F423742

General Info

Members Datasets Scaffolds Average Seq Length
365 147 730 273

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0125541|Ga0373935_0125541_132_1118
Length 328
Sequence MLYQRGWPGNVPRQRASRRDAIAAQFLARIMTGCGNEPTATLDSRHNLAMGGKERILTCAGAAILTLGTALAWQLPWREYPGQDNIEIPPDYQEKTEWVFARLMYPPYMGSMNGRGFRGFYGGDWKHGRSSWTTDYTSADRHVAVALRRLTRVHVRSVEQPVDLDDGPDAFNYPWLYAVEVGHWQLTDFQVKQMREFLERGGFFMCDDFHGIQEWEVFLASMKRVFPDRPIVDIPDSDPIFHVIYDLDHRYQVPGAQYLRSGRTYEQDGYEARWRGIYDEHGRLMVAICHNMDLGDAWEWADYPRYDEKFAALAFRIVSNYVVYAMTH

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 30.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0125541 3300035692 Bacteria 1719
2 Ga0070658_10021390 3300005327 Bacteria 5185
3 Ga0070658_10079888 3300005327 Bacteria 2686
4 Ga0070658_10115814 3300005327 Bacteria 2223
5 Ga0070658_10164230 3300005327 Bacteria 1864
6 Ga0070683_100000024 3300005329 Bacteria 173376
7 Ga0070683_100000694 3300005329 Bacteria 24453
8 Ga0070683_100020826 3300005329 Bacteria 5842
9 Ga0068869_100007394 3300005334 Bacteria 7015
10 Ga0070666_10163684 3300005335 Unclassified 1555
11 Ga0070680_100029385 3300005336 Bacteria 4415
12 Ga0068868_100011205 3300005338 Bacteria 6529
13 Ga0068868_100449500 3300005338 Unclassified 1121
14 Ga0070660_100029822 3300005339 Unclassified 4090
15 Ga0070660_100096647 3300005339 Bacteria 2336
16 Ga0070660_100235223 3300005339 Bacteria 1491
17 Ga0070689_100136182 3300005340 Bacteria 1972
18 Ga0070691_10002238 3300005341 Bacteria 8557
19 Ga0070671_100204161 3300005355 Bacteria 1676
20 Ga0070667_100113252 3300005367 Unclassified 2354
21 Ga0070709_10127216 3300005434 Unclassified 1735
22 Ga0070714_100036860 3300005435 Bacteria 4105
23 Ga0070713_100011942 3300005436 Bacteria 6352
24 Ga0070713_100130179 3300005436 Bacteria 2218
25 Ga0070711_100120857 3300005439 Bacteria 1937
26 Ga0070711_100530615 3300005439 Unclassified 974
27 Ga0070708_100414619 3300005445 Bacteria 1270
28 Ga0070681_10008370 3300005458 Bacteria 10133
29 Ga0070681_10019747 3300005458 Bacteria 6749
30 Ga0070681_10114020 3300005458 Bacteria 2642
31 Ga0070681_10307887 3300005458 Bacteria 1493
32 Ga0068867_100358301 3300005459 Bacteria 1219
33 Ga0070679_100006154 3300005530 Bacteria 11166
34 Ga0070679_100230159 3300005530 Bacteria 1813
35 Ga0070679_100249702 3300005530 Bacteria 1731
36 Ga0070679_100250994 3300005530 Unclassified 1725
37 Ga0070684_100000023 3300005535 Bacteria 127415
38 Ga0070684_100000633 3300005535 Bacteria 24156
39 Ga0070684_100021761 3300005535 Bacteria 5341
40 Ga0070684_100086918 3300005535 Bacteria 2776
41 Ga0068853_100081150 3300005539 Unclassified 2839
42 Ga0068853_100135618 3300005539 Unclassified 2206
43 Ga0068853_100172597 3300005539 Bacteria 1957
44 Ga0068853_100466681 3300005539 Unclassified 1189
45 Ga0070665_100073030 3300005548 Bacteria 3438
46 Ga0070665_100533912 3300005548 Bacteria 1185
47 Ga0068855_100007964 3300005563 Bacteria 12802
48 Ga0068855_100011483 3300005563 Bacteria 10704
49 Ga0068855_100015260 3300005563 Bacteria 9247
50 Ga0068855_100103574 3300005563 Unclassified 3274
51 Ga0068855_100156583 3300005563 Bacteria 2588
52 Ga0068855_100168523 3300005563 Bacteria 2481
53 Ga0070664_100136881 3300005564 Unclassified 2154
54 Ga0070664_100470775 3300005564 Unclassified 1155
55 Ga0068857_100000701 3300005577 Bacteria 24896
56 Ga0068857_100015252 3300005577 Bacteria 6707
57 Ga0068857_100038532 3300005577 Bacteria 4233
58 Ga0068857_100138133 3300005577 Unclassified 2202
59 Ga0068856_100017233 3300005614 Bacteria 7001
60 Ga0068856_100017433 3300005614 Bacteria 6959
