F423943

General Info

Members Datasets Scaffolds Average Seq Length
366 188 732 231

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100243196|Ga0070698_1002431962
Length 245
Sequence VPSRYYRAVLLTLPIRDVQPATPRARIVRLDLDGQPFEYDAGQAVLVGTHGSSKRKPYSIAAAPEDARRDRWLELLVGVEADGTPGEHLALDRGAQVDVEGPIGSFTFPAAPEERRFVFIAGGTGIAPLRAMLRHALAIPHRDIGLFYSARTPEDFAFEREFRGLADAGDIELRQTVTRAAETDWTGPRGRLKRDALEELVHDPATLCFVCGPPALVNEIPKILRDLGIPRARIKIEEWGPPAST

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.28
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100243196 3300005471 Bacteria 1733
2 Ga0065712_10109065 3300005290 Unclassified 1862
3 Ga0070676_10012356 3300005328 Bacteria 4657
4 Ga0070676_10208746 3300005328 Bacteria 1284
5 Ga0070670_100039651 3300005331 Bacteria 4050
6 Ga0070670_100756610 3300005331 Bacteria 876
7 Ga0070666_10037004 3300005335 Bacteria 3243
8 Ga0070682_100073564 3300005337 Bacteria 2193
9 Ga0068868_100345589 3300005338 Bacteria 1273
10 Ga0068868_100626297 3300005338 Unclassified 955
11 Ga0070660_100034180 3300005339 Bacteria 3839
12 Ga0070660_100129330 3300005339 Bacteria 2020
13 Ga0070689_100010839 3300005340 Bacteria 6514
14 Ga0070689_100447990 3300005340 Unclassified 1098
15 Ga0070691_10001122 3300005341 Bacteria 11122
16 Ga0070691_10327764 3300005341 Bacteria 844
17 Ga0070687_100195767 3300005343 Bacteria 1221
18 Ga0070668_100262466 3300005347 Bacteria 1437
19 Ga0070669_100274300 3300005353 Bacteria 1349
20 Ga0070669_100293402 3300005353 Bacteria 1306
21 Ga0070675_100331273 3300005354 Bacteria 1347
22 Ga0070675_100446742 3300005354 Bacteria 1159
23 Ga0070671_100031296 3300005355 Bacteria 4394
24 Ga0070674_100005882 3300005356 Bacteria 7131
25 Ga0070674_100060934 3300005356 Bacteria 2632
26 Ga0070674_100067002 3300005356 Bacteria 2524
27 Ga0070674_100211228 3300005356 Bacteria 1504
28 Ga0070674_100308218 3300005356 Bacteria 1265
29 Ga0070673_100056076 3300005364 Bacteria 3107
30 Ga0070673_100136225 3300005364 Bacteria 2067
31 Ga0070673_100316835 3300005364 Bacteria 1377
32 Ga0070688_100011222 3300005365 Bacteria 4975
33 Ga0070688_100069284 3300005365 Bacteria 2252
34 Ga0070659_100079640 3300005366 Bacteria 2615
35 Ga0070659_100116464 3300005366 Bacteria 2160
36 Ga0070659_100577971 3300005366 Bacteria 964
37 Ga0070703_10225461 3300005406 Bacteria 748
38 Ga0070709_10023326 3300005434 Bacteria 3631
39 Ga0070714_101190441 3300005435 Unclassified 743
40 Ga0070701_10010149 3300005438 Bacteria 4153
41 Ga0070701_10382695 3300005438 Bacteria 887
42 Ga0070700_100005681 3300005441 Bacteria 6617
43 Ga0070700_100277952 3300005441 Bacteria 1213
44 Ga0070694_100012467 3300005444 Bacteria 5286
45 Ga0070694_100017426 3300005444 Bacteria 4540
46 Ga0070694_100177313 3300005444 Bacteria 1574
47 Ga0070708_100141131 3300005445 Bacteria 2234
48 Ga0070708_100183398 3300005445 Bacteria 1957
49 Ga0070708_100250757 3300005445 Bacteria 1663
50 Ga0070678_100056692 3300005456 Bacteria 2867
51 Ga0070662_100391983 3300005457 Bacteria 1145
52 Ga0070662_100450735 3300005457 Bacteria 1068
53 Ga0070681_10100509 3300005458 Bacteria 2838
54 Ga0070681_10187729 3300005458 Bacteria 1987
55 Ga0068867_100007661 3300005459 Bacteria 7640
56 Ga0068867_100079858 3300005459 Bacteria 2462
57 Ga0068867_100526684 3300005459 Bacteria 1020
58 Ga0070685_10180306 3300005466 Bacteria 1359
59 Ga0070685_10469174 3300005466 Unclassified 885
60 Ga0070706_100091854 3300005467 Bacteria 2816
61 Ga0070698_100044182 3300005471 Bacteria 4565
62 Ga0070698_100154806 3300005471 Bacteria 2238
63 Ga0070699_100006260 3300005518 Bacteria 10383
64 Ga0070699_100086549 3300005518 Bacteria 2735
65 Ga0070699_100215272 3300005518 Bacteria 1711
66 Ga0070679_100015427 3300005530 Bacteria 7343
67 Ga0070679_100186450 3300005530 Bacteria 2045
68 Ga0070684_100305334 3300005535 Bacteria 1461
69 Ga0070697_100119237 3300005536 Bacteria 2206
