F422723

General Info

Members Datasets Scaffolds Average Seq Length
362 177 724 386

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0004441|Ga0495580_0004441_5564_6979
Length 471
Sequence MSDFDTDGHDVTGIAFARSKEAGTFEFEDRRDGDQIGPGLYNAAVRILISAGEASGEMYGAQLIKAMRRTDPSVEFFGVGGEKMRAAGCEIVVDSKDLAVVGITEILSHLPKIWRLFNKLIAEADRRKPDLAIVIDSPAFNWRVARQMKKRGIPVVYYVCPQFWAWRQGRVRLLRKYIDKALVIFPFEEKFYRDRGVNAEFVGHPLAELPRPAISHEEYAANHALNPAKQWITLMPGSRVKEVRMNLPAMLAASRRLGAEYEFLLPVAPTLDAEFMQTLVGQAPFRKGTAFSRNDDRSKLTDGITGSRALPDSNGRVLPQSSNRSDLPVIHLVPDALPALAHSRAGIIASGTATVEAALMDLPFVMVYRVTPLTYLLGRSTVKVPHFAMVNLIAGRQVVPELVQKDFTPEKVTAEMNKIIPDSETRKKMLAGLKEVRDGLRGGEKSSLAPAERAANTIFALWRASQPRQTP

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.59
Rhizosphere 94.48
Stem 0
Stem Tuber 0
Unclassified 17.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0004441 3300046472 Bacteria 11786
2 Ga0070676_10010004 3300005328 Bacteria 5133
3 Ga0070683_100011425 3300005329 Bacteria 7675
4 Ga0070683_100101504 3300005329 Bacteria 2709
5 Ga0070670_100009740 3300005331 Bacteria 8206
6 Ga0068869_100002113 3300005334 Bacteria 11945
7 Ga0068869_100165125 3300005334 Bacteria 1726
8 Ga0068868_100004078 3300005338 Bacteria 10197
9 Ga0068868_100013737 3300005338 Bacteria 5949
10 Ga0070661_100037555 3300005344 Bacteria 3524
11 Ga0070667_100282193 3300005367 Unclassified 1491
12 Ga0070709_10010323 3300005434 Bacteria 5166
13 Ga0070709_10016751 3300005434 Bacteria 4191
14 Ga0070709_10090513 3300005434 Bacteria 2017
15 Ga0070714_100000128 3300005435 Bacteria 59542
16 Ga0070714_100001298 3300005435 Bacteria 18076
17 Ga0070714_100001364 3300005435 Bacteria 17686
18 Ga0070713_100000133 3300005436 Bacteria 48970
19 Ga0070713_100001356 3300005436 Bacteria 15660
20 Ga0070713_100019779 3300005436 Bacteria 5151
21 Ga0070713_100072122 3300005436 Unclassified 2920
22 Ga0070713_100076354 3300005436 Bacteria 2845
23 Ga0070713_100077175 3300005436 Unclassified 2832
24 Ga0070713_100110904 3300005436 Bacteria 2392
25 Ga0070713_100111690 3300005436 Bacteria 2384
26 Ga0070713_100242848 3300005436 Bacteria 1640
27 Ga0070710_10003784 3300005437 Bacteria 7151
28 Ga0070710_10015129 3300005437 Unclassified 3898
29 Ga0070710_10043452 3300005437 Bacteria 2489
30 Ga0070711_100000189 3300005439 Bacteria 32578
31 Ga0070711_100005989 3300005439 Bacteria 7299
32 Ga0070708_100014435 3300005445 Bacteria 6500
33 Ga0070708_100025851 3300005445 Bacteria 5020
34 Ga0070708_100036944 3300005445 Unclassified 4259
35 Ga0070708_100083284 3300005445 Bacteria 2899
36 Ga0070708_100123344 3300005445 Bacteria 2392
37 Ga0070708_100158424 3300005445 Bacteria 2109
38 Ga0070708_100206347 3300005445 Bacteria 1841
39 Ga0070708_100254289 3300005445 Bacteria 1651
40 Ga0070678_100030993 3300005456 Bacteria 3683
41 Ga0070681_10000091 3300005458 Bacteria 67429
42 Ga0070681_10004214 3300005458 Bacteria 13624
43 Ga0070681_10263995 3300005458 Unclassified 1633
44 Ga0070681_10309021 3300005458 Bacteria 1490
45 Ga0068867_100007978 3300005459 Bacteria 7479
46 Ga0070706_100062814 3300005467 Unclassified 3432
47 Ga0070706_100207399 3300005467 Bacteria 1830
48 Ga0070707_100017398 3300005468 Bacteria 6758
49 Ga0070707_100112554 3300005468 Unclassified 2640
50 Ga0070707_100210667 3300005468 Bacteria 1894
