F423742
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 365 | 147 | 730 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300035692|Ga0373935_0125541|Ga0373935_0125541_132_1118 |
| Length | 328 |
| Sequence | MLYQRGWPGNVPRQRASRRDAIAAQFLARIMTGCGNEPTATLDSRHNLAMGGKERILTCAGAAILTLGTALAWQLPWREYPGQDNIEIPPDYQEKTEWVFARLMYPPYMGSMNGRGFRGFYGGDWKHGRSSWTTDYTSADRHVAVALRRLTRVHVRSVEQPVDLDDGPDAFNYPWLYAVEVGHWQLTDFQVKQMREFLERGGFFMCDDFHGIQEWEVFLASMKRVFPDRPIVDIPDSDPIFHVIYDLDHRYQVPGAQYLRSGRTYEQDGYEARWRGIYDEHGRLMVAICHNMDLGDAWEWADYPRYDEKFAALAFRIVSNYVVYAMTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 62 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 63 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 98 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 101 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 104 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 105 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 107 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 108 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 109 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 116 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 98.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 30.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373935_0125541 | 3300035692 | Bacteria | 1719 |
| 2 | Ga0070658_10021390 | 3300005327 | Bacteria | 5185 |
| 3 | Ga0070658_10079888 | 3300005327 | Bacteria | 2686 |
| 4 | Ga0070658_10115814 | 3300005327 | Bacteria | 2223 |
| 5 | Ga0070658_10164230 | 3300005327 | Bacteria | 1864 |
| 6 | Ga0070683_100000024 | 3300005329 | Bacteria | 173376 |
| 7 | Ga0070683_100000694 | 3300005329 | Bacteria | 24453 |
| 8 | Ga0070683_100020826 | 3300005329 | Bacteria | 5842 |
| 9 | Ga0068869_100007394 | 3300005334 | Bacteria | 7015 |
| 10 | Ga0070666_10163684 | 3300005335 | Unclassified | 1555 |
| 11 | Ga0070680_100029385 | 3300005336 | Bacteria | 4415 |
| 12 | Ga0068868_100011205 | 3300005338 | Bacteria | 6529 |
| 13 | Ga0068868_100449500 | 3300005338 | Unclassified | 1121 |
| 14 | Ga0070660_100029822 | 3300005339 | Unclassified | 4090 |
| 15 | Ga0070660_100096647 | 3300005339 | Bacteria | 2336 |
| 16 | Ga0070660_100235223 | 3300005339 | Bacteria | 1491 |
| 17 | Ga0070689_100136182 | 3300005340 | Bacteria | 1972 |
| 18 | Ga0070691_10002238 | 3300005341 | Bacteria | 8557 |
| 19 | Ga0070671_100204161 | 3300005355 | Bacteria | 1676 |
| 20 | Ga0070667_100113252 | 3300005367 | Unclassified | 2354 |
| 21 | Ga0070709_10127216 | 3300005434 | Unclassified | 1735 |
| 22 | Ga0070714_100036860 | 3300005435 | Bacteria | 4105 |
| 23 | Ga0070713_100011942 | 3300005436 | Bacteria | 6352 |
| 24 | Ga0070713_100130179 | 3300005436 | Bacteria | 2218 |
| 25 | Ga0070711_100120857 | 3300005439 | Bacteria | 1937 |
| 26 | Ga0070711_100530615 | 3300005439 | Unclassified | 974 |
| 27 | Ga0070708_100414619 | 3300005445 | Bacteria | 1270 |
| 28 | Ga0070681_10008370 | 3300005458 | Bacteria | 10133 |
| 29 | Ga0070681_10019747 | 3300005458 | Bacteria | 6749 |
| 30 | Ga0070681_10114020 | 3300005458 | Bacteria | 2642 |
| 31 | Ga0070681_10307887 | 3300005458 | Bacteria | 1493 |
| 32 | Ga0068867_100358301 | 3300005459 | Bacteria | 1219 |
| 33 | Ga0070679_100006154 | 3300005530 | Bacteria | 11166 |
| 34 | Ga0070679_100230159 | 3300005530 | Bacteria | 1813 |
| 35 | Ga0070679_100249702 | 3300005530 | Bacteria | 1731 |
| 36 | Ga0070679_100250994 | 3300005530 | Unclassified | 1725 |
| 37 | Ga0070684_100000023 | 3300005535 | Bacteria | 127415 |
| 38 | Ga0070684_100000633 | 3300005535 | Bacteria | 24156 |
| 39 | Ga0070684_100021761 | 3300005535 | Bacteria | 5341 |
| 40 | Ga0070684_100086918 | 3300005535 | Bacteria | 2776 |
| 41 | Ga0068853_100081150 | 3300005539 | Unclassified | 2839 |
| 42 | Ga0068853_100135618 | 3300005539 | Unclassified | 2206 |
| 43 | Ga0068853_100172597 | 3300005539 | Bacteria | 1957 |
| 44 | Ga0068853_100466681 | 3300005539 | Unclassified | 1189 |
| 45 | Ga0070665_100073030 | 3300005548 | Bacteria | 3438 |
| 46 | Ga0070665_100533912 | 3300005548 | Bacteria | 1185 |
| 47 | Ga0068855_100007964 | 3300005563 | Bacteria | 12802 |
| 48 | Ga0068855_100011483 | 3300005563 | Bacteria | 10704 |
| 49 | Ga0068855_100015260 | 3300005563 | Bacteria | 9247 |
| 50 | Ga0068855_100103574 | 3300005563 | Unclassified | 3274 |
| 51 | Ga0068855_100156583 | 3300005563 | Bacteria | 2588 |
| 52 | Ga0068855_100168523 | 3300005563 | Bacteria | 2481 |
| 53 | Ga0070664_100136881 | 3300005564 | Unclassified | 2154 |
| 54 | Ga0070664_100470775 | 3300005564 | Unclassified | 1155 |
| 55 | Ga0068857_100000701 | 3300005577 | Bacteria | 24896 |
| 56 | Ga0068857_100015252 | 3300005577 | Bacteria | 6707 |