61 Ga0068856_100045585 3300005614 Unclassified 4318
62 Ga0068856_100097322 3300005614 Unclassified 2932
63 Ga0068856_100397076 3300005614 Bacteria 1399
64 Ga0068852_100034857 3300005616 Unclassified 4192
65 Ga0068852_100226557 3300005616 Bacteria 1780
66 Ga0068852_100243473 3300005616 Bacteria 1720
67 Ga0068859_100076458 3300005617 Unclassified 3389
68 Ga0068859_100145256 3300005617 Unclassified 2447
69 Ga0068859_100329566 3300005617 Unclassified 1621
70 Ga0068864_100045545 3300005618 Bacteria 3763
71 Ga0068863_100024186 3300005841 Bacteria 5794
72 Ga0068863_100355581 3300005841 Unclassified 1427
73 Ga0068863_100360216 3300005841 Unclassified 1418
74 Ga0068858_100002905 3300005842 Bacteria 17241
75 Ga0068858_100035210 3300005842 Bacteria 4643
76 Ga0068858_100170838 3300005842 Unclassified 2050
77 Ga0068858_100282122 3300005842 Unclassified 1582
78 Ga0068858_100507193 3300005842 Bacteria 1166
79 Ga0068858_100646296 3300005842 Bacteria 1028
80 Ga0070717_10049318 3300006028 Bacteria 3456
81 Ga0070717_10137954 3300006028 Bacteria 2102
82 Ga0097621_100050733 3300006237 Bacteria 3375
83 Ga0097621_100402960 3300006237 Unclassified 1225
84 Ga0068871_100108613 3300006358 Bacteria 2332
85 Ga0068871_100387177 3300006358 Unclassified 1243
86 Ga0075430_100002855 3300006846 Bacteria 14465
87 Ga0075431_100003198 3300006847 Bacteria 15840
88 Ga0097620_100076459 3300006931 Unclassified 3389
89 Ga0097620_100145258 3300006931 Unclassified 2447
90 Ga0097620_100329568 3300006931 Unclassified 1621
91 Ga0105240_10000349 3300009093 Bacteria 86505
92 Ga0105240_10003715 3300009093 Bacteria 23583
93 Ga0105240_10004951 3300009093 Bacteria 20031
94 Ga0105240_10011224 3300009093 Bacteria 12495
95 Ga0105240_10093342 3300009093 Unclassified 3673
96 Ga0105240_10117154 3300009093 Bacteria 3212
97 Ga0105240_10208943 3300009093 Bacteria 2282
98 Ga0105240_10483377 3300009093 Unclassified 1380
99 Ga0105245_10004266 3300009098 Bacteria 12673
100 Ga0105245_10005194 3300009098 Bacteria 11432
101 Ga0105245_10017514 3300009098 Bacteria 6252
102 Ga0105245_10040066 3300009098 Bacteria 4171
103 Ga0105245_10168812 3300009098 Unclassified 2082
104 Ga0105245_10445142 3300009098 Unclassified 1303
105 Ga0105245_10672567 3300009098 Bacteria 1067
106 Ga0105245_10989318 3300009098 Unclassified 885
107 Ga0114129_10078929 3300009147 Unclassified 4578
108 Ga0105243_10018725 3300009148 Bacteria 5245
109 Ga0105243_10315875 3300009148 Unclassified 1422
110 Ga0105241_10003609 3300009174 Bacteria 11505
111 Ga0105241_10007344 3300009174 Bacteria 8104
112 Ga0105241_10008251 3300009174 Bacteria 7673
113 Ga0105241_10021622 3300009174 Bacteria 4758
114 Ga0105241_10048728 3300009174 Unclassified 3225
115 Ga0105241_10528261 3300009174 Unclassified 1056
116 Ga0105242_10008408 3300009176 Bacteria 7934
117 Ga0105242_10022625 3300009176 Unclassified 4947
118 Ga0105242_10278922 3300009176 Unclassified 1517
119 Ga0105242_10393987 3300009176 Bacteria 1290
120 Ga0105242_10483599 3300009176 Unclassified 1174
121 Ga0105248_10033969 3300009177 Bacteria 5701
122 Ga0105248_10071826 3300009177 Unclassified 3889
123 Ga0105248_10106079 3300009177 Unclassified 3168
124 Ga0105248_10401904 3300009177 Unclassified 1542
125 Ga0105248_10695811 3300009177 Unclassified 1147
126 Ga0105237_10003116 3300009545 Bacteria 19958
127 Ga0105237_10022142 3300009545 Bacteria 6520
128 Ga0105237_10031683 3300009545 Bacteria 5355
129 Ga0105237_10032833 3300009545 Bacteria 5255
130 Ga0105237_10032934 3300009545 Bacteria 5248
131 Ga0105237_10033896 3300009545 Bacteria 5173
132 Ga0105238_10028382 3300009551 Bacteria 5703