70 Ga0070697_100145744 3300005536 Bacteria 1993
71 Ga0068853_100820506 3300005539 Unclassified 891
72 Ga0070672_100166766 3300005543 Bacteria 1830
73 Ga0070672_100244182 3300005543 Unclassified 1511
74 Ga0070672_100266600 3300005543 Bacteria 1445
75 Ga0070695_100017658 3300005545 Bacteria 4329
76 Ga0070696_100013105 3300005546 Bacteria 5562
77 Ga0070696_100774904 3300005546 Bacteria 788
78 Ga0070665_100047582 3300005548 Bacteria 4304
79 Ga0070665_100058605 3300005548 Bacteria 3860
80 Ga0070665_100140024 3300005548 Bacteria 2423
81 Ga0070704_100092687 3300005549 Bacteria 2255
82 Ga0070704_100194987 3300005549 Unclassified 1631
83 Ga0070704_100225766 3300005549 Bacteria 1525
84 Ga0068855_100004263 3300005563 Bacteria 17459
85 Ga0068854_100068721 3300005578 Bacteria 2584
86 Ga0068854_100180919 3300005578 Bacteria 1647
87 Ga0070702_100004269 3300005615 Bacteria 6508
88 Ga0068852_100417472 3300005616 Bacteria 1323
89 Ga0068859_100200726 3300005617 Bacteria 2079
90 Ga0068859_100324700 3300005617 Bacteria 1633
91 Ga0068864_100375006 3300005618 Bacteria 1347
92 Ga0068864_100535054 3300005618 Bacteria 1131
93 Ga0068866_10012156 3300005718 Bacteria 3747
94 Ga0068866_10105739 3300005718 Bacteria 1561
95 Ga0068866_10283001 3300005718 Bacteria 1028
96 Ga0068861_100000721 3300005719 Bacteria 19783
97 Ga0068861_100023173 3300005719 Bacteria 4476
98 Ga0068861_100178640 3300005719 Bacteria 1765
99 Ga0068863_100010645 3300005841 Bacteria 8929
100 Ga0068863_100131286 3300005841 Unclassified 2392
101 Ga0068863_100448511 3300005841 Bacteria 1266
102 Ga0068858_100041353 3300005842 Bacteria 4274
103 Ga0068858_100326183 3300005842 Unclassified 1468
104 Ga0068858_100826742 3300005842 Bacteria 904
105 Ga0068860_100061634 3300005843 Bacteria 3564
106 Ga0068860_100873481 3300005843 Bacteria 915
107 Ga0068862_100228017 3300005844 Bacteria 1689
108 Ga0068862_100467344 3300005844 Unclassified 1192
109 Ga0068862_100493592 3300005844 Bacteria 1161
110 Ga0081539_10003680 3300005985 Bacteria 18367
111 Ga0070716_100566435 3300006173 Bacteria 849
112 Ga0097621_100020639 3300006237 Bacteria 5079
113 Ga0068871_100071629 3300006358 Bacteria 2851
114 Ga0075431_100047414 3300006847 Bacteria 4430
115 Ga0075433_10063146 3300006852 Bacteria 3245
116 Ga0075433_10081147 3300006852 Bacteria 2859
117 Ga0075433_10161887 3300006852 Bacteria 1992
118 Ga0075433_10166443 3300006852 Bacteria 1962
119 Ga0075433_10169766 3300006852 Bacteria 1941
120 Ga0075434_100000523 3300006871 Bacteria 29248
121 Ga0075434_100004821 3300006871 Bacteria 12219
122 Ga0075434_100104226 3300006871 Bacteria 2846
123 Ga0075434_100861749 3300006871 Bacteria 921
124 Ga0075429_100658732 3300006880 Bacteria 917
125 Ga0068865_100094364 3300006881 Bacteria 2177
126 Ga0075436_100004866 3300006914 Bacteria 9229
127 Ga0075436_100045295 3300006914 Bacteria 3034
128 Ga0075436_100096779 3300006914 Bacteria 2053
129 Ga0097620_100200738 3300006931 Bacteria 2079
130 Ga0097620_100324690 3300006931 Bacteria 1633
131 Ga0075435_100001437 3300007076 Bacteria 15311
132 Ga0075435_100002690 3300007076 Bacteria 11867
133 Ga0075435_100021569 3300007076 Bacteria 4957
134 Ga0105251_10100721 3300009011 Unclassified 1320
135 Ga0105240_10009233 3300009093 Bacteria 13990
136 Ga0105240_10461527 3300009093 Bacteria 1419
137 Ga0105240_11101163 3300009093 Unclassified 845
138 Ga0111539_10004085 3300009094 Bacteria 19151
139 Ga0111539_10080282 3300009094 Bacteria 3837
140 Ga0105245_10027390 3300009098 Bacteria 5021
141 Ga0105245_10166360 3300009098 Bacteria 2096
142 Ga0105247_10007172 3300009101 Bacteria 6841
143 Ga0114129_10001577 3300009147 Bacteria 30953
144 Ga0114129_10002983 3300009147 Bacteria 23718
145 Ga0114129_10004637 3300009147 Bacteria 19399
146 Ga0114129_10026994 3300009147 Bacteria 8129
147 Ga0114129_10034634 3300009147 Bacteria 7132
148 Ga0114129_10047655 3300009147 Bacteria 6021