| 57 | Ga0068857_100038532 | 3300005577 | Bacteria | 4233 |
| 58 | Ga0068857_100138133 | 3300005577 | Unclassified | 2202 |
| 59 | Ga0068856_100017233 | 3300005614 | Bacteria | 7001 |
| 60 | Ga0068856_100017433 | 3300005614 | Bacteria | 6959 |
| 61 | Ga0068856_100045585 | 3300005614 | Unclassified | 4318 |
| 62 | Ga0068856_100097322 | 3300005614 | Unclassified | 2932 |
| 63 | Ga0068856_100397076 | 3300005614 | Bacteria | 1399 |
| 64 | Ga0068852_100034857 | 3300005616 | Unclassified | 4192 |
| 65 | Ga0068852_100226557 | 3300005616 | Bacteria | 1780 |
| 66 | Ga0068852_100243473 | 3300005616 | Bacteria | 1720 |
| 67 | Ga0068859_100076458 | 3300005617 | Unclassified | 3389 |
| 68 | Ga0068859_100145256 | 3300005617 | Unclassified | 2447 |
| 69 | Ga0068859_100329566 | 3300005617 | Unclassified | 1621 |
| 70 | Ga0068864_100045545 | 3300005618 | Bacteria | 3763 |
| 71 | Ga0068863_100024186 | 3300005841 | Bacteria | 5794 |
| 72 | Ga0068863_100355581 | 3300005841 | Unclassified | 1427 |
| 73 | Ga0068863_100360216 | 3300005841 | Unclassified | 1418 |
| 74 | Ga0068858_100002905 | 3300005842 | Bacteria | 17241 |
| 75 | Ga0068858_100035210 | 3300005842 | Bacteria | 4643 |
| 76 | Ga0068858_100170838 | 3300005842 | Unclassified | 2050 |
| 77 | Ga0068858_100282122 | 3300005842 | Unclassified | 1582 |
| 78 | Ga0068858_100507193 | 3300005842 | Bacteria | 1166 |
| 79 | Ga0068858_100646296 | 3300005842 | Bacteria | 1028 |
| 80 | Ga0070717_10049318 | 3300006028 | Bacteria | 3456 |
| 81 | Ga0070717_10137954 | 3300006028 | Bacteria | 2102 |
| 82 | Ga0097621_100050733 | 3300006237 | Bacteria | 3375 |
| 83 | Ga0097621_100402960 | 3300006237 | Unclassified | 1225 |
| 84 | Ga0068871_100108613 | 3300006358 | Bacteria | 2332 |
| 85 | Ga0068871_100387177 | 3300006358 | Unclassified | 1243 |
| 86 | Ga0075430_100002855 | 3300006846 | Bacteria | 14465 |
| 87 | Ga0075431_100003198 | 3300006847 | Bacteria | 15840 |
| 88 | Ga0097620_100076459 | 3300006931 | Unclassified | 3389 |
| 89 | Ga0097620_100145258 | 3300006931 | Unclassified | 2447 |
| 90 | Ga0097620_100329568 | 3300006931 | Unclassified | 1621 |
| 91 | Ga0105240_10000349 | 3300009093 | Bacteria | 86505 |
| 92 | Ga0105240_10003715 | 3300009093 | Bacteria | 23583 |
| 93 | Ga0105240_10004951 | 3300009093 | Bacteria | 20031 |
| 94 | Ga0105240_10011224 | 3300009093 | Bacteria | 12495 |
| 95 | Ga0105240_10093342 | 3300009093 | Unclassified | 3673 |
| 96 | Ga0105240_10117154 | 3300009093 | Bacteria | 3212 |
| 97 | Ga0105240_10208943 | 3300009093 | Bacteria | 2282 |
| 98 | Ga0105240_10483377 | 3300009093 | Unclassified | 1380 |
| 99 | Ga0105245_10004266 | 3300009098 | Bacteria | 12673 |
| 100 | Ga0105245_10005194 | 3300009098 | Bacteria | 11432 |
| 101 | Ga0105245_10017514 | 3300009098 | Bacteria | 6252 |
| 102 | Ga0105245_10040066 | 3300009098 | Bacteria | 4171 |
| 103 | Ga0105245_10168812 | 3300009098 | Unclassified | 2082 |
| 104 | Ga0105245_10445142 | 3300009098 | Unclassified | 1303 |
| 105 | Ga0105245_10672567 | 3300009098 | Bacteria | 1067 |
| 106 | Ga0105245_10989318 | 3300009098 | Unclassified | 885 |
| 107 | Ga0114129_10078929 | 3300009147 | Unclassified | 4578 |
| 108 | Ga0105243_10018725 | 3300009148 | Bacteria | 5245 |
| 109 | Ga0105243_10315875 | 3300009148 | Unclassified | 1422 |
| 110 | Ga0105241_10003609 | 3300009174 | Bacteria | 11505 |
| 111 | Ga0105241_10007344 | 3300009174 | Bacteria | 8104 |
| 112 | Ga0105241_10008251 | 3300009174 | Bacteria | 7673 |
| 113 | Ga0105241_10021622 | 3300009174 | Bacteria | 4758 |
| 114 | Ga0105241_10048728 | 3300009174 | Unclassified | 3225 |
| 115 | Ga0105241_10528261 | 3300009174 | Unclassified | 1056 |
| 116 | Ga0105242_10008408 | 3300009176 | Bacteria | 7934 |
| 117 | Ga0105242_10022625 | 3300009176 | Unclassified | 4947 |
| 118 | Ga0105242_10278922 | 3300009176 | Unclassified | 1517 |
| 119 | Ga0105242_10393987 | 3300009176 | Bacteria | 1290 |
| 120 | Ga0105242_10483599 | 3300009176 | Unclassified | 1174 |
| 121 | Ga0105248_10033969 | 3300009177 | Bacteria | 5701 |
| 122 | Ga0105248_10071826 | 3300009177 | Unclassified | 3889 |
| 123 | Ga0105248_10106079 | 3300009177 | Unclassified | 3168 |
| 124 | Ga0105248_10401904 | 3300009177 | Unclassified | 1542 |
| 125 | Ga0105248_10695811 | 3300009177 | Unclassified | 1147 |
| 126 | Ga0105237_10003116 | 3300009545 | Bacteria | 19958 |
| 127 | Ga0105237_10022142 | 3300009545 | Bacteria | 6520 |
| 128 | Ga0105237_10031683 | 3300009545 | Bacteria | 5355 |
| 129 | Ga0105237_10032833 | 3300009545 | Bacteria | 5255 |
| 130 | Ga0105237_10032934 | 3300009545 | Bacteria | 5248 |
| 131 | Ga0105237_10033896 | 3300009545 | Bacteria | 5173 |
| 132 | Ga0105238_10028382 | 3300009551 | Bacteria | 5703 |