133 Ga0105238_10040363 3300009551 Bacteria 4729
134 Ga0105238_10060783 3300009551 Bacteria 3782
135 Ga0105238_10112020 3300009551 Bacteria 2708
136 Ga0105238_10130523 3300009551 Unclassified 2491
137 Ga0105238_10491307 3300009551 Bacteria 1227
138 Ga0105238_10594134 3300009551 Bacteria 1114
139 Ga0105238_10678111 3300009551 Bacteria 1042
140 Ga0105249_10042470 3300009553 Unclassified 4135
141 Ga0105239_10004575 3300010375 Bacteria 16482
142 Ga0105239_10012002 3300010375 Bacteria 9661
143 Ga0105239_10013052 3300010375 Bacteria 9234
144 Ga0105239_10068642 3300010375 Bacteria 3896
145 Ga0105239_10086397 3300010375 Bacteria 3457
146 Ga0105239_10139347 3300010375 Bacteria 2702
147 Ga0105239_10186049 3300010375 Bacteria 2324
148 Ga0105239_10256320 3300010375 Unclassified 1965
149 Ga0157371_10041521 3300013102 Unclassified 3281
150 Ga0157370_10001930 3300013104 Bacteria 25516
151 Ga0157370_10004518 3300013104 Bacteria 15945
152 Ga0157370_10011874 3300013104 Bacteria 9085
153 Ga0157369_10003687 3300013105 Bacteria 18200
154 Ga0157369_10015530 3300013105 Bacteria 8581
155 Ga0157369_10021732 3300013105 Bacteria 7176
156 Ga0157369_10075526 3300013105 Bacteria 3613
157 Ga0157369_10131160 3300013105 Unclassified 2656
158 Ga0157369_10536573 3300013105 Unclassified 1210
159 Ga0157374_10017770 3300013296 Bacteria 6266
160 Ga0157374_10030369 3300013296 Unclassified 4906
161 Ga0157374_10072756 3300013296 Unclassified 3244
162 Ga0157374_10108989 3300013296 Bacteria 2662
163 Ga0157374_10147951 3300013296 Bacteria 2282
164 Ga0157378_10053050 3300013297 Bacteria 3609
165 Ga0157378_10355490 3300013297 Unclassified 1432
166 Ga0163162_10002654 3300013306 Bacteria 16954
167 Ga0163162_10003665 3300013306 Bacteria 14738
168 Ga0163162_10348252 3300013306 Bacteria 1614
169 Ga0163162_10652686 3300013306 Unclassified 1176
170 Ga0157372_10039565 3300013307 Bacteria 5204
171 Ga0157372_10106819 3300013307 Bacteria 3202
172 Ga0157372_10495591 3300013307 Bacteria 1424
173 Ga0157375_10001273 3300013308 Bacteria 21807
174 Ga0157375_10006963 3300013308 Bacteria 9873
175 Ga0157375_10034427 3300013308 Bacteria 4826
176 Ga0157375_10098730 3300013308 Unclassified 2998
177 Ga0163163_10001269 3300014325 Bacteria 21312
178 Ga0163163_10067114 3300014325 Bacteria 3565
179 Ga0163163_10073930 3300014325 Unclassified 3399
180 Ga0163163_10226783 3300014325 Bacteria 1917
181 Ga0163163_10258097 3300014325 Unclassified 1794
182 Ga0163163_10373704 3300014325 Bacteria 1483
183 Ga0157379_10385623 3300014968 Unclassified 1286
184 Ga0157376_10245261 3300014969 Unclassified 1671
185 Ga0157376_10333470 3300014969 Bacteria 1446
186 Ga0213873_10056978 3300021358 Unclassified 1048
187 Ga0213875_10010062 3300021388 Bacteria 4754
188 Ga0207680_10042642 3300025903 Bacteria 2656
189 Ga0207680_10201022 3300025903 Unclassified 1358
190 Ga0207645_10460964 3300025907 Unclassified 858
191 Ga0207705_10042469 3300025909 Bacteria 3264
192 Ga0207654_10008304 3300025911 Bacteria 5246
193 Ga0207654_10008514 3300025911 Bacteria 5191
194 Ga0207654_10083036 3300025911 Bacteria 1933
195 Ga0207654_10128071 3300025911 Bacteria 1603
196 Ga0207654_10162868 3300025911 Unclassified 1442
197 Ga0207707_10006458 3300025912 Bacteria 10238
198 Ga0207707_10023149 3300025912 Bacteria 5435
199 Ga0207707_10038771 3300025912 Bacteria 4164
200 Ga0207707_10103113 3300025912 Bacteria 2494
201 Ga0207695_10002383 3300025913 Bacteria 27875
202 Ga0207695_10003035 3300025913 Bacteria 24083
203 Ga0207695_10003175 3300025913 Bacteria 23422
204 Ga0207695_10005373 3300025913 Bacteria 17032