149 Ga0114129_10086533 3300009147 Bacteria 4347
150 Ga0114129_10087655 3300009147 Bacteria 4315
151 Ga0114129_10259494 3300009147 Bacteria 2330
152 Ga0114129_10381810 3300009147 Bacteria 1860
153 Ga0114129_10747903 3300009147 Bacteria 1252
154 Ga0105243_10301287 3300009148 Bacteria 1453
155 Ga0105241_10717216 3300009174 Bacteria 914
156 Ga0105242_10033830 3300009176 Bacteria 4095
157 Ga0105242_10116432 3300009176 Bacteria 2286
158 Ga0105248_10010286 3300009177 Bacteria 10299
159 Ga0105248_10020945 3300009177 Bacteria 7247
160 Ga0105248_10064911 3300009177 Bacteria 4098
161 Ga0105248_10222248 3300009177 Bacteria 2126
162 Ga0105248_10247888 3300009177 Bacteria 2005
163 Ga0105248_10675965 3300009177 Bacteria 1165
164 Ga0105248_10851120 3300009177 Bacteria 1029
165 Ga0105238_10289850 3300009551 Unclassified 1619
166 Ga0105238_10736063 3300009551 Unclassified 999
167 Ga0105249_10099807 3300009553 Bacteria 2729
168 Ga0105249_10311760 3300009553 Bacteria 1582
169 Ga0105249_10919457 3300009553 Bacteria 942
170 Ga0105249_10952361 3300009553 Unclassified 926
171 Ga0157374_10013898 3300013296 Bacteria 7034
172 Ga0157378_10234230 3300013297 Bacteria 1751
173 Ga0163162_10045774 3300013306 Bacteria 4384
174 Ga0157375_10017162 3300013308 Bacteria 6527
175 Ga0157375_10277915 3300013308 Bacteria 1837
176 Ga0157375_10310826 3300013308 Bacteria 1740
177 Ga0163163_10004856 3300014325 Bacteria 11552
178 Ga0163163_10192129 3300014325 Bacteria 2090
179 Ga0157380_10233202 3300014326 Bacteria 1654
180 Ga0157379_10017125 3300014968 Bacteria 6381
181 Ga0157379_10109277 3300014968 Bacteria 2483
182 Ga0157376_10510288 3300014969 Bacteria 1183
183 Ga0157376_10515221 3300014969 Unclassified 1178
184 Ga0163161_10180537 3300017792 Unclassified 1618
185 Ga0163161_10599807 3300017792 Bacteria 908
186 Ga0207642_10147828 3300025899 Bacteria 1247
187 Ga0207710_10007027 3300025900 Bacteria 4783
188 Ga0207688_10067277 3300025901 Bacteria 2027
189 Ga0207680_10010545 3300025903 Bacteria 4627
190 Ga0207680_10014067 3300025903 Bacteria 4128
191 Ga0207680_10047530 3300025903 Bacteria 2543
192 Ga0207645_10001520 3300025907 Bacteria 18951
193 Ga0207643_10228339 3300025908 Bacteria 1141
194 Ga0207684_10243615 3300025910 Bacteria 1551
195 Ga0207695_10035437 3300025913 Bacteria 5411
196 Ga0207695_10391106 3300025913 Bacteria 1275
197 Ga0207657_10005945 3300025919 Bacteria 12701
198 Ga0207657_10061495 3300025919 Bacteria 3219
199 Ga0207646_10268400 3300025922 Bacteria 1542
200 Ga0207681_10071404 3300025923 Bacteria 2421
201 Ga0207681_10234554 3300025923 Bacteria 1425
202 Ga0207681_10320624 3300025923 Bacteria 1232
203 Ga0207694_10663103 3300025924 Bacteria 879
204 Ga0207650_10027672 3300025925 Bacteria 4060
205 Ga0207687_10165074 3300025927 Unclassified 1703
206 Ga0207687_10230260 3300025927 Bacteria 1463
207 Ga0207687_10615466 3300025927 Bacteria 916
208 Ga0207664_10325732 3300025929 Bacteria 1356
209 Ga0207644_10094856 3300025931 Bacteria 2230
210 Ga0207690_10039926 3300025932 Bacteria 3065
211 Ga0207690_10064231 3300025932 Bacteria 2506
212 Ga0207690_10522842 3300025932 Bacteria 962
213 Ga0207706_10096441 3300025933 Bacteria 2600
214 Ga0207706_10321296 3300025933 Bacteria 1347
215 Ga0207706_10623773 3300025933 Bacteria 925
216 Ga0207686_10004353 3300025934 Bacteria 7588
217 Ga0207686_10079410 3300025934 Bacteria 2137
218 Ga0207709_10146478 3300025935 Bacteria 1630
219 Ga0207670_10043743 3300025936 Bacteria 2960
220 Ga0207670_10436305 3300025936 Bacteria 1054
221 Ga0207669_10012297 3300025937 Bacteria 4203
222 Ga0207669_10413964 3300025937 Bacteria 1059
223 Ga0207669_10636237 3300025937 Bacteria 871
224 Ga0207691_10012213 3300025940 Bacteria 8233
225 Ga0207691_10182506 3300025940 Bacteria 1833
226 Ga0207711_10058056 3300025941 Bacteria 3328
227 Ga0207711_10118900 3300025941 Bacteria 2358
228 Ga0207711_10121752 3300025941 Bacteria 2330