| 133 | Ga0105238_10040363 | 3300009551 | Bacteria | 4729 |
| 134 | Ga0105238_10060783 | 3300009551 | Bacteria | 3782 |
| 135 | Ga0105238_10112020 | 3300009551 | Bacteria | 2708 |
| 136 | Ga0105238_10130523 | 3300009551 | Unclassified | 2491 |
| 137 | Ga0105238_10491307 | 3300009551 | Bacteria | 1227 |
| 138 | Ga0105238_10594134 | 3300009551 | Bacteria | 1114 |
| 139 | Ga0105238_10678111 | 3300009551 | Bacteria | 1042 |
| 140 | Ga0105249_10042470 | 3300009553 | Unclassified | 4135 |
| 141 | Ga0105239_10004575 | 3300010375 | Bacteria | 16482 |
| 142 | Ga0105239_10012002 | 3300010375 | Bacteria | 9661 |
| 143 | Ga0105239_10013052 | 3300010375 | Bacteria | 9234 |
| 144 | Ga0105239_10068642 | 3300010375 | Bacteria | 3896 |
| 145 | Ga0105239_10086397 | 3300010375 | Bacteria | 3457 |
| 146 | Ga0105239_10139347 | 3300010375 | Bacteria | 2702 |
| 147 | Ga0105239_10186049 | 3300010375 | Bacteria | 2324 |
| 148 | Ga0105239_10256320 | 3300010375 | Unclassified | 1965 |
| 149 | Ga0157371_10041521 | 3300013102 | Unclassified | 3281 |
| 150 | Ga0157370_10001930 | 3300013104 | Bacteria | 25516 |
| 151 | Ga0157370_10004518 | 3300013104 | Bacteria | 15945 |
| 152 | Ga0157370_10011874 | 3300013104 | Bacteria | 9085 |
| 153 | Ga0157369_10003687 | 3300013105 | Bacteria | 18200 |
| 154 | Ga0157369_10015530 | 3300013105 | Bacteria | 8581 |
| 155 | Ga0157369_10021732 | 3300013105 | Bacteria | 7176 |
| 156 | Ga0157369_10075526 | 3300013105 | Bacteria | 3613 |
| 157 | Ga0157369_10131160 | 3300013105 | Unclassified | 2656 |
| 158 | Ga0157369_10536573 | 3300013105 | Unclassified | 1210 |
| 159 | Ga0157374_10017770 | 3300013296 | Bacteria | 6266 |
| 160 | Ga0157374_10030369 | 3300013296 | Unclassified | 4906 |
| 161 | Ga0157374_10072756 | 3300013296 | Unclassified | 3244 |
| 162 | Ga0157374_10108989 | 3300013296 | Bacteria | 2662 |
| 163 | Ga0157374_10147951 | 3300013296 | Bacteria | 2282 |
| 164 | Ga0157378_10053050 | 3300013297 | Bacteria | 3609 |
| 165 | Ga0157378_10355490 | 3300013297 | Unclassified | 1432 |
| 166 | Ga0163162_10002654 | 3300013306 | Bacteria | 16954 |
| 167 | Ga0163162_10003665 | 3300013306 | Bacteria | 14738 |
| 168 | Ga0163162_10348252 | 3300013306 | Bacteria | 1614 |
| 169 | Ga0163162_10652686 | 3300013306 | Unclassified | 1176 |
| 170 | Ga0157372_10039565 | 3300013307 | Bacteria | 5204 |
| 171 | Ga0157372_10106819 | 3300013307 | Bacteria | 3202 |
| 172 | Ga0157372_10495591 | 3300013307 | Bacteria | 1424 |
| 173 | Ga0157375_10001273 | 3300013308 | Bacteria | 21807 |
| 174 | Ga0157375_10006963 | 3300013308 | Bacteria | 9873 |
| 175 | Ga0157375_10034427 | 3300013308 | Bacteria | 4826 |
| 176 | Ga0157375_10098730 | 3300013308 | Unclassified | 2998 |
| 177 | Ga0163163_10001269 | 3300014325 | Bacteria | 21312 |
| 178 | Ga0163163_10067114 | 3300014325 | Bacteria | 3565 |
| 179 | Ga0163163_10073930 | 3300014325 | Unclassified | 3399 |
| 180 | Ga0163163_10226783 | 3300014325 | Bacteria | 1917 |
| 181 | Ga0163163_10258097 | 3300014325 | Unclassified | 1794 |
| 182 | Ga0163163_10373704 | 3300014325 | Bacteria | 1483 |
| 183 | Ga0157379_10385623 | 3300014968 | Unclassified | 1286 |
| 184 | Ga0157376_10245261 | 3300014969 | Unclassified | 1671 |
| 185 | Ga0157376_10333470 | 3300014969 | Bacteria | 1446 |
| 186 | Ga0213873_10056978 | 3300021358 | Unclassified | 1048 |
| 187 | Ga0213875_10010062 | 3300021388 | Bacteria | 4754 |
| 188 | Ga0207680_10042642 | 3300025903 | Bacteria | 2656 |
| 189 | Ga0207680_10201022 | 3300025903 | Unclassified | 1358 |
| 190 | Ga0207645_10460964 | 3300025907 | Unclassified | 858 |
| 191 | Ga0207705_10042469 | 3300025909 | Bacteria | 3264 |
| 192 | Ga0207654_10008304 | 3300025911 | Bacteria | 5246 |
| 193 | Ga0207654_10008514 | 3300025911 | Bacteria | 5191 |
| 194 | Ga0207654_10083036 | 3300025911 | Bacteria | 1933 |
| 195 | Ga0207654_10128071 | 3300025911 | Bacteria | 1603 |
| 196 | Ga0207654_10162868 | 3300025911 | Unclassified | 1442 |
| 197 | Ga0207707_10006458 | 3300025912 | Bacteria | 10238 |
| 198 | Ga0207707_10023149 | 3300025912 | Bacteria | 5435 |
| 199 | Ga0207707_10038771 | 3300025912 | Bacteria | 4164 |
| 200 | Ga0207707_10103113 | 3300025912 | Bacteria | 2494 |
| 201 | Ga0207695_10002383 | 3300025913 | Bacteria | 27875 |
| 202 | Ga0207695_10003035 | 3300025913 | Bacteria | 24083 |
| 203 | Ga0207695_10003175 | 3300025913 | Bacteria | 23422 |
| 204 | Ga0207695_10005373 | 3300025913 | Bacteria | 17032 |
| 205 | Ga0207695_10013509 | 3300025913 | Bacteria | 9733 |
| 206 | Ga0207695_10020230 | 3300025913 | Bacteria | 7629 |
| 207 | Ga0207695_10070953 | 3300025913 | Unclassified | 3559 |
| 208 | Ga0207695_10220029 | 3300025913 | Unclassified | 1806 |