205 Ga0207695_10013509 3300025913 Bacteria 9733
206 Ga0207695_10020230 3300025913 Bacteria 7629
207 Ga0207695_10070953 3300025913 Unclassified 3559
208 Ga0207695_10220029 3300025913 Unclassified 1806
209 Ga0207671_10015936 3300025914 Bacteria 5860
210 Ga0207671_10017299 3300025914 Bacteria 5562
211 Ga0207671_10025693 3300025914 Unclassified 4421
212 Ga0207671_10028228 3300025914 Bacteria 4194
213 Ga0207671_10032400 3300025914 Bacteria 3891
214 Ga0207671_10039595 3300025914 Bacteria 3490
215 Ga0207660_10022344 3300025917 Unclassified 4261
216 Ga0207660_10453649 3300025917 Unclassified 1037
217 Ga0207657_10002011 3300025919 Bacteria 21986
218 Ga0207657_10059539 3300025919 Unclassified 3281
219 Ga0207652_10003776 3300025921 Bacteria 12402
220 Ga0207652_10060652 3300025921 Unclassified 3264
221 Ga0207652_10219176 3300025921 Bacteria 1714
222 Ga0207652_10412364 3300025921 Unclassified 1218
223 Ga0207694_10000927 3300025924 Bacteria 25984
224 Ga0207694_10010303 3300025924 Bacteria 7047
225 Ga0207694_10019940 3300025924 Bacteria 5073
226 Ga0207694_10179574 3300025924 Bacteria 1716
227 Ga0207694_10218286 3300025924 Bacteria 1555
228 Ga0207694_10311988 3300025924 Unclassified 1297
229 Ga0207687_10001714 3300025927 Bacteria 15117
230 Ga0207687_10010641 3300025927 Bacteria 6010
231 Ga0207687_10126131 3300025927 Unclassified 1922
232 Ga0207687_10192725 3300025927 Unclassified 1587
233 Ga0207687_10295352 3300025927 Unclassified 1303
234 Ga0207700_10106623 3300025928 Bacteria 2247
235 Ga0207700_10197043 3300025928 Bacteria 1695
236 Ga0207644_10080578 3300025931 Bacteria 2405
237 Ga0207644_10117580 3300025931 Bacteria 2019
238 Ga0207686_10007096 3300025934 Bacteria 6030
239 Ga0207686_10057463 3300025934 Bacteria 2449
240 Ga0207686_10158306 3300025934 Unclassified 1585
241 Ga0207686_10204982 3300025934 Bacteria 1414
242 Ga0207709_10189264 3300025935 Unclassified 1460
243 Ga0207670_10325999 3300025936 Bacteria 1209
244 Ga0207711_10009407 3300025941 Bacteria 8160
245 Ga0207711_10109711 3300025941 Bacteria 2453
246 Ga0207711_10584522 3300025941 Unclassified 1042
247 Ga0207711_10747870 3300025941 Bacteria 911
248 Ga0207689_10162925 3300025942 Bacteria 1837
249 Ga0207661_10000038 3300025944 Bacteria 136281
250 Ga0207661_10017436 3300025944 Bacteria 5315
251 Ga0207679_10326135 3300025945 Unclassified 1331
252 Ga0207667_10001452 3300025949 Bacteria 29739
253 Ga0207667_10007170 3300025949 Bacteria 13451
254 Ga0207667_10069297 3300025949 Bacteria 3671
255 Ga0207667_10087566 3300025949 Bacteria 3221
256 Ga0207667_10298390 3300025949 Unclassified 1646
257 Ga0207712_10045792 3300025961 Bacteria 3030
258 Ga0207677_10009668 3300026023 Bacteria 5431
259 Ga0207677_10058903 3300026023 Bacteria 2647
260 Ga0207677_10159634 3300026023 Unclassified 1750
261 Ga0207677_10354930 3300026023 Unclassified 1230
262 Ga0207703_10007894 3300026035 Bacteria 8415
263 Ga0207703_10029510 3300026035 Unclassified 4329
264 Ga0207703_10516833 3300026035 Bacteria 1122
265 Ga0207703_10607144 3300026035 Unclassified 1035
266 Ga0207639_10255622 3300026041 Unclassified 1530
267 Ga0207702_10012914 3300026078 Bacteria 6946
268 Ga0207702_10013881 3300026078 Bacteria 6691
269 Ga0207702_10025358 3300026078 Bacteria 4920
270 Ga0207702_10058275 3300026078 Bacteria 3286
271 Ga0207702_10097348 3300026078 Unclassified 2589
272 Ga0207641_10013228 3300026088 Bacteria 6766
273 Ga0207648_10032367 3300026089 Bacteria 4617
274 Ga0207676_10087607 3300026095 Unclassified 2547
275 Ga0207676_10113867 3300026095 Bacteria 2268
276 Ga0207674_10002236 3300026116 Bacteria 24504