229 Ga0207711_10360589 3300025941 Unclassified 1347
230 Ga0207711_10643324 3300025941 Bacteria 989
231 Ga0207689_10168652 3300025942 Bacteria 1804
232 Ga0207689_10193068 3300025942 Bacteria 1680
233 Ga0207661_10357924 3300025944 Unclassified 1318
234 Ga0207679_10839424 3300025945 Bacteria 839
235 Ga0207667_10123685 3300025949 Bacteria 2665
236 Ga0207651_10041719 3300025960 Bacteria 3048
237 Ga0207651_10212960 3300025960 Bacteria 1557
238 Ga0207651_10284632 3300025960 Bacteria 1368
239 Ga0207651_10507015 3300025960 Bacteria 1044
240 Ga0207668_10077573 3300025972 Bacteria 2396
241 Ga0207668_10346766 3300025972 Bacteria 1240
242 Ga0207640_10075948 3300025981 Bacteria 2279
243 Ga0207640_10382038 3300025981 Bacteria 1141
244 Ga0207658_10291681 3300025986 Bacteria 1402
245 Ga0207658_10500065 3300025986 Bacteria 1083
246 Ga0207677_10202462 3300026023 Bacteria 1579
247 Ga0207703_10195640 3300026035 Unclassified 1794
248 Ga0207703_10575454 3300026035 Bacteria 1064
249 Ga0207678_10061263 3300026067 Bacteria 3236
250 Ga0207708_10009060 3300026075 Bacteria 7363
251 Ga0207708_10054226 3300026075 Bacteria 3056
252 Ga0207708_10248170 3300026075 Bacteria 1433
253 Ga0207702_10773281 3300026078 Bacteria 949
254 Ga0207641_10000870 3300026088 Bacteria 31696
255 Ga0207641_10058223 3300026088 Bacteria 3288
256 Ga0207641_10315624 3300026088 Bacteria 1481
257 Ga0207648_10037028 3300026089 Bacteria 4297
258 Ga0207648_10119585 3300026089 Bacteria 2316
259 Ga0207648_10281328 3300026089 Bacteria 1488
260 Ga0207676_10448149 3300026095 Bacteria 1216
261 Ga0207676_10893507 3300026095 Bacteria 871
262 Ga0207674_10011313 3300026116 Bacteria 10029
263 Ga0207674_10092348 3300026116 Bacteria 3017
264 Ga0207675_100000451 3300026118 Bacteria 39879
265 Ga0207675_100083443 3300026118 Bacteria 2997
266 Ga0207675_100147336 3300026118 Bacteria 2239
267 Ga0207683_10142489 3300026121 Bacteria 2160
268 Ga0207683_10246293 3300026121 Unclassified 1630
269 Ga0207698_10265596 3300026142 Bacteria 1579
270 Ga0207428_10043313 3300027907 Bacteria 3636
271 Ga0268266_10507866 3300028379 Bacteria 1151
272 Ga0268266_10548697 3300028379 Unclassified 1107
273 Ga0268266_10752333 3300028379 Unclassified 940
274 Ga0268265_10152376 3300028380 Bacteria 1951
275 Ga0268265_10205589 3300028380 Bacteria 1711
276 Ga0268265_10233137 3300028380 Bacteria 1619
277 Ga0268265_11027165 3300028380 Unclassified 815
278 Ga0268264_10184464 3300028381 Bacteria 1897
279 Ga0268264_10428884 3300028381 Bacteria 1276
280 Ga0265332_10109071 3300031238 Bacteria 1166
281 Ga0307408_100057319 3300031548 Bacteria 2828
282 Ga0373934_0134850 3300035086 Bacteria 1008
283 Ga0373956_0021294 3300035119 Bacteria 2766
284 Ga0373943_0249582 3300035170 Bacteria 996
285 Ga0373946_0071901 3300035171 Bacteria 1496
286 Ga0373946_0110875 3300035171 Unclassified 1242
287 Ga0373955_0213578 3300035172 Unclassified 1151
288 Ga0373924_0158374 3300035410 Unclassified 992
289 Ga0373931_0353694 3300035691 Unclassified 920
290 Ga0373947_0281873 3300035725 Bacteria 1105
291 Ga0373937_0034155 3300036401 Bacteria 4625
292 Ga0373937_0450504 3300036401 Unclassified 1222
293 Ga0373925_0158155 3300037068 Bacteria 1783
294 Ga0450898_066255 3300042134 Bacteria 717
295 Ga0451577_0040582 3300042876 Bacteria 4179
296 Ga0453683_0320178 3300044673 Unclassified 994
297 Ga0466963_0124931 3300044694 Bacteria 1773
298 Ga0451576_0212672 3300045051 Bacteria 2019
299 Ga0451576_0335587 3300045051 Bacteria 1582
300 Ga0495592_0272158 3300046454 Bacteria 1111
301 Ga0495629_0071625 3300046459 Bacteria 2419
302 Ga0495629_0327850 3300046459 Unclassified 1046
303 Ga0495651_0255639 3300046462 Bacteria 1194
304 Ga0495580_0292859 3300046472 Unclassified 1109
305 Ga0495580_0469924 3300046472 Bacteria 842
306 Ga0495664_0082687 3300046477 Bacteria 1926
307 Ga0495628_0013282 3300046516 Bacteria 6927
308 Ga0495645_0006240 3300046543 Bacteria 8258