| 209 | Ga0207671_10015936 | 3300025914 | Bacteria | 5860 |
| 210 | Ga0207671_10017299 | 3300025914 | Bacteria | 5562 |
| 211 | Ga0207671_10025693 | 3300025914 | Unclassified | 4421 |
| 212 | Ga0207671_10028228 | 3300025914 | Bacteria | 4194 |
| 213 | Ga0207671_10032400 | 3300025914 | Bacteria | 3891 |
| 214 | Ga0207671_10039595 | 3300025914 | Bacteria | 3490 |
| 215 | Ga0207660_10022344 | 3300025917 | Unclassified | 4261 |
| 216 | Ga0207660_10453649 | 3300025917 | Unclassified | 1037 |
| 217 | Ga0207657_10002011 | 3300025919 | Bacteria | 21986 |
| 218 | Ga0207657_10059539 | 3300025919 | Unclassified | 3281 |
| 219 | Ga0207652_10003776 | 3300025921 | Bacteria | 12402 |
| 220 | Ga0207652_10060652 | 3300025921 | Unclassified | 3264 |
| 221 | Ga0207652_10219176 | 3300025921 | Bacteria | 1714 |
| 222 | Ga0207652_10412364 | 3300025921 | Unclassified | 1218 |
| 223 | Ga0207694_10000927 | 3300025924 | Bacteria | 25984 |
| 224 | Ga0207694_10010303 | 3300025924 | Bacteria | 7047 |
| 225 | Ga0207694_10019940 | 3300025924 | Bacteria | 5073 |
| 226 | Ga0207694_10179574 | 3300025924 | Bacteria | 1716 |
| 227 | Ga0207694_10218286 | 3300025924 | Bacteria | 1555 |
| 228 | Ga0207694_10311988 | 3300025924 | Unclassified | 1297 |
| 229 | Ga0207687_10001714 | 3300025927 | Bacteria | 15117 |
| 230 | Ga0207687_10010641 | 3300025927 | Bacteria | 6010 |
| 231 | Ga0207687_10126131 | 3300025927 | Unclassified | 1922 |
| 232 | Ga0207687_10192725 | 3300025927 | Unclassified | 1587 |
| 233 | Ga0207687_10295352 | 3300025927 | Unclassified | 1303 |
| 234 | Ga0207700_10106623 | 3300025928 | Bacteria | 2247 |
| 235 | Ga0207700_10197043 | 3300025928 | Bacteria | 1695 |
| 236 | Ga0207644_10080578 | 3300025931 | Bacteria | 2405 |
| 237 | Ga0207644_10117580 | 3300025931 | Bacteria | 2019 |
| 238 | Ga0207686_10007096 | 3300025934 | Bacteria | 6030 |
| 239 | Ga0207686_10057463 | 3300025934 | Bacteria | 2449 |
| 240 | Ga0207686_10158306 | 3300025934 | Unclassified | 1585 |
| 241 | Ga0207686_10204982 | 3300025934 | Bacteria | 1414 |
| 242 | Ga0207709_10189264 | 3300025935 | Unclassified | 1460 |
| 243 | Ga0207670_10325999 | 3300025936 | Bacteria | 1209 |
| 244 | Ga0207711_10009407 | 3300025941 | Bacteria | 8160 |
| 245 | Ga0207711_10109711 | 3300025941 | Bacteria | 2453 |
| 246 | Ga0207711_10584522 | 3300025941 | Unclassified | 1042 |
| 247 | Ga0207711_10747870 | 3300025941 | Bacteria | 911 |
| 248 | Ga0207689_10162925 | 3300025942 | Bacteria | 1837 |
| 249 | Ga0207661_10000038 | 3300025944 | Bacteria | 136281 |
| 250 | Ga0207661_10017436 | 3300025944 | Bacteria | 5315 |
| 251 | Ga0207679_10326135 | 3300025945 | Unclassified | 1331 |
| 252 | Ga0207667_10001452 | 3300025949 | Bacteria | 29739 |
| 253 | Ga0207667_10007170 | 3300025949 | Bacteria | 13451 |
| 254 | Ga0207667_10069297 | 3300025949 | Bacteria | 3671 |
| 255 | Ga0207667_10087566 | 3300025949 | Bacteria | 3221 |
| 256 | Ga0207667_10298390 | 3300025949 | Unclassified | 1646 |
| 257 | Ga0207712_10045792 | 3300025961 | Bacteria | 3030 |
| 258 | Ga0207677_10009668 | 3300026023 | Bacteria | 5431 |
| 259 | Ga0207677_10058903 | 3300026023 | Bacteria | 2647 |
| 260 | Ga0207677_10159634 | 3300026023 | Unclassified | 1750 |
| 261 | Ga0207677_10354930 | 3300026023 | Unclassified | 1230 |
| 262 | Ga0207703_10007894 | 3300026035 | Bacteria | 8415 |
| 263 | Ga0207703_10029510 | 3300026035 | Unclassified | 4329 |
| 264 | Ga0207703_10516833 | 3300026035 | Bacteria | 1122 |
| 265 | Ga0207703_10607144 | 3300026035 | Unclassified | 1035 |
| 266 | Ga0207639_10255622 | 3300026041 | Unclassified | 1530 |
| 267 | Ga0207702_10012914 | 3300026078 | Bacteria | 6946 |
| 268 | Ga0207702_10013881 | 3300026078 | Bacteria | 6691 |
| 269 | Ga0207702_10025358 | 3300026078 | Bacteria | 4920 |
| 270 | Ga0207702_10058275 | 3300026078 | Bacteria | 3286 |
| 271 | Ga0207702_10097348 | 3300026078 | Unclassified | 2589 |
| 272 | Ga0207641_10013228 | 3300026088 | Bacteria | 6766 |
| 273 | Ga0207648_10032367 | 3300026089 | Bacteria | 4617 |
| 274 | Ga0207676_10087607 | 3300026095 | Unclassified | 2547 |
| 275 | Ga0207676_10113867 | 3300026095 | Bacteria | 2268 |
| 276 | Ga0207674_10002236 | 3300026116 | Bacteria | 24504 |
| 277 | Ga0207674_10013150 | 3300026116 | Bacteria | 9211 |
| 278 | Ga0207674_10089201 | 3300026116 | Bacteria | 3076 |
| 279 | Ga0207683_10357224 | 3300026121 | Unclassified | 1342 |
| 280 | Ga0207698_10023855 | 3300026142 | Unclassified | 4282 |
| 281 | Ga0268266_10421809 | 3300028379 | Unclassified | 1264 |
| 282 | Ga0265338_10207923 | 3300028800 | Bacteria | 1471 |
| 283 | Ga0265331_10067503 | 3300031250 | Bacteria | 1678 |
| 284 | Ga0265314_10038260 | 3300031711 | Bacteria | 3468 |