277 Ga0207674_10013150 3300026116 Bacteria 9211
278 Ga0207674_10089201 3300026116 Bacteria 3076
279 Ga0207683_10357224 3300026121 Unclassified 1342
280 Ga0207698_10023855 3300026142 Unclassified 4282
281 Ga0268266_10421809 3300028379 Unclassified 1264
282 Ga0265338_10207923 3300028800 Bacteria 1471
283 Ga0265331_10067503 3300031250 Bacteria 1678
284 Ga0265314_10038260 3300031711 Bacteria 3468
285 Ga0265314_10111479 3300031711 Bacteria 1738
286 Ga0373926_0011326 3300035083 Bacteria 3000
287 Ga0373926_0056234 3300035083 Archaea 1427
288 Ga0373934_0001144 3300035086 Bacteria 9655
289 Ga0373945_0019355 3300035116 Archaea 2324
290 Ga0373945_0075679 3300035116 Unclassified 1282
291 Ga0373954_0019688 3300035118 Bacteria 3046
292 Ga0373943_0018877 3300035170 Bacteria 3170
293 Ga0373946_0011928 3300035171 Unclassified 3248
294 Ga0373931_0102951 3300035691 Bacteria 1609
295 Ga0373927_0000194 3300035695 Bacteria 48820
296 Ga0373927_0001095 3300035695 Bacteria 20613
297 Ga0373927_0228855 3300035695 Bacteria 1222
298 Ga0373933_0047855 3300035724 Bacteria 2545
299 Ga0373933_0072422 3300035724 Bacteria 2099
300 Ga0373933_0178189 3300035724 Bacteria 1355
301 Ga0373947_0003398 3300035725 Bacteria 9418
302 Ga0373947_0027196 3300035725 Unclassified 3347
303 Ga0373947_0048303 3300035725 Archaea 2553
304 Ga0373937_0017300 3300036401 Bacteria 6420
305 Ga0373937_0026097 3300036401 Bacteria 5279
306 Ga0373937_0095918 3300036401 Bacteria 2750
307 Ga0373937_0154844 3300036401 Bacteria 2148
308 Ga0373937_0224520 3300036401 Unclassified 1768
309 Ga0373937_0425123 3300036401 Bacteria 1261
310 Ga0373937_0478640 3300036401 Bacteria 1183
311 Ga0373925_0000669 3300037068 Bacteria 32216
312 Ga0373925_0000698 3300037068 Bacteria 31435
313 Ga0373925_0025072 3300037068 Unclassified 4355
314 Ga0373925_0472049 3300037068 Unclassified 1029
315 Ga0395898_0221194 3300037466 Bacteria 1806
316 Ga0436364_0076825 3300037853 Bacteria 3761
317 Ga0436364_0623660 3300037853 Bacteria 5057
318 Ga0436364_0692685 3300037853 Unclassified 1606
319 Ga0436365_0685921 3300039437 Unclassified 2855
320 Ga0436362_0358059 3300039453 Bacteria 4747
321 Ga0466959_0305647 3300045049 Bacteria 1089
322 Ga0451576_0010589 3300045051 Bacteria 10561
323 Ga0495651_0082620 3300046462 Bacteria 2423
324 Ga0495580_0044024 3300046472 Unclassified 3176
325 Ga0495580_0086401 3300046472 Unclassified 2185
326 Ga0495580_0143895 3300046472 Bacteria 1652
327 Ga0495580_0191539 3300046472 Unclassified 1410
328 Ga0495580_0252547 3300046472 Bacteria 1207
329 Ga0495582_0069825 3300046473 Unclassified 1943
330 Ga0495639_0091230 3300046475 Unclassified 1430
331 Ga0495664_0045952 3300046477 Bacteria 2590
332 Ga0495594_0137087 3300046499 Bacteria 1387
333 Ga0495594_0171621 3300046499 Bacteria 1234
334 Ga0495608_0176092 3300046511 Bacteria 1355
335 Ga0495628_0020819 3300046516 Bacteria 5403
336 Ga0495665_0029269 3300046531 Bacteria 2951
337 Ga0495665_0151104 3300046531 Unclassified 1212
338 Ga0495640_0080579 3300046533 Bacteria 2165
339 Ga0495640_0167880 3300046533 Unclassified 1403
340 Ga0495587_0054609 3300046536 Bacteria 2354
341 Ga0495587_0064993 3300046536 Bacteria 2131
342 Ga0495645_0019209 3300046543 Bacteria 4920
343 Ga0495634_0014927 3300046642 Bacteria 5585
344 Ga0495635_0060277 3300046663 Bacteria 2608
345 Ga0495635_0233320 3300046663 Unclassified 1243
346 Ga0495657_0071048 3300046675 Bacteria 2274
347 Ga0495599_0006291 3300046678 Bacteria 7155
348 Ga0495599_0011805 3300046678 Bacteria 5371
349 Ga0495623_0074895 3300046679 Unclassified 2103
350 Ga0495646_0036746 3300046680 Bacteria 3033