309 Ga0495635_0115450 3300046663 Bacteria 1833
310 Ga0495647_0073545 3300046681 Bacteria 1373
311 Ga0495669_0256053 3300046684 Bacteria 841
312 Ga0495604_0314368 3300047317 Unclassified 1048
313 Ga0495684_0379260 3300047471 Bacteria 998
314 Ga0495602_0355627 3300048088 Bacteria 1056
315 Ga0495614_0158528 3300048089 Bacteria 1012
316 Ga0496100_0035600 3300048903 Bacteria 3133
317 Ga0496101_0044974 3300048904 Bacteria 3161
318 Ga0496104_0178114 3300048907 Bacteria 2036
319 Ga0496104_0833176 3300048907 Bacteria 828
320 Ga0496108_0002812 3300048911 Bacteria 13963
321 Ga0496108_0636590 3300048911 Bacteria 928
322 Ga0496109_1185064 3300048912 Bacteria 700
323 Ga0496112_0005310 3300048915 Bacteria 11118
324 Ga0496112_0195010 3300048915 Bacteria 1986
325 Ga0496113_0046518 3300048916 Bacteria 3221
326 Ga0496114_0191182 3300048917 Bacteria 1791
327 Ga0496114_0347975 3300048917 Unclassified 1311
328 Ga0501079_0736214 3300049741 Unclassified 776
329 Ga0501081_0276651 3300049743 Bacteria 1228
330 Ga0501083_0225951 3300049744 Bacteria 1219
331 nmdc:mga05p37_109728_c1 3300050507 Bacteria 3394
332 nmdc:mga05p37_1473_c1 3300050507 Bacteria 27340
333 nmdc:mga05p37_17165_c1 3300050507 Bacteria 8733
334 nmdc:mga05p37_17998_c1 3300050507 Bacteria 8532
335 nmdc:mga05p37_39024_c1 3300050507 Bacteria 5826
336 nmdc:mga05p37_42073_c1 3300050507 Bacteria 5612
337 nmdc:mga05p37_446000_c1 3300050507 Bacteria 1499
338 nmdc:mga05p37_45534_c1 3300050507 Bacteria 5395
339 nmdc:mga06r32_44631_c1 3300050510 Bacteria 4221
340 nmdc:mga08y16_224549_c1 3300050511 Bacteria 1944
341 nmdc:mga08y16_543238_c1 3300050511 Bacteria 1177
342 nmdc:mga08y16_5669_c1 3300050511 Bacteria 13082
343 nmdc:mga0n895_117205_c1 3300050512 Bacteria 2682
344 nmdc:mga0n895_187722_c1 3300050512 Bacteria 2098
345 nmdc:mga0n895_23770_c1 3300050512 Bacteria 5766
346 nmdc:mga0n895_487057_c1 3300050512 Bacteria 1243
347 nmdc:mga0n895_58328_c1 3300050512 Bacteria 3806
348 nmdc:mga0n895_77747_c1 3300050512 Bacteria 3302
349 nmdc:mga0rr50_248776_c1 3300050513 Bacteria 1476
350 nmdc:mga0rr50_60328_c1 3300050513 Bacteria 2853
351 nmdc:mga08x19_160844_c1 3300050514 Bacteria 1525
352 nmdc:mga08x19_43485_c1 3300050514 Bacteria 2866
353 nmdc:mga0a205_227875_c1 3300050515 Bacteria 1748
354 nmdc:mga0a205_346363_c1 3300050515 Bacteria 1354
355 nmdc:mga0a205_3534_c1 3300050515 Bacteria 13971
356 nmdc:mga0a205_411109_c1 3300050515 Bacteria 1216
357 nmdc:mga0a205_562541_c1 3300050515 Bacteria 995
358 nmdc:mga0a205_6880_c1 3300050515 Bacteria 10286
359 Ga0495601_0172269 3300053077 Bacteria 1415
360 Ga0495601_0328141 3300053077 Bacteria 996
361 Ga0495595_0026768 3300053084 Bacteria 2564
362 Ga0495595_0112865 3300053084 Bacteria 1319
363 Ga0495619_0057110 3300053085 Bacteria 2589
364 Ga0495619_0105968 3300053085 Bacteria 1917
365 Ga0495619_0125288 3300053085 Bacteria 1763
366 Ga0501084_0062400 3300054114 Bacteria 3120
367 Ga0070698_100243196
368 Ga0065712_10109065
369 Ga0070676_10012356
370 Ga0070676_10208746
371 Ga0070670_100039651
372 Ga0070670_100756610
373 Ga0070666_10037004
374 Ga0070682_100073564
375 Ga0068868_100345589
376 Ga0068868_100626297
377 Ga0070660_100034180
378 Ga0070660_100129330
379 Ga0070689_100010839
380 Ga0070689_100447990
381 Ga0070691_10001122
382 Ga0070691_10327764
383 Ga0070687_100195767
384 Ga0070668_100262466
385 Ga0070669_100274300
386 Ga0070669_100293402
387 Ga0070675_100331273
388 Ga0070675_100446742
389 Ga0070671_100031296
390 Ga0070674_100005882
391 Ga0070674_100060934
392 Ga0070674_100067002
393 Ga0070674_100211228
394 Ga0070674_100308218
395 Ga0070673_100056076
396 Ga0070673_100136225
397 Ga0070673_100316835
398 Ga0070688_100011222
399 Ga0070688_100069284
400 Ga0070659_100079640
401 Ga0070659_100116464
402 Ga0070659_100577971
403 Ga0070703_10225461
404 Ga0070709_10023326
405 Ga0070714_101190441
406 Ga0070701_10010149