| 285 | Ga0265314_10111479 | 3300031711 | Bacteria | 1738 |
| 286 | Ga0373926_0011326 | 3300035083 | Bacteria | 3000 |
| 287 | Ga0373926_0056234 | 3300035083 | Archaea | 1427 |
| 288 | Ga0373934_0001144 | 3300035086 | Bacteria | 9655 |
| 289 | Ga0373945_0019355 | 3300035116 | Archaea | 2324 |
| 290 | Ga0373945_0075679 | 3300035116 | Unclassified | 1282 |
| 291 | Ga0373954_0019688 | 3300035118 | Bacteria | 3046 |
| 292 | Ga0373943_0018877 | 3300035170 | Bacteria | 3170 |
| 293 | Ga0373946_0011928 | 3300035171 | Unclassified | 3248 |
| 294 | Ga0373931_0102951 | 3300035691 | Bacteria | 1609 |
| 295 | Ga0373927_0000194 | 3300035695 | Bacteria | 48820 |
| 296 | Ga0373927_0001095 | 3300035695 | Bacteria | 20613 |
| 297 | Ga0373927_0228855 | 3300035695 | Bacteria | 1222 |
| 298 | Ga0373933_0047855 | 3300035724 | Bacteria | 2545 |
| 299 | Ga0373933_0072422 | 3300035724 | Bacteria | 2099 |
| 300 | Ga0373933_0178189 | 3300035724 | Bacteria | 1355 |
| 301 | Ga0373947_0003398 | 3300035725 | Bacteria | 9418 |
| 302 | Ga0373947_0027196 | 3300035725 | Unclassified | 3347 |
| 303 | Ga0373947_0048303 | 3300035725 | Archaea | 2553 |
| 304 | Ga0373937_0017300 | 3300036401 | Bacteria | 6420 |
| 305 | Ga0373937_0026097 | 3300036401 | Bacteria | 5279 |
| 306 | Ga0373937_0095918 | 3300036401 | Bacteria | 2750 |
| 307 | Ga0373937_0154844 | 3300036401 | Bacteria | 2148 |
| 308 | Ga0373937_0224520 | 3300036401 | Unclassified | 1768 |
| 309 | Ga0373937_0425123 | 3300036401 | Bacteria | 1261 |
| 310 | Ga0373937_0478640 | 3300036401 | Bacteria | 1183 |
| 311 | Ga0373925_0000669 | 3300037068 | Bacteria | 32216 |
| 312 | Ga0373925_0000698 | 3300037068 | Bacteria | 31435 |
| 313 | Ga0373925_0025072 | 3300037068 | Unclassified | 4355 |
| 314 | Ga0373925_0472049 | 3300037068 | Unclassified | 1029 |
| 315 | Ga0395898_0221194 | 3300037466 | Bacteria | 1806 |
| 316 | Ga0436364_0076825 | 3300037853 | Bacteria | 3761 |
| 317 | Ga0436364_0623660 | 3300037853 | Bacteria | 5057 |
| 318 | Ga0436364_0692685 | 3300037853 | Unclassified | 1606 |
| 319 | Ga0436365_0685921 | 3300039437 | Unclassified | 2855 |
| 320 | Ga0436362_0358059 | 3300039453 | Bacteria | 4747 |
| 321 | Ga0466959_0305647 | 3300045049 | Bacteria | 1089 |
| 322 | Ga0451576_0010589 | 3300045051 | Bacteria | 10561 |
| 323 | Ga0495651_0082620 | 3300046462 | Bacteria | 2423 |
| 324 | Ga0495580_0044024 | 3300046472 | Unclassified | 3176 |
| 325 | Ga0495580_0086401 | 3300046472 | Unclassified | 2185 |
| 326 | Ga0495580_0143895 | 3300046472 | Bacteria | 1652 |
| 327 | Ga0495580_0191539 | 3300046472 | Unclassified | 1410 |
| 328 | Ga0495580_0252547 | 3300046472 | Bacteria | 1207 |
| 329 | Ga0495582_0069825 | 3300046473 | Unclassified | 1943 |
| 330 | Ga0495639_0091230 | 3300046475 | Unclassified | 1430 |
| 331 | Ga0495664_0045952 | 3300046477 | Bacteria | 2590 |
| 332 | Ga0495594_0137087 | 3300046499 | Bacteria | 1387 |
| 333 | Ga0495594_0171621 | 3300046499 | Bacteria | 1234 |
| 334 | Ga0495608_0176092 | 3300046511 | Bacteria | 1355 |
| 335 | Ga0495628_0020819 | 3300046516 | Bacteria | 5403 |
| 336 | Ga0495665_0029269 | 3300046531 | Bacteria | 2951 |
| 337 | Ga0495665_0151104 | 3300046531 | Unclassified | 1212 |
| 338 | Ga0495640_0080579 | 3300046533 | Bacteria | 2165 |
| 339 | Ga0495640_0167880 | 3300046533 | Unclassified | 1403 |
| 340 | Ga0495587_0054609 | 3300046536 | Bacteria | 2354 |
| 341 | Ga0495587_0064993 | 3300046536 | Bacteria | 2131 |
| 342 | Ga0495645_0019209 | 3300046543 | Bacteria | 4920 |
| 343 | Ga0495634_0014927 | 3300046642 | Bacteria | 5585 |
| 344 | Ga0495635_0060277 | 3300046663 | Bacteria | 2608 |
| 345 | Ga0495635_0233320 | 3300046663 | Unclassified | 1243 |
| 346 | Ga0495657_0071048 | 3300046675 | Bacteria | 2274 |
| 347 | Ga0495599_0006291 | 3300046678 | Bacteria | 7155 |
| 348 | Ga0495599_0011805 | 3300046678 | Bacteria | 5371 |
| 349 | Ga0495623_0074895 | 3300046679 | Unclassified | 2103 |
| 350 | Ga0495646_0036746 | 3300046680 | Bacteria | 3033 |
| 351 | Ga0495613_0053041 | 3300046689 | Bacteria | 2985 |
| 352 | Ga0495624_0056557 | 3300046690 | Archaea | 2468 |
| 353 | Ga0495600_0086368 | 3300046809 | Bacteria | 2047 |
| 354 | Ga0495604_0094860 | 3300047317 | Unclassified | 2205 |
| 355 | Ga0495674_0260239 | 3300047319 | Unclassified | 1426 |
| 356 | Ga0495674_0271121 | 3300047319 | Bacteria | 1392 |
| 357 | Ga0495680_0044916 | 3300047322 | Bacteria | 3491 |
| 358 | Ga0495675_0069326 | 3300047444 | Bacteria | 2227 |
| 359 | Ga0495684_0005955 | 3300047471 | Bacteria | 9473 |
| 360 | Ga0495684_0011073 | 3300047471 | Bacteria | 6972 |
| 361 | Ga0495684_0043664 | 3300047471 | Bacteria | 3432 |
| 362 | Ga0495602_0004231 | 3300048088 | Bacteria | 14936 |