351 Ga0495613_0053041 3300046689 Bacteria 2985
352 Ga0495624_0056557 3300046690 Archaea 2468
353 Ga0495600_0086368 3300046809 Bacteria 2047
354 Ga0495604_0094860 3300047317 Unclassified 2205
355 Ga0495674_0260239 3300047319 Unclassified 1426
356 Ga0495674_0271121 3300047319 Bacteria 1392
357 Ga0495680_0044916 3300047322 Bacteria 3491
358 Ga0495675_0069326 3300047444 Bacteria 2227
359 Ga0495684_0005955 3300047471 Bacteria 9473
360 Ga0495684_0011073 3300047471 Bacteria 6972
361 Ga0495684_0043664 3300047471 Bacteria 3432
362 Ga0495602_0004231 3300048088 Bacteria 14936
363 Ga0501073_0098765 3300049589 Bacteria 2027
364 nmdc:mga0qj67_27001_c1 3300050509 Bacteria 4447
365 nmdc:mga06r32_13464_c1 3300050510 Bacteria 7410
366 Ga0373935_0125541
367 Ga0070658_10021390
368 Ga0070658_10079888
369 Ga0070658_10115814
370 Ga0070658_10164230
371 Ga0070683_100000024
372 Ga0070683_100000694
373 Ga0070683_100020826
374 Ga0068869_100007394
375 Ga0070666_10163684
376 Ga0070680_100029385
377 Ga0068868_100011205
378 Ga0068868_100449500
379 Ga0070660_100029822
380 Ga0070660_100096647
381 Ga0070660_100235223
382 Ga0070689_100136182
383 Ga0070691_10002238
384 Ga0070671_100204161
385 Ga0070667_100113252
386 Ga0070709_10127216
387 Ga0070714_100036860
388 Ga0070713_100011942
389 Ga0070713_100130179
390 Ga0070711_100120857
391 Ga0070711_100530615
392 Ga0070708_100414619
393 Ga0070681_10008370
394 Ga0070681_10019747
395 Ga0070681_10114020
396 Ga0070681_10307887
397 Ga0068867_100358301
398 Ga0070679_100006154
399 Ga0070679_100230159
400 Ga0070679_100249702
401 Ga0070679_100250994
402 Ga0070684_100000023
403 Ga0070684_100000633
404 Ga0070684_100021761
405 Ga0070684_100086918
406 Ga0068853_100081150
407 Ga0068853_100135618
408 Ga0068853_100172597
409 Ga0068853_100466681
410 Ga0070665_100073030
411 Ga0070665_100533912
412 Ga0068855_100007964
413 Ga0068855_100011483
414 Ga0068855_100015260
415 Ga0068855_100103574
416 Ga0068855_100156583
417 Ga0068855_100168523
418 Ga0070664_100136881
419 Ga0070664_100470775
420 Ga0068857_100000701
421 Ga0068857_100015252
422 Ga0068857_100038532
423 Ga0068857_100138133
424 Ga0068856_100017233
425 Ga0068856_100017433
426 Ga0068856_100045585
427 Ga0068856_100097322
428 Ga0068856_100397076
429 Ga0068852_100034857
430 Ga0068852_100226557
431 Ga0068852_100243473
432 Ga0068859_100076458
433 Ga0068859_100145256
434 Ga0068859_100329566
435 Ga0068864_100045545
436 Ga0068863_100024186
437 Ga0068863_100355581
438 Ga0068863_100360216
439 Ga0068858_100002905
440 Ga0068858_100035210
441 Ga0068858_100170838
442 Ga0068858_100282122
443 Ga0068858_100507193
444 Ga0068858_100646296
445 Ga0070717_10049318
446 Ga0070717_10137954
447 Ga0097621_100050733
448 Ga0097621_100402960
449 Ga0068871_100108613
450 Ga0068871_100387177
451 Ga0075430_100002855
452 Ga0075431_100003198
453 Ga0097620_100076459
454 Ga0097620_100145258
455 Ga0097620_100329568
456 Ga0105240_10000349
457 Ga0105240_10003715
458 Ga0105240_10004951
459 Ga0105240_10011224
460 Ga0105240_10093342
461 Ga0105240_10117154
462 Ga0105240_10208943
463 Ga0105240_10483377
464 Ga0105245_10004266
465 Ga0105245_10005194
466 Ga0105245_10017514
467 Ga0105245_10040066
468 Ga0105245_10168812
469 Ga0105245_10445142
470 Ga0105245_10672567
471 Ga0105245_10989318
472 Ga0114129_10078929
473 Ga0105243_10018725
474 Ga0105243_10315875
475 Ga0105241_10003609
476 Ga0105241_10007344
477 Ga0105241_10008251
478 Ga0105241_10021622
479 Ga0105241_10048728
480 Ga0105241_10528261
481 Ga0105242_10008408
482 Ga0105242_10022625
483 Ga0105242_10278922
484 Ga0105242_10393987
485 Ga0105242_10483599