51 Ga0070707_100299197 3300005468 Bacteria 1563
52 Ga0070707_100316624 3300005468 Unclassified 1516
53 Ga0070698_100427494 3300005471 Unclassified 1259
54 Ga0070699_100014922 3300005518 Bacteria 6679
55 Ga0070679_100014241 3300005530 Bacteria 7635
56 Ga0070679_100128748 3300005530 Bacteria 2513
57 Ga0070679_100260186 3300005530 Unclassified 1690
58 Ga0070684_100059249 3300005535 Bacteria 3347
59 Ga0068853_100038362 3300005539 Unclassified 4080
60 Ga0068855_100001496 3300005563 Bacteria 29261
61 Ga0068855_100003961 3300005563 Bacteria 18081
62 Ga0068855_100099937 3300005563 Bacteria 3341
63 Ga0068855_100212246 3300005563 Unclassified 2174
64 Ga0068855_100328458 3300005563 Bacteria 1689
65 Ga0070664_100000896 3300005564 Bacteria 23166
66 Ga0068857_100000994 3300005577 Bacteria 21786
67 Ga0068857_100003030 3300005577 Bacteria 13893
68 Ga0068857_100039568 3300005577 Bacteria 4177
69 Ga0068854_100003448 3300005578 Bacteria 9868
70 Ga0068854_100020942 3300005578 Bacteria 4431
71 Ga0068854_100033068 3300005578 Unclassified 3603
72 Ga0068856_100000252 3300005614 Bacteria 58351
73 Ga0068856_100009195 3300005614 Bacteria 9607
74 Ga0068856_100041001 3300005614 Bacteria 4548
75 Ga0068856_100070452 3300005614 Bacteria 3459
76 Ga0068852_100063293 3300005616 Bacteria 3221
77 Ga0068852_100160174 3300005616 Unclassified 2101
78 Ga0068859_100033819 3300005617 Bacteria 5133
79 Ga0068864_100002339 3300005618 Bacteria 15671
80 Ga0068864_100226556 3300005618 Bacteria 1727
81 Ga0068861_100185811 3300005719 Unclassified 1733
82 Ga0068851_10021068 3300005834 Bacteria 3162
83 Ga0068858_100000597 3300005842 Bacteria 37673
84 Ga0068858_100001669 3300005842 Bacteria 22692
85 Ga0068858_100004008 3300005842 Bacteria 14532
86 Ga0068858_100046351 3300005842 Bacteria 4030
87 Ga0068860_100029686 3300005843 Bacteria 5261
88 Ga0070717_10001834 3300006028 Bacteria 14846
89 Ga0070717_10005530 3300006028 Bacteria 9217
90 Ga0070717_10033848 3300006028 Bacteria 4125
91 Ga0070717_10080184 3300006028 Bacteria 2738
92 Ga0070717_10134889 3300006028 Unclassified 2125
93 Ga0070717_10154995 3300006028 Bacteria 1984
94 Ga0070715_10020823 3300006163 Bacteria 2534
95 Ga0070715_10049826 3300006163 Bacteria 1796
96 Ga0070716_100004231 3300006173 Bacteria 6833
97 Ga0070716_100078925 3300006173 Unclassified 1959
98 Ga0070716_100210379 3300006173 Unclassified 1299
99 Ga0070712_100000290 3300006175 Bacteria 28324
100 Ga0070712_100000843 3300006175 Bacteria 18221
101 Ga0070712_100003362 3300006175 Bacteria 9831
102 Ga0070712_100008291 3300006175 Bacteria 6529
103 Ga0070712_100022800 3300006175 Unclassified 4127
104 Ga0097621_100001438 3300006237 Bacteria 16333
105 Ga0097621_100002641 3300006237 Bacteria 12271
106 Ga0097621_100017459 3300006237 Bacteria 5449
107 Ga0068871_100040795 3300006358 Unclassified 3719
108 Ga0068871_100067612 3300006358 Unclassified 2932
109 Ga0068871_100189083 3300006358 Bacteria 1773
110 Ga0075433_10000824 3300006852 Bacteria 21652
111 Ga0075434_100000005 3300006871 Bacteria 104425
112 Ga0075434_100026274 3300006871 Bacteria 5702
113 Ga0068865_100021584 3300006881 Bacteria 4189
114 Ga0068865_100032540 3300006881 Bacteria 3484
115 Ga0075436_100003195 3300006914 Bacteria 11239