| 363 | Ga0501073_0098765 | 3300049589 | Bacteria | 2027 |
| 364 | nmdc:mga0qj67_27001_c1 | 3300050509 | Bacteria | 4447 |
| 365 | nmdc:mga06r32_13464_c1 | 3300050510 | Bacteria | 7410 |
| 366 | Ga0373935_0125541 | |||
| 367 | Ga0070658_10021390 | |||
| 368 | Ga0070658_10079888 | |||
| 369 | Ga0070658_10115814 | |||
| 370 | Ga0070658_10164230 | |||
| 371 | Ga0070683_100000024 | |||
| 372 | Ga0070683_100000694 | |||
| 373 | Ga0070683_100020826 | |||
| 374 | Ga0068869_100007394 | |||
| 375 | Ga0070666_10163684 | |||
| 376 | Ga0070680_100029385 | |||
| 377 | Ga0068868_100011205 | |||
| 378 | Ga0068868_100449500 | |||
| 379 | Ga0070660_100029822 | |||
| 380 | Ga0070660_100096647 | |||
| 381 | Ga0070660_100235223 | |||
| 382 | Ga0070689_100136182 | |||
| 383 | Ga0070691_10002238 | |||
| 384 | Ga0070671_100204161 | |||
| 385 | Ga0070667_100113252 | |||
| 386 | Ga0070709_10127216 | |||
| 387 | Ga0070714_100036860 | |||
| 388 | Ga0070713_100011942 | |||
| 389 | Ga0070713_100130179 | |||
| 390 | Ga0070711_100120857 | |||
| 391 | Ga0070711_100530615 | |||
| 392 | Ga0070708_100414619 | |||
| 393 | Ga0070681_10008370 | |||
| 394 | Ga0070681_10019747 | |||
| 395 | Ga0070681_10114020 | |||
| 396 | Ga0070681_10307887 | |||
| 397 | Ga0068867_100358301 | |||
| 398 | Ga0070679_100006154 | |||
| 399 | Ga0070679_100230159 | |||
| 400 | Ga0070679_100249702 | |||
| 401 | Ga0070679_100250994 | |||
| 402 | Ga0070684_100000023 | |||
| 403 | Ga0070684_100000633 | |||
| 404 | Ga0070684_100021761 | |||
| 405 | Ga0070684_100086918 | |||
| 406 | Ga0068853_100081150 | |||
| 407 | Ga0068853_100135618 | |||
| 408 | Ga0068853_100172597 | |||
| 409 | Ga0068853_100466681 | |||
| 410 | Ga0070665_100073030 | |||
| 411 | Ga0070665_100533912 | |||
| 412 | Ga0068855_100007964 | |||
| 413 | Ga0068855_100011483 | |||
| 414 | Ga0068855_100015260 | |||
| 415 | Ga0068855_100103574 | |||
| 416 | Ga0068855_100156583 | |||
| 417 | Ga0068855_100168523 | |||
| 418 | Ga0070664_100136881 | |||
| 419 | Ga0070664_100470775 | |||
| 420 | Ga0068857_100000701 | |||
| 421 | Ga0068857_100015252 | |||
| 422 | Ga0068857_100038532 | |||
| 423 | Ga0068857_100138133 | |||
| 424 | Ga0068856_100017233 | |||
| 425 | Ga0068856_100017433 | |||
| 426 | Ga0068856_100045585 | |||
| 427 | Ga0068856_100097322 | |||
| 428 | Ga0068856_100397076 | |||
| 429 | Ga0068852_100034857 | |||
| 430 | Ga0068852_100226557 | |||
| 431 | Ga0068852_100243473 | |||
| 432 | Ga0068859_100076458 | |||
| 433 | Ga0068859_100145256 | |||
| 434 | Ga0068859_100329566 | |||
| 435 | Ga0068864_100045545 | |||
| 436 | Ga0068863_100024186 | |||
| 437 | Ga0068863_100355581 | |||
| 438 | Ga0068863_100360216 | |||
| 439 | Ga0068858_100002905 | |||
| 440 | Ga0068858_100035210 | |||
| 441 | Ga0068858_100170838 | |||
| 442 | Ga0068858_100282122 | |||
| 443 | Ga0068858_100507193 | |||
| 444 | Ga0068858_100646296 | |||
| 445 | Ga0070717_10049318 | |||
| 446 | Ga0070717_10137954 | |||
| 447 | Ga0097621_100050733 | |||
| 448 | Ga0097621_100402960 | |||
| 449 | Ga0068871_100108613 | |||
| 450 | Ga0068871_100387177 | |||
| 451 | Ga0075430_100002855 | |||
| 452 | Ga0075431_100003198 | |||
| 453 | Ga0097620_100076459 | |||
| 454 | Ga0097620_100145258 | |||
| 455 | Ga0097620_100329568 | |||
| 456 | Ga0105240_10000349 | |||
| 457 | Ga0105240_10003715 | |||
| 458 | Ga0105240_10004951 | |||
| 459 | Ga0105240_10011224 | |||
| 460 | Ga0105240_10093342 | |||
| 461 | Ga0105240_10117154 | |||
| 462 | Ga0105240_10208943 | |||
| 463 | Ga0105240_10483377 | |||
| 464 | Ga0105245_10004266 | |||
| 465 | Ga0105245_10005194 | |||
| 466 | Ga0105245_10017514 | |||
| 467 | Ga0105245_10040066 | |||
| 468 | Ga0105245_10168812 | |||
| 469 | Ga0105245_10445142 | |||
| 470 | Ga0105245_10672567 | |||
| 471 | Ga0105245_10989318 | |||
| 472 | Ga0114129_10078929 | |||
| 473 | Ga0105243_10018725 | |||
| 474 | Ga0105243_10315875 | |||
| 475 | Ga0105241_10003609 | |||
| 476 | Ga0105241_10007344 | |||
| 477 | Ga0105241_10008251 | |||
| 478 | Ga0105241_10021622 | |||
| 479 | Ga0105241_10048728 | |||
| 480 | Ga0105241_10528261 | |||
| 481 | Ga0105242_10008408 | |||
| 482 | Ga0105242_10022625 | |||
| 483 | Ga0105242_10278922 | |||
| 484 | Ga0105242_10393987 | |||
| 485 | Ga0105242_10483599 | |||
| 486 | Ga0105248_10033969 | |||
| 487 | Ga0105248_10071826 | |||
| 488 | Ga0105248_10106079 | |||
| 489 | Ga0105248_10401904 | |||
| 490 | Ga0105248_10695811 | |||
| 491 | Ga0105237_10003116 | |||
| 492 | Ga0105237_10022142 | |||
| 493 | Ga0105237_10031683 | |||
| 494 | Ga0105237_10032833 | |||
| 495 | Ga0105237_10032934 | |||
| 496 | Ga0105237_10033896 | |||
| 497 | Ga0105238_10028382 | |||
| 498 | Ga0105238_10040363 | |||
| 499 | Ga0105238_10060783 | |||