486 Ga0105248_10033969
487 Ga0105248_10071826
488 Ga0105248_10106079
489 Ga0105248_10401904
490 Ga0105248_10695811
491 Ga0105237_10003116
492 Ga0105237_10022142
493 Ga0105237_10031683
494 Ga0105237_10032833
495 Ga0105237_10032934
496 Ga0105237_10033896
497 Ga0105238_10028382
498 Ga0105238_10040363
499 Ga0105238_10060783
500 Ga0105238_10112020
501 Ga0105238_10130523
502 Ga0105238_10491307
503 Ga0105238_10594134
504 Ga0105238_10678111
505 Ga0105249_10042470
506 Ga0105239_10004575
507 Ga0105239_10012002
508 Ga0105239_10013052
509 Ga0105239_10068642
510 Ga0105239_10086397
511 Ga0105239_10139347
512 Ga0105239_10186049
513 Ga0105239_10256320
514 Ga0157371_10041521
515 Ga0157370_10001930
516 Ga0157370_10004518
517 Ga0157370_10011874
518 Ga0157369_10003687
519 Ga0157369_10015530
520 Ga0157369_10021732
521 Ga0157369_10075526
522 Ga0157369_10131160
523 Ga0157369_10536573
524 Ga0157374_10017770
525 Ga0157374_10030369
526 Ga0157374_10072756
527 Ga0157374_10108989
528 Ga0157374_10147951
529 Ga0157378_10053050
530 Ga0157378_10355490
531 Ga0163162_10002654
532 Ga0163162_10003665
533 Ga0163162_10348252
534 Ga0163162_10652686
535 Ga0157372_10039565
536 Ga0157372_10106819
537 Ga0157372_10495591
538 Ga0157375_10001273
539 Ga0157375_10006963
540 Ga0157375_10034427
541 Ga0157375_10098730
542 Ga0163163_10001269
543 Ga0163163_10067114
544 Ga0163163_10073930
545 Ga0163163_10226783
546 Ga0163163_10258097
547 Ga0163163_10373704
548 Ga0157379_10385623
549 Ga0157376_10245261
550 Ga0157376_10333470
551 Ga0213873_10056978
552 Ga0213875_10010062
553 Ga0207680_10042642
554 Ga0207680_10201022
555 Ga0207645_10460964
556 Ga0207705_10042469
557 Ga0207654_10008304
558 Ga0207654_10008514
559 Ga0207654_10083036
560 Ga0207654_10128071
561 Ga0207654_10162868
562 Ga0207707_10006458
563 Ga0207707_10023149
564 Ga0207707_10038771
565 Ga0207707_10103113
566 Ga0207695_10002383
567 Ga0207695_10003035
568 Ga0207695_10003175
569 Ga0207695_10005373
570 Ga0207695_10013509
571 Ga0207695_10020230
572 Ga0207695_10070953
573 Ga0207695_10220029
574 Ga0207671_10015936
575 Ga0207671_10017299
576 Ga0207671_10025693
577 Ga0207671_10028228
578 Ga0207671_10032400
579 Ga0207671_10039595
580 Ga0207660_10022344
581 Ga0207660_10453649
582 Ga0207657_10002011
583 Ga0207657_10059539
584 Ga0207652_10003776
585 Ga0207652_10060652
586 Ga0207652_10219176
587 Ga0207652_10412364
588 Ga0207694_10000927
589 Ga0207694_10010303
590 Ga0207694_10019940
591 Ga0207694_10179574
592 Ga0207694_10218286
593 Ga0207694_10311988
594 Ga0207687_10001714
595 Ga0207687_10010641
596 Ga0207687_10126131
597 Ga0207687_10192725
598 Ga0207687_10295352
599 Ga0207700_10106623
600 Ga0207700_10197043
601 Ga0207644_10080578
602 Ga0207644_10117580
603 Ga0207686_10007096
604 Ga0207686_10057463
605 Ga0207686_10158306
606 Ga0207686_10204982
607 Ga0207709_10189264
608 Ga0207670_10325999
609 Ga0207711_10009407
610 Ga0207711_10109711
611 Ga0207711_10584522
612 Ga0207711_10747870
613 Ga0207689_10162925
614 Ga0207661_10000038
615 Ga0207661_10017436
616 Ga0207679_10326135
617 Ga0207667_10001452
618 Ga0207667_10007170
619 Ga0207667_10069297
620 Ga0207667_10087566
621 Ga0207667_10298390
622 Ga0207712_10045792
623 Ga0207677_10009668
624 Ga0207677_10058903
625 Ga0207677_10159634
626 Ga0207677_10354930
627 Ga0207703_10007894
628 Ga0207703_10029510
629 Ga0207703_10516833
630 Ga0207703_10607144
631 Ga0207639_10255622
632 Ga0207702_10012914
633 Ga0207702_10013881
634 Ga0207702_10025358
635 Ga0207702_10058275
636 Ga0207702_10097348
637 Ga0207641_10013228
638 Ga0207648_10032367
639 Ga0207676_10087607
640 Ga0207676_10113867