116 Ga0075436_100004595 3300006914 Bacteria 9457
117 Ga0075436_100083974 3300006914 Bacteria 2210
118 Ga0097620_100033819 3300006931 Bacteria 5133
119 Ga0075435_100000726 3300007076 Bacteria 20433
120 Ga0075435_100050198 3300007076 Bacteria 3357
121 Ga0099794_10021761 3300007265 Bacteria 2916
122 Ga0105240_10009266 3300009093 Bacteria 13963
123 Ga0105240_10032867 3300009093 Bacteria 6710
124 Ga0105240_10050355 3300009093 Bacteria 5252
125 Ga0105240_10081273 3300009093 Bacteria 3982
126 Ga0105245_10032011 3300009098 Unclassified 4656
127 Ga0105245_10067237 3300009098 Bacteria 3245
128 Ga0105245_10071386 3300009098 Bacteria 3153
129 Ga0114129_10453841 3300009147 Bacteria 1681
130 Ga0105241_10000531 3300009174 Bacteria 28727
131 Ga0105241_10006292 3300009174 Bacteria 8755
132 Ga0105241_10011537 3300009174 Bacteria 6478
133 Ga0105241_10028158 3300009174 Bacteria 4185
134 Ga0105242_10028072 3300009176 Unclassified 4477
135 Ga0105248_10008859 3300009177 Bacteria 11056
136 Ga0105248_10110762 3300009177 Bacteria 3096
137 Ga0105237_10028718 3300009545 Bacteria 5662
138 Ga0105237_10073224 3300009545 Unclassified 3418
139 Ga0105238_10000090 3300009551 Bacteria 102374
140 Ga0105238_10030926 3300009551 Bacteria 5448
141 Ga0105239_10030221 3300010375 Bacteria 5956
142 Ga0105239_10053030 3300010375 Unclassified 4448
143 Ga0157373_10003966 3300013100 Bacteria 11172
144 Ga0157373_10121584 3300013100 Unclassified 1835
145 Ga0157373_10145355 3300013100 Unclassified 1668
146 Ga0157373_10211355 3300013100 Bacteria 1368
147 Ga0157370_10046123 3300013104 Bacteria 4179
148 Ga0157370_10050395 3300013104 Bacteria 3980
149 Ga0157369_10000102 3300013105 Bacteria 118470
150 Ga0157369_10037172 3300013105 Bacteria 5331
151 Ga0157369_10169725 3300013105 Bacteria 2299
152 Ga0157369_10244075 3300013105 Unclassified 1875
153 Ga0157374_10000097 3300013296 Bacteria 81947
154 Ga0157374_10000567 3300013296 Bacteria 32753
155 Ga0157374_10008103 3300013296 Bacteria 8981
156 Ga0157374_10064698 3300013296 Bacteria 3433
157 Ga0157374_10162692 3300013296 Bacteria 2174
158 Ga0157374_10381338 3300013296 Bacteria 1404
159 Ga0157378_10000104 3300013297 Bacteria 80068
160 Ga0157378_10035666 3300013297 Bacteria 4400
161 Ga0157378_10112054 3300013297 Unclassified 2502
162 Ga0157378_10281113 3300013297 Bacteria 1604
163 Ga0163162_10033104 3300013306 Bacteria 5134
164 Ga0163162_10144795 3300013306 Bacteria 2491
165 Ga0157372_10000242 3300013307 Bacteria 60460
166 Ga0157372_10011058 3300013307 Bacteria 9603
167 Ga0157372_10019054 3300013307 Bacteria 7388
168 Ga0157372_10024135 3300013307 Bacteria 6601
169 Ga0157372_10043574 3300013307 Bacteria 4968
170 Ga0163163_10006440 3300014325 Bacteria 10266
171 Ga0163163_10011071 3300014325 Bacteria 8161
172 Ga0163163_10014046 3300014325 Bacteria 7350
173 Ga0163163_10040334 3300014325 Bacteria 4558
174 Ga0163163_10170167 3300014325 Unclassified 2225
175 Ga0182008_10010659 3300014497 Bacteria 4915
176 Ga0157377_10033355 3300014745 Bacteria 2810
177 Ga0157379_10003230 3300014968 Bacteria 13811
178 Ga0157376_10052580 3300014969 Bacteria 3388
179 Ga0182005_1031483 3300015265 Bacteria 1445
180 Ga0213875_10001723 3300021388 Bacteria 13718
181 Ga0213875_10040025 3300021388 Bacteria 2207