407 Ga0070701_10382695
408 Ga0070700_100005681
409 Ga0070700_100277952
410 Ga0070694_100012467
411 Ga0070694_100017426
412 Ga0070694_100177313
413 Ga0070708_100141131
414 Ga0070708_100183398
415 Ga0070708_100250757
416 Ga0070678_100056692
417 Ga0070662_100391983
418 Ga0070662_100450735
419 Ga0070681_10100509
420 Ga0070681_10187729
421 Ga0068867_100007661
422 Ga0068867_100079858
423 Ga0068867_100526684
424 Ga0070685_10180306
425 Ga0070685_10469174
426 Ga0070706_100091854
427 Ga0070698_100044182
428 Ga0070698_100154806
429 Ga0070699_100006260
430 Ga0070699_100086549
431 Ga0070699_100215272
432 Ga0070679_100015427
433 Ga0070679_100186450
434 Ga0070684_100305334
435 Ga0070697_100119237
436 Ga0070697_100145744
437 Ga0068853_100820506
438 Ga0070672_100166766
439 Ga0070672_100244182
440 Ga0070672_100266600
441 Ga0070695_100017658
442 Ga0070696_100013105
443 Ga0070696_100774904
444 Ga0070665_100047582
445 Ga0070665_100058605
446 Ga0070665_100140024
447 Ga0070704_100092687
448 Ga0070704_100194987
449 Ga0070704_100225766
450 Ga0068855_100004263
451 Ga0068854_100068721
452 Ga0068854_100180919
453 Ga0070702_100004269
454 Ga0068852_100417472
455 Ga0068859_100200726
456 Ga0068859_100324700
457 Ga0068864_100375006
458 Ga0068864_100535054
459 Ga0068866_10012156
460 Ga0068866_10105739
461 Ga0068866_10283001
462 Ga0068861_100000721
463 Ga0068861_100023173
464 Ga0068861_100178640
465 Ga0068863_100010645
466 Ga0068863_100131286
467 Ga0068863_100448511
468 Ga0068858_100041353
469 Ga0068858_100326183
470 Ga0068858_100826742
471 Ga0068860_100061634
472 Ga0068860_100873481
473 Ga0068862_100228017
474 Ga0068862_100467344
475 Ga0068862_100493592
476 Ga0081539_10003680
477 Ga0070716_100566435
478 Ga0097621_100020639
479 Ga0068871_100071629
480 Ga0075431_100047414
481 Ga0075433_10063146
482 Ga0075433_10081147
483 Ga0075433_10161887
484 Ga0075433_10166443
485 Ga0075433_10169766
486 Ga0075434_100000523
487 Ga0075434_100004821
488 Ga0075434_100104226
489 Ga0075434_100861749
490 Ga0075429_100658732
491 Ga0068865_100094364
492 Ga0075436_100004866
493 Ga0075436_100045295
494 Ga0075436_100096779
495 Ga0097620_100200738
496 Ga0097620_100324690
497 Ga0075435_100001437
498 Ga0075435_100002690
499 Ga0075435_100021569
500 Ga0105251_10100721
501 Ga0105240_10009233
502 Ga0105240_10461527
503 Ga0105240_11101163
504 Ga0111539_10004085
505 Ga0111539_10080282
506 Ga0105245_10027390
507 Ga0105245_10166360
508 Ga0105247_10007172
509 Ga0114129_10001577
510 Ga0114129_10002983
511 Ga0114129_10004637
512 Ga0114129_10026994
513 Ga0114129_10034634
514 Ga0114129_10047655
515 Ga0114129_10086533
516 Ga0114129_10087655
517 Ga0114129_10259494
518 Ga0114129_10381810
519 Ga0114129_10747903
520 Ga0105243_10301287
521 Ga0105241_10717216
522 Ga0105242_10033830
523 Ga0105242_10116432
524 Ga0105248_10010286
525 Ga0105248_10020945
526 Ga0105248_10064911
527 Ga0105248_10222248
528 Ga0105248_10247888
529 Ga0105248_10675965
530 Ga0105248_10851120
531 Ga0105238_10289850
532 Ga0105238_10736063
533 Ga0105249_10099807
534 Ga0105249_10311760
535 Ga0105249_10919457
536 Ga0105249_10952361
537 Ga0157374_10013898
538 Ga0157378_10234230
539 Ga0163162_10045774
540 Ga0157375_10017162
541 Ga0157375_10277915
542 Ga0157375_10310826
543 Ga0163163_10004856
544 Ga0163163_10192129
545 Ga0157380_10233202
546 Ga0157379_10017125
547 Ga0157379_10109277
548 Ga0157376_10510288
549 Ga0157376_10515221
550 Ga0163161_10180537
551 Ga0163161_10599807
552 Ga0207642_10147828
553 Ga0207710_10007027
554 Ga0207688_10067277
555 Ga0207680_10010545
556 Ga0207680_10014067
557 Ga0207680_10047530
558 Ga0207645_10001520
559 Ga0207643_10228339
560 Ga0207684_10243615
561 Ga0207695_10035437
562 Ga0207695_10391106
563 Ga0207657_10005945
564 Ga0207657_10061495
565 Ga0207646_10268400
566 Ga0207681_10071404
567 Ga0207681_10234554
568 Ga0207681_10320624
569 Ga0207694_10663103
570 Ga0207650_10027672