641 Ga0207674_10002236
642 Ga0207674_10013150
643 Ga0207674_10089201
644 Ga0207683_10357224
645 Ga0207698_10023855
646 Ga0268266_10421809
647 Ga0265338_10207923
648 Ga0265331_10067503
649 Ga0265314_10038260
650 Ga0265314_10111479
651 Ga0373926_0011326
652 Ga0373926_0056234
653 Ga0373934_0001144
654 Ga0373945_0019355
655 Ga0373945_0075679
656 Ga0373954_0019688
657 Ga0373943_0018877
658 Ga0373946_0011928
659 Ga0373931_0102951
660 Ga0373927_0000194
661 Ga0373927_0001095
662 Ga0373927_0228855
663 Ga0373933_0047855
664 Ga0373933_0072422
665 Ga0373933_0178189
666 Ga0373947_0003398
667 Ga0373947_0027196
668 Ga0373947_0048303
669 Ga0373937_0017300
670 Ga0373937_0026097
671 Ga0373937_0095918
672 Ga0373937_0154844
673 Ga0373937_0224520
674 Ga0373937_0425123
675 Ga0373937_0478640
676 Ga0373925_0000669
677 Ga0373925_0000698
678 Ga0373925_0025072
679 Ga0373925_0472049
680 Ga0395898_0221194
681 Ga0436364_0076825
682 Ga0436364_0623660
683 Ga0436364_0692685
684 Ga0436365_0685921
685 Ga0436362_0358059
686 Ga0466959_0305647
687 Ga0451576_0010589
688 Ga0495651_0082620
689 Ga0495580_0044024
690 Ga0495580_0086401
691 Ga0495580_0143895
692 Ga0495580_0191539
693 Ga0495580_0252547
694 Ga0495582_0069825
695 Ga0495639_0091230
696 Ga0495664_0045952
697 Ga0495594_0137087
698 Ga0495594_0171621
699 Ga0495608_0176092
700 Ga0495628_0020819
701 Ga0495665_0029269
702 Ga0495665_0151104
703 Ga0495640_0080579
704 Ga0495640_0167880
705 Ga0495587_0054609
706 Ga0495587_0064993
707 Ga0495645_0019209
708 Ga0495634_0014927
709 Ga0495635_0060277
710 Ga0495635_0233320
711 Ga0495657_0071048
712 Ga0495599_0006291
713 Ga0495599_0011805
714 Ga0495623_0074895
715 Ga0495646_0036746
716 Ga0495613_0053041
717 Ga0495624_0056557
718 Ga0495600_0086368
719 Ga0495604_0094860
720 Ga0495674_0260239
721 Ga0495674_0271121
722 Ga0495680_0044916
723 Ga0495675_0069326
724 Ga0495684_0005955
725 Ga0495684_0011073
726 Ga0495684_0043664
727 Ga0495602_0004231
728 Ga0501073_0098765
729 nmdc:mga0qj67_27001_c1
730 nmdc:mga06r32_13464_c1

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13709

DUF4159

Domain of unknown function (DUF4159)

124

326

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.8236 54 276
4i66-assembly1.cif.gz_A-2 crystal structure of hoch_4089 protein from haliangium ochraceum 0.812 54 276
3unl-assembly2.cif.gz_D crystal structure of ketosteroid isomerase f54g from pseudomonas testosteroni 0.8091 222 239
3m8c-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound 0.7836 222 239
7qcz-assembly1.cif.gz_A-2 structure of the orange carotenoid protein from planktothrix agardhii binding canthaxanthin in the c2 space group 0.738 221 242
ID Description Score Start End Superfamily
af_Q8I0Z3_52_185_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8163 223 238 3.10.450.50
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.8007 54 276 3.40.50.12140
4i66A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 0.7894 54 276 3.40.50.12140
af_A0A2R8RL16_66_203_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7232 221 242 2.60.40.10
af_Q2R940_342_494_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7132 222 239 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2N9MZG7-F1-model_v4 DUF4159 domain-containing protein 0.9799 106 278
AF-A0A7Y5LI15-F1-model_v4 DUF4159 domain-containing protein 0.9726 184 278
AF-A0A6L7WQY4-F1-model_v4 DUF4159 domain-containing protein 0.9714 109 278
AF-A0A2U3L1S4-F1-model_v4 DUF4159 domain-containing protein 0.9702 87 278
AF-A0A2N9MZG7-F1-model_v4 DUF4159 domain-containing protein 0.9688 106 278

Map