| 500 | Ga0105238_10112020 | |||
| 501 | Ga0105238_10130523 | |||
| 502 | Ga0105238_10491307 | |||
| 503 | Ga0105238_10594134 | |||
| 504 | Ga0105238_10678111 | |||
| 505 | Ga0105249_10042470 | |||
| 506 | Ga0105239_10004575 | |||
| 507 | Ga0105239_10012002 | |||
| 508 | Ga0105239_10013052 | |||
| 509 | Ga0105239_10068642 | |||
| 510 | Ga0105239_10086397 | |||
| 511 | Ga0105239_10139347 | |||
| 512 | Ga0105239_10186049 | |||
| 513 | Ga0105239_10256320 | |||
| 514 | Ga0157371_10041521 | |||
| 515 | Ga0157370_10001930 | |||
| 516 | Ga0157370_10004518 | |||
| 517 | Ga0157370_10011874 | |||
| 518 | Ga0157369_10003687 | |||
| 519 | Ga0157369_10015530 | |||
| 520 | Ga0157369_10021732 | |||
| 521 | Ga0157369_10075526 | |||
| 522 | Ga0157369_10131160 | |||
| 523 | Ga0157369_10536573 | |||
| 524 | Ga0157374_10017770 | |||
| 525 | Ga0157374_10030369 | |||
| 526 | Ga0157374_10072756 | |||
| 527 | Ga0157374_10108989 | |||
| 528 | Ga0157374_10147951 | |||
| 529 | Ga0157378_10053050 | |||
| 530 | Ga0157378_10355490 | |||
| 531 | Ga0163162_10002654 | |||
| 532 | Ga0163162_10003665 | |||
| 533 | Ga0163162_10348252 | |||
| 534 | Ga0163162_10652686 | |||
| 535 | Ga0157372_10039565 | |||
| 536 | Ga0157372_10106819 | |||
| 537 | Ga0157372_10495591 | |||
| 538 | Ga0157375_10001273 | |||
| 539 | Ga0157375_10006963 | |||
| 540 | Ga0157375_10034427 | |||
| 541 | Ga0157375_10098730 | |||
| 542 | Ga0163163_10001269 | |||
| 543 | Ga0163163_10067114 | |||
| 544 | Ga0163163_10073930 | |||
| 545 | Ga0163163_10226783 | |||
| 546 | Ga0163163_10258097 | |||
| 547 | Ga0163163_10373704 | |||
| 548 | Ga0157379_10385623 | |||
| 549 | Ga0157376_10245261 | |||
| 550 | Ga0157376_10333470 | |||
| 551 | Ga0213873_10056978 | |||
| 552 | Ga0213875_10010062 | |||
| 553 | Ga0207680_10042642 | |||
| 554 | Ga0207680_10201022 | |||
| 555 | Ga0207645_10460964 | |||
| 556 | Ga0207705_10042469 | |||
| 557 | Ga0207654_10008304 | |||
| 558 | Ga0207654_10008514 | |||
| 559 | Ga0207654_10083036 | |||
| 560 | Ga0207654_10128071 | |||
| 561 | Ga0207654_10162868 | |||
| 562 | Ga0207707_10006458 | |||
| 563 | Ga0207707_10023149 | |||
| 564 | Ga0207707_10038771 | |||
| 565 | Ga0207707_10103113 | |||
| 566 | Ga0207695_10002383 | |||
| 567 | Ga0207695_10003035 | |||
| 568 | Ga0207695_10003175 | |||
| 569 | Ga0207695_10005373 | |||
| 570 | Ga0207695_10013509 | |||
| 571 | Ga0207695_10020230 | |||
| 572 | Ga0207695_10070953 | |||
| 573 | Ga0207695_10220029 | |||
| 574 | Ga0207671_10015936 | |||
| 575 | Ga0207671_10017299 | |||
| 576 | Ga0207671_10025693 | |||
| 577 | Ga0207671_10028228 | |||
| 578 | Ga0207671_10032400 | |||
| 579 | Ga0207671_10039595 | |||
| 580 | Ga0207660_10022344 | |||
| 581 | Ga0207660_10453649 | |||
| 582 | Ga0207657_10002011 | |||
| 583 | Ga0207657_10059539 | |||
| 584 | Ga0207652_10003776 | |||
| 585 | Ga0207652_10060652 | |||
| 586 | Ga0207652_10219176 | |||
| 587 | Ga0207652_10412364 | |||
| 588 | Ga0207694_10000927 | |||
| 589 | Ga0207694_10010303 | |||
| 590 | Ga0207694_10019940 | |||
| 591 | Ga0207694_10179574 | |||
| 592 | Ga0207694_10218286 | |||
| 593 | Ga0207694_10311988 | |||
| 594 | Ga0207687_10001714 | |||
| 595 | Ga0207687_10010641 | |||
| 596 | Ga0207687_10126131 | |||
| 597 | Ga0207687_10192725 | |||
| 598 | Ga0207687_10295352 | |||
| 599 | Ga0207700_10106623 | |||
| 600 | Ga0207700_10197043 | |||
| 601 | Ga0207644_10080578 | |||
| 602 | Ga0207644_10117580 | |||
| 603 | Ga0207686_10007096 | |||
| 604 | Ga0207686_10057463 | |||
| 605 | Ga0207686_10158306 | |||
| 606 | Ga0207686_10204982 | |||
| 607 | Ga0207709_10189264 | |||
| 608 | Ga0207670_10325999 | |||
| 609 | Ga0207711_10009407 | |||
| 610 | Ga0207711_10109711 | |||
| 611 | Ga0207711_10584522 | |||
| 612 | Ga0207711_10747870 | |||
| 613 | Ga0207689_10162925 | |||
| 614 | Ga0207661_10000038 | |||
| 615 | Ga0207661_10017436 | |||
| 616 | Ga0207679_10326135 | |||
| 617 | Ga0207667_10001452 | |||
| 618 | Ga0207667_10007170 | |||
| 619 | Ga0207667_10069297 | |||
| 620 | Ga0207667_10087566 | |||
| 621 | Ga0207667_10298390 | |||
| 622 | Ga0207712_10045792 | |||
| 623 | Ga0207677_10009668 | |||
| 624 | Ga0207677_10058903 | |||
| 625 | Ga0207677_10159634 | |||
| 626 | Ga0207677_10354930 | |||
| 627 | Ga0207703_10007894 | |||
| 628 | Ga0207703_10029510 | |||
| 629 | Ga0207703_10516833 | |||
| 630 | Ga0207703_10607144 | |||
| 631 | Ga0207639_10255622 | |||
| 632 | Ga0207702_10012914 | |||
| 633 | Ga0207702_10013881 | |||
| 634 | Ga0207702_10025358 | |||
| 635 | Ga0207702_10058275 | |||
| 636 | Ga0207702_10097348 | |||
| 637 | Ga0207641_10013228 | |||
| 638 | Ga0207648_10032367 | |||
| 639 | Ga0207676_10087607 | |||
| 640 | Ga0207676_10113867 | |||
