007
527 Ga0207663_10037514
528 Ga0207663_10442598
529 Ga0207660_10901041
530 Ga0207662_10027032
531 Ga0207662_10218875
532 Ga0207652_10074134
533 Ga0207646_10343508
534 Ga0207681_10454291
535 Ga0207694_10138904
536 Ga0207694_10459343
537 Ga0207659_10613242
538 Ga0207687_10047407
539 Ga0207687_10453224
540 Ga0207700_10997598
541 Ga0207664_10140443
542 Ga0207706_10639766
543 Ga0207686_10000795
544 Ga0207686_10023009
545 Ga0207709_10024407
546 Ga0207709_11303272
547 Ga0207670_10041169
548 Ga0207670_10279625
549 Ga0207670_10361936
550 Ga0207669_10282765
551 Ga0207669_10317711
552 Ga0207704_10065825
553 Ga0207665_10005065
554 Ga0207691_10007647
555 Ga0207691_10567061
556 Ga0207711_10034934
557 Ga0207711_10104993
558 Ga0207711_10216143
559 Ga0207689_10094414
560 Ga0207689_10812543
561 Ga0207661_10131800
562 Ga0207667_10058429
563 Ga0207667_10128885
564 Ga0207667_10273938
565 Ga0207667_10987646
566 Ga0207651_10099715
567 Ga0207651_10180092
568 Ga0207640_10584677
569 Ga0207677_10016538
570 Ga0207677_10161128
571 Ga0207677_10377471
572 Ga0207703_10217068
573 Ga0207703_10299185
574 Ga0207708_10123924
575 Ga0207641_10186817
576 Ga0207648_10135430
577 Ga0207648_10332067
578 Ga0207648_10941143
579 Ga0207676_10185428
580 Ga0207674_10762340
581 Ga0207683_10682295
582 Ga0207683_10754297
583 Ga0207698_10004318
584 Ga0268266_10138355
585 Ga0265325_10315480
586 Ga0265340_10204189
587 Ga0265339_10110194
588 Ga0265342_10146182
589 Ga0307410_11002810
590 Ga0307412_10286399
591 Ga0307409_100085685
592 Ga0307416_100098249
593 Ga0307416_100624187
594 Ga0307416_101001275
595 Ga0307416_101905951
596 Ga0307415_100815471
597 Ga0373928_0014821
598 Ga0373934_0001439
599 Ga0373934_0208302
600 Ga0373923_0107615
601 Ga0373945_0034587
602 Ga0373954_0011566
603 Ga0373954_0015289
604 Ga0373954_0023378
605 Ga0373956_0290354
606 Ga0373957_0000943
607 Ga0373957_0135814
608 Ga0373943_0302079
609 Ga0373946_0035670
610 Ga0373955_0000913
611 Ga0373955_0259735
612 Ga0373924_0020859
613 Ga0373924_0077442
614 Ga0373931_0227965
615 Ga0373935_0017964
616 Ga0373935_0084231
617 Ga0373927_0156269
618 Ga0373933_0067899
619 Ga0373933_0069410
620 Ga0373933_0132452
621 Ga0373947_0262370
622 Ga0373937_0003301
623 Ga0373937_0171389
624 Ga0373937_0264750
625 Ga0436365_1465206
626 Ga0451798_0604106
627 Ga0451853_0391126
628 Ga0439452_117150
629 Ga0439446_0015767
630 Ga0495592_0027621
631 Ga0495592_0031538
632 Ga0495592_0149180
633 Ga0495603_0359103
634 Ga0495641_0060743
635 Ga0495651_0079704
636 Ga0495653_0006644
637 Ga0495653_0028060
638 Ga0495580_0124987
639 Ga0495662_0166036
640 Ga0495664_0345630
641 Ga0495608_0009946
642 Ga0495608_0373031
643 Ga0495618_0113039
644 Ga0495618_0864711
645 Ga0495628_0055102
646 Ga0495628_0641978
647 Ga0495630_0020407
648 Ga0495630_0150410
649 Ga0495652_0040522
650 Ga0495652_0608425
651 Ga0495640_0249639
652 Ga0495586_0036526
653 Ga0495587_0007056
654 Ga0495587_0325908
655 Ga0495587_0498356
656 Ga0495598_0353514
657 Ga0495621_0009748
658 Ga0495645_0003047
659 Ga0495622_0099014
660 Ga0495667_0007458
661 Ga0495667_0106387
662 Ga0495634_0167253
663 Ga0495635_0058990
664 Ga0495657_0022301
665 Ga0495657_0038045
666 Ga0495599_0003247
667 Ga0495599_0039851
668 Ga0495599_0524460
669 Ga0495623_0032710
670 Ga0495646_0406934
671 Ga0495658_0086697
672 Ga0495613_0129912
673 Ga0495613_0957859
674 Ga0495624_0395077
675 Ga0495600_0133272
676 Ga0495581_0326853
677 Ga0495604_0556063
678 Ga0495674_0027318
679 Ga0495680_0200021
680 Ga0495680_0270263
681 Ga0495675_0092380
682 Ga0495675_0247924
683 Ga0495675_0360626
684 Ga0495602_0042906
685 Ga0496104_0016330
686 Ga0496105_0530211
687 Ga0496109_1172071
688 Ga0496110_0108277
689 Ga0501031_0027831
690 Ga0501032_0090517
691 Ga0501032_0189922
692 Ga0501033_0288353
693 Ga0501034_0245725
694 Ga0501037_0808796
695 Ga0501037_0970581
696 Ga0501038_0133379
697 Ga0501038_0945782
698 Ga0501039_0519674
699 Ga0501040_0006269
700 Ga0501041_0418277
701 Ga0501046_0032300
702 Ga0501047_0194907
703 Ga0501047_0233130
704 Ga0501068_0001496
705 Ga0501070_0185446
706 Ga0501071_1043837
707 Ga0501073_0048877
708 Ga0501073_0915833
709 Ga0501074_0051062
710 Ga0501074_0213255
711 Ga0501079_0392080
712 Ga0501080_0005922
713 Ga0501080_0384855
714 Ga0501080_1661920
715 Ga0501081_0199072
716 Ga0501083_0013256
717 Ga0501083_0021320
718 Ga0501035_0028234
719 Ga0501044_0007844
720 Ga0501044_0869416
721 Ga0501045_0014606
722 nmdc:mga00v17_369042_c1
723 nmdc:mga0k408_249737_c1
724 nmdc:mga08y16_152417_c1
725 nmdc:mga0n895_134175_c1
726 nmdc:mga0n895_282547_c1
727 nmdc:mga0n895_879743_c1
728 nmdc:mga0rr50_641188_c1
729 nmdc:mga08x19_1888_c1
730 nmdc:mga0sz30_34142_c1
731 Ga0495601_0001183
732 Ga0495601_0012477
733 Ga0495595_0530669
734 Ga0495619_0398521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