182 Ga0213875_10068316 3300021388 Bacteria 1660
183 Ga0228598_1001911 3300024227 Bacteria 4532
184 Ga0207692_10036607 3300025898 Bacteria 2395
185 Ga0207647_10013986 3300025904 Bacteria 5553
186 Ga0207699_10002271 3300025906 Bacteria 9068
187 Ga0207699_10163632 3300025906 Bacteria 1483
188 Ga0207684_10000238 3300025910 Bacteria 83165
189 Ga0207684_10281571 3300025910 Unclassified 1434
190 Ga0207654_10011997 3300025911 Unclassified 4431
191 Ga0207654_10014018 3300025911 Bacteria 4134
192 Ga0207654_10016355 3300025911 Bacteria 3861
193 Ga0207707_10000127 3300025912 Bacteria 78669
194 Ga0207707_10003926 3300025912 Bacteria 13204
195 Ga0207707_10005395 3300025912 Bacteria 11176
196 Ga0207695_10151931 3300025913 Bacteria 2254
197 Ga0207671_10030522 3300025914 Bacteria 4019
198 Ga0207693_10000044 3300025915 Bacteria 103362
199 Ga0207693_10000097 3300025915 Bacteria 77565
200 Ga0207693_10002115 3300025915 Bacteria 17334
201 Ga0207693_10010881 3300025915 Bacteria 7381
202 Ga0207693_10023063 3300025915 Bacteria 4943
203 Ga0207663_10001259 3300025916 Bacteria 11741
204 Ga0207663_10012407 3300025916 Bacteria 4607
205 Ga0207663_10021271 3300025916 Bacteria 3691
206 Ga0207663_10048593 3300025916 Bacteria 2627
207 Ga0207657_10002133 3300025919 Bacteria 21430
208 Ga0207652_10009977 3300025921 Bacteria 7647
209 Ga0207646_10000073 3300025922 Bacteria 140267
210 Ga0207646_10102439 3300025922 Unclassified 2566
211 Ga0207646_10137178 3300025922 Bacteria 2203
212 Ga0207646_10211102 3300025922 Bacteria 1753
213 Ga0207646_10225912 3300025922 Bacteria 1691
214 Ga0207694_10001306 3300025924 Bacteria 21454
215 Ga0207694_10130677 3300025924 Unclassified 2012
216 Ga0207650_10136024 3300025925 Unclassified 1927
217 Ga0207687_10012001 3300025927 Bacteria 5666
218 Ga0207687_10039975 3300025927 Bacteria 3213
219 Ga0207687_10051353 3300025927 Bacteria 2874
220 Ga0207687_10055658 3300025927 Bacteria 2772
221 Ga0207687_10060174 3300025927 Bacteria 2678
222 Ga0207700_10000227 3300025928 Bacteria 33670
223 Ga0207700_10001543 3300025928 Bacteria 13050
224 Ga0207700_10013278 3300025928 Bacteria 5352
225 Ga0207700_10249172 3300025928 Bacteria 1517
226 Ga0207664_10000033 3300025929 Bacteria 176549
227 Ga0207664_10001957 3300025929 Bacteria 13568
228 Ga0207664_10024628 3300025929 Bacteria 4523
229 Ga0207664_10078102 3300025929 Bacteria 2684
230 Ga0207690_10273035 3300025932 Unclassified 1314
231 Ga0207686_10014218 3300025934 Bacteria 4427
232 Ga0207665_10003463 3300025939 Bacteria 10538
233 Ga0207665_10088874 3300025939 Unclassified 2139
234 Ga0207711_10182110 3300025941 Bacteria 1911
235 Ga0207689_10001202 3300025942 Bacteria 24875
236 Ga0207661_10077904 3300025944 Bacteria 2727
237 Ga0207661_10177375 3300025944 Unclassified 1859
238 Ga0207667_10000606 3300025949 Bacteria 46386
239 Ga0207667_10007926 3300025949 Bacteria 12675
240 Ga0207640_10007504 3300025981 Bacteria 6023
241 Ga0207640_10044705 3300025981 Unclassified 2840
242 Ga0207658_10128031 3300025986 Unclassified 2035
243 Ga0207677_10125713 3300026023 Unclassified 1938
244 Ga0207677_10257166 3300026023 Bacteria 1421
245 Ga0207703_10008432 3300026035 Bacteria 8146
246 Ga0207703_10012487 3300026035 Bacteria 6621
247 Ga0207703_10063863 3300026035 Bacteria 3020