| 641 | Ga0207674_10002236 | |||
| 642 | Ga0207674_10013150 | |||
| 643 | Ga0207674_10089201 | |||
| 644 | Ga0207683_10357224 | |||
| 645 | Ga0207698_10023855 | |||
| 646 | Ga0268266_10421809 | |||
| 647 | Ga0265338_10207923 | |||
| 648 | Ga0265331_10067503 | |||
| 649 | Ga0265314_10038260 | |||
| 650 | Ga0265314_10111479 | |||
| 651 | Ga0373926_0011326 | |||
| 652 | Ga0373926_0056234 | |||
| 653 | Ga0373934_0001144 | |||
| 654 | Ga0373945_0019355 | |||
| 655 | Ga0373945_0075679 | |||
| 656 | Ga0373954_0019688 | |||
| 657 | Ga0373943_0018877 | |||
| 658 | Ga0373946_0011928 | |||
| 659 | Ga0373931_0102951 | |||
| 660 | Ga0373927_0000194 | |||
| 661 | Ga0373927_0001095 | |||
| 662 | Ga0373927_0228855 | |||
| 663 | Ga0373933_0047855 | |||
| 664 | Ga0373933_0072422 | |||
| 665 | Ga0373933_0178189 | |||
| 666 | Ga0373947_0003398 | |||
| 667 | Ga0373947_0027196 | |||
| 668 | Ga0373947_0048303 | |||
| 669 | Ga0373937_0017300 | |||
| 670 | Ga0373937_0026097 | |||
| 671 | Ga0373937_0095918 | |||
| 672 | Ga0373937_0154844 | |||
| 673 | Ga0373937_0224520 | |||
| 674 | Ga0373937_0425123 | |||
| 675 | Ga0373937_0478640 | |||
| 676 | Ga0373925_0000669 | |||
| 677 | Ga0373925_0000698 | |||
| 678 | Ga0373925_0025072 | |||
| 679 | Ga0373925_0472049 | |||
| 680 | Ga0395898_0221194 | |||
| 681 | Ga0436364_0076825 | |||
| 682 | Ga0436364_0623660 | |||
| 683 | Ga0436364_0692685 | |||
| 684 | Ga0436365_0685921 | |||
| 685 | Ga0436362_0358059 | |||
| 686 | Ga0466959_0305647 | |||
| 687 | Ga0451576_0010589 | |||
| 688 | Ga0495651_0082620 | |||
| 689 | Ga0495580_0044024 | |||
| 690 | Ga0495580_0086401 | |||
| 691 | Ga0495580_0143895 | |||
| 692 | Ga0495580_0191539 | |||
| 693 | Ga0495580_0252547 | |||
| 694 | Ga0495582_0069825 | |||
| 695 | Ga0495639_0091230 | |||
| 696 | Ga0495664_0045952 | |||
| 697 | Ga0495594_0137087 | |||
| 698 | Ga0495594_0171621 | |||
| 699 | Ga0495608_0176092 | |||
| 700 | Ga0495628_0020819 | |||
| 701 | Ga0495665_0029269 | |||
| 702 | Ga0495665_0151104 | |||
| 703 | Ga0495640_0080579 | |||
| 704 | Ga0495640_0167880 | |||
| 705 | Ga0495587_0054609 | |||
| 706 | Ga0495587_0064993 | |||
| 707 | Ga0495645_0019209 | |||
| 708 | Ga0495634_0014927 | |||
| 709 | Ga0495635_0060277 | |||
| 710 | Ga0495635_0233320 | |||
| 711 | Ga0495657_0071048 | |||
| 712 | Ga0495599_0006291 | |||
| 713 | Ga0495599_0011805 | |||
| 714 | Ga0495623_0074895 | |||
| 715 | Ga0495646_0036746 | |||
| 716 | Ga0495613_0053041 | |||
| 717 | Ga0495624_0056557 | |||
| 718 | Ga0495600_0086368 | |||
| 719 | Ga0495604_0094860 | |||
| 720 | Ga0495674_0260239 | |||
| 721 | Ga0495674_0271121 | |||
| 722 | Ga0495680_0044916 | |||
| 723 | Ga0495675_0069326 | |||
| 724 | Ga0495684_0005955 | |||
| 725 | Ga0495684_0011073 | |||
| 726 | Ga0495684_0043664 | |||
| 727 | Ga0495602_0004231 | |||
| 728 | Ga0501073_0098765 | |||
| 729 | nmdc:mga0qj67_27001_c1 | |||
| 730 | nmdc:mga06r32_13464_c1 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4i66-assembly1.cif.gz_A-2 | crystal structure of hoch_4089 protein from haliangium ochraceum | 0.8236 | 54 | 276 |
| 4i66-assembly1.cif.gz_A-2 | crystal structure of hoch_4089 protein from haliangium ochraceum | 0.812 | 54 | 276 |
| 3unl-assembly2.cif.gz_D | crystal structure of ketosteroid isomerase f54g from pseudomonas testosteroni | 0.8091 | 222 | 239 |
| 3m8c-assembly1.cif.gz_A | crystal structure of ketosteroid isomerase d99n from pseudomonas testosteroni (tksi) with equilenin bound | 0.7836 | 222 | 239 |
| 7qcz-assembly1.cif.gz_A-2 | structure of the orange carotenoid protein from planktothrix agardhii binding canthaxanthin in the c2 space group | 0.738 | 221 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I0Z3_52_185_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8163 | 223 | 238 | 3.10.450.50 |
| 4i66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 | 0.8007 | 54 | 276 | 3.40.50.12140 |
| 4i66A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Domain of unknown function DUF4159 | 0.7894 | 54 | 276 | 3.40.50.12140 |
| af_A0A2R8RL16_66_203_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7232 | 221 | 242 | 2.60.40.10 |
| af_Q2R940_342_494_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7132 | 222 | 239 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N9MZG7-F1-model_v4 | DUF4159 domain-containing protein | 0.9799 | 106 | 278 |
|
| AF-A0A7Y5LI15-F1-model_v4 | DUF4159 domain-containing protein | 0.9726 | 184 | 278 |
|
| AF-A0A6L7WQY4-F1-model_v4 | DUF4159 domain-containing protein | 0.9714 | 109 | 278 |
|
| AF-A0A2U3L1S4-F1-model_v4 | DUF4159 domain-containing protein | 0.9702 | 87 | 278 |
|
| AF-A0A2N9MZG7-F1-model_v4 | DUF4159 domain-containing protein | 0.9688 | 106 | 278 |
|