16

136

0.86

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

50

135

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n1l-assembly6.cif.gz_I crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.8536 2 108
7n1l-assembly4.cif.gz_F crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.8517 2 110
7n1l-assembly8.cif.gz_N crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.8377 1 103
7n1l-assembly1.cif.gz_A crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.8377 2 108
3t9y-assembly1.cif.gz_A-2 crystal structure of gnat family acetyltransferase staphylococcus aureus subsp. aureus usa300_tch1516 0.8262 2 118
ID Description Score Start End Superfamily
af_O17731_1_160_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8558 2 101 3.40.630.30
af_C6TD41_15_117_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8515 52 104 3.40.630.30
af_A0A1D6G8A0_124_211_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8268 40 121 3.40.630.30
af_Q8N8A8_6_121_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.816 40 100 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8075 46 101 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7C1TKI4-F1-model_v4 N-acetyltransferase 0.9437 2 111 GO:0016747
AF-A0A4Q4X746-F1-model_v4 FMN-dependent NADH-azoreductase (EC 1.7.1.17) 0.9411 25 110 GO:0010181
GO:0016655
GO:0016747
GO:0051920
AF-A0A1H2ILT5-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9379 2 103 GO:0016747
AF-A0A536W6I8-F1-model_v4 GNAT family N-acetyltransferase 0.9289 1 87 GO:0016747
AF-A0A7R7Y3Q7-F1-model_v4 deleted 0.9202 3 137

Map