571 Ga0207687_10165074
572 Ga0207687_10230260
573 Ga0207687_10615466
574 Ga0207664_10325732
575 Ga0207644_10094856
576 Ga0207690_10039926
577 Ga0207690_10064231
578 Ga0207690_10522842
579 Ga0207706_10096441
580 Ga0207706_10321296
581 Ga0207706_10623773
582 Ga0207686_10004353
583 Ga0207686_10079410
584 Ga0207709_10146478
585 Ga0207670_10043743
586 Ga0207670_10436305
587 Ga0207669_10012297
588 Ga0207669_10413964
589 Ga0207669_10636237
590 Ga0207691_10012213
591 Ga0207691_10182506
592 Ga0207711_10058056
593 Ga0207711_10118900
594 Ga0207711_10121752
595 Ga0207711_10360589
596 Ga0207711_10643324
597 Ga0207689_10168652
598 Ga0207689_10193068
599 Ga0207661_10357924
600 Ga0207679_10839424
601 Ga0207667_10123685
602 Ga0207651_10041719
603 Ga0207651_10212960
604 Ga0207651_10284632
605 Ga0207651_10507015
606 Ga0207668_10077573
607 Ga0207668_10346766
608 Ga0207640_10075948
609 Ga0207640_10382038
610 Ga0207658_10291681
611 Ga0207658_10500065
612 Ga0207677_10202462
613 Ga0207703_10195640
614 Ga0207703_10575454
615 Ga0207678_10061263
616 Ga0207708_10009060
617 Ga0207708_10054226
618 Ga0207708_10248170
619 Ga0207702_10773281
620 Ga0207641_10000870
621 Ga0207641_10058223
622 Ga0207641_10315624
623 Ga0207648_10037028
624 Ga0207648_10119585
625 Ga0207648_10281328
626 Ga0207676_10448149
627 Ga0207676_10893507
628 Ga0207674_10011313
629 Ga0207674_10092348
630 Ga0207675_100000451
631 Ga0207675_100083443
632 Ga0207675_100147336
633 Ga0207683_10142489
634 Ga0207683_10246293
635 Ga0207698_10265596
636 Ga0207428_10043313
637 Ga0268266_10507866
638 Ga0268266_10548697
639 Ga0268266_10752333
640 Ga0268265_10152376
641 Ga0268265_10205589
642 Ga0268265_10233137
643 Ga0268265_11027165
644 Ga0268264_10184464
645 Ga0268264_10428884
646 Ga0265332_10109071
647 Ga0307408_100057319
648 Ga0373934_0134850
649 Ga0373956_0021294
650 Ga0373943_0249582
651 Ga0373946_0071901
652 Ga0373946_0110875
653 Ga0373955_0213578
654 Ga0373924_0158374
655 Ga0373931_0353694
656 Ga0373947_0281873
657 Ga0373937_0034155
658 Ga0373937_0450504
659 Ga0373925_0158155
660 Ga0450898_066255
661 Ga0451577_0040582
662 Ga0453683_0320178
663 Ga0466963_0124931
664 Ga0451576_0212672
665 Ga0451576_0335587
666 Ga0495592_0272158
667 Ga0495629_0071625
668 Ga0495629_0327850
669 Ga0495651_0255639
670 Ga0495580_0292859
671 Ga0495580_0469924
672 Ga0495664_0082687
673 Ga0495628_0013282
674 Ga0495645_0006240
675 Ga0495635_0115450
676 Ga0495647_0073545
677 Ga0495669_0256053
678 Ga0495604_0314368
679 Ga0495684_0379260
680 Ga0495602_0355627
681 Ga0495614_0158528
682 Ga0496100_0035600
683 Ga0496101_0044974
684 Ga0496104_0178114
685 Ga0496104_0833176
686 Ga0496108_0002812
687 Ga0496108_0636590
688 Ga0496109_1185064
689 Ga0496112_0005310
690 Ga0496112_0195010
691 Ga0496113_0046518
692 Ga0496114_0191182
693 Ga0496114_0347975
694 Ga0501079_0736214
695 Ga0501081_0276651
696 Ga0501083_0225951
697 nmdc:mga05p37_109728_c1
698 nmdc:mga05p37_1473_c1
699 nmdc:mga05p37_17165_c1
700 nmdc:mga05p37_17998_c1
701 nmdc:mga05p37_39024_c1
702 nmdc:mga05p37_42073_c1
703 nmdc:mga05p37_446000_c1
704 nmdc:mga05p37_45534_c1
705 nmdc:mga06r32_44631_c1
706 nmdc:mga08y16_224549_c1
707 nmdc:mga08y16_543238_c1
708 nmdc:mga08y16_5669_c1
709 nmdc:mga0n895_117205_c1
710 nmdc:mga0n895_187722_c1
711 nmdc:mga0n895_23770_c1
712 nmdc:mga0n895_487057_c1
713 nmdc:mga0n895_58328_c1
714 nmdc:mga0n895_77747_c1
715 nmdc:mga0rr50_248776_c1
716 nmdc:mga0rr50_60328_c1
717 nmdc:mga08x19_160844_c1
718 nmdc:mga08x19_43485_c1
719 nmdc:mga0a205_227875_c1
720 nmdc:mga0a205_346363_c1
721 nmdc:mga0a205_3534_c1
722 nmdc:mga0a205_411109_c1
723 nmdc:mga0a205_562541_c1
724 nmdc:mga0a205_6880_c1
725 Ga0495601_0172269
726 Ga0495601_0328141
727 Ga0495595_0026768
728 Ga0495595_0112865
729 Ga0495619_0057110
730 Ga0495619_0105968
731 Ga0495619_0125288
732 Ga0501084_0062400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00175