248 Ga0207703_10139034 3300026035 Bacteria 2106
249 Ga0207639_10040958 3300026041 Bacteria 3462
250 Ga0207702_10000704 3300026078 Bacteria 35989
251 Ga0207702_10003921 3300026078 Bacteria 13401
252 Ga0207648_10066028 3300026089 Unclassified 3155
253 Ga0207648_10080782 3300026089 Bacteria 2836
254 Ga0207648_10107281 3300026089 Bacteria 2451
255 Ga0207676_10005340 3300026095 Bacteria 9099
256 Ga0207674_10003843 3300026116 Bacteria 18304
257 Ga0207674_10004539 3300026116 Bacteria 16672
258 Ga0207674_10007983 3300026116 Bacteria 12281
259 Ga0268264_10013069 3300028381 Bacteria 6825
260 Ga0268264_10065298 3300028381 Bacteria 3066
261 Ga0265338_10002093 3300028800 Bacteria 30821
262 Ga0265338_10016154 3300028800 Bacteria 8143
263 Ga0265325_10020270 3300031241 Unclassified 3665
264 Ga0265340_10004947 3300031247 Bacteria 7408
265 Ga0265339_10010003 3300031249 Bacteria 5918
266 Ga0265316_10019848 3300031344 Bacteria 5738
267 Ga0265316_10130649 3300031344 Unclassified 1892
268 Ga0316575_10013032 3300031665 Bacteria 3103
269 Ga0265314_10003474 3300031711 Bacteria 15217
270 Ga0316576_10080580 3300031727 Unclassified 2415
271 Ga0316578_10006978 3300031728 Bacteria 5620
272 Ga0307406_10081975 3300031901 Unclassified 2147
273 Ga0373934_0021266 3300035086 Unclassified 2498
274 Ga0373936_0002818 3300035113 Bacteria 6481
275 Ga0373945_0004096 3300035116 Bacteria 4621
276 Ga0373954_0030058 3300035118 Unclassified 2504
277 Ga0373943_0000271 3300035170 Bacteria 21388
278 Ga0316574_0100426 3300035398 Bacteria 1852
279 Ga0373924_0005373 3300035410 Bacteria 4531
280 Ga0373935_0003844 3300035692 Bacteria 8761
281 Ga0373927_0000123 3300035695 Bacteria 58803
282 Ga0373927_0025725 3300035695 Unclassified 3848
283 Ga0373927_0034340 3300035695 Unclassified 3300
284 Ga0373927_0035736 3300035695 Bacteria 3231
285 Ga0373933_0051434 3300035724 Unclassified 2462
286 Ga0373947_0002530 3300035725 Bacteria 10990
287 Ga0373947_0129642 3300035725 Bacteria 1609
288 Ga0373937_0017282 3300036401 Bacteria 6423
289 Ga0373937_0064652 3300036401 Unclassified 3365
290 Ga0373937_0121491 3300036401 Bacteria 2434
291 Ga0373925_0000915 3300037068 Bacteria 26942
292 Ga0373925_0001131 3300037068 Bacteria 23661
293 Ga0373925_0036232 3300037068 Bacteria 3641
294 Ga0373925_0082939 3300037068 Unclassified 2441
295 Ga0373925_0367471 3300037068 Bacteria 1170
296 Ga0436364_0445685 3300037853 Bacteria 13579
297 Ga0436364_0786434 3300037853 Bacteria 2169
298 Ga0436363_0154368 3300039450 Bacteria 4376
299 Ga0436363_0612232 3300039450 Bacteria 8125
300 Ga0436362_0797808 3300039453 Unclassified 3003
301 Ga0466964_0019856 3300044706 Bacteria 2586
302 Ga0451576_0053184 3300045051 Unclassified 4243
303 Ga0466967_0025667 3300045976 Bacteria 4862
304 Ga0466967_0044496 3300045976 Bacteria 3851
305 Ga0495629_0124529 3300046459 Bacteria 1796
306 Ga0495580_0001485 3300046472 Bacteria 20582
307 Ga0495580_0010193 3300046472 Bacteria 7335
308 Ga0495580_0015576 3300046472 Bacteria 5731
309 Ga0495580_0028075 3300046472 Bacteria 4092
310 Ga0495582_0000877 3300046473 Bacteria 16673
311 Ga0495594_0077712 3300046499 Unclassified 1852
312 Ga0495628_0088621 3300046516 Bacteria 2398
313 Ga0495665_0016465 3300046531 Bacteria 3984
314 Ga0495645_0026894 3300046543 Bacteria 4