NAD_binding_1

Oxidoreductase NAD-binding domain

119

222

0.91

PF00970

FAD_binding_6

Oxidoreductase FAD-binding domain

13

108

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c3a-assembly3.cif.gz_C ferredoxin reductase in carbazole 1,9a-dioxygenase 0.8401 1 219
6mv1-assembly1.cif.gz_A 2.15a resolution structure of the cs-b5r domains of human ncb5or (nad+ form) 0.8287 2 219
7c3a-assembly2.cif.gz_B ferredoxin reductase in carbazole 1,9a-dioxygenase 0.8285 1 219
5ogx-assembly1.cif.gz_A crystal structure of amycolatopsis cytochrome p450 reductase gcob. 0.826 1 219
1krh-assembly2.cif.gz_B x-ray structure of benzoate dioxygenase reductase 0.826 1 219
ID Description Score Start End Superfamily
af_Q3TDX8_385_526_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9206 96 218 3.40.50.80
af_Q502I6_386_525_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9139 95 218 3.40.50.80
af_A3KP77_129_270_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8985 98 221 3.40.50.80
1cnfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.889 96 216 3.40.50.80
af_A4IB12_998_1133_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8851 90 212 3.40.50.80
ID Description Score Start End GO Terms
AF-A0A2V8EK59-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9865 1 221 GO:0016491
AF-A0A2V8EK59-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9821 1 221 GO:0016491
AF-A0A7W1TSM9-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9726 1 219 GO:0016491
GO:0051537
AF-A0A7W1TSM9-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9596 1 219 GO:0016491
GO:0051537
AF-A0A143PIG4-F1-model_v4 Naphthalene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component (EC 1.18.1.3) 0.9498 1 221 GO:0008860
GO:0051213
GO:0051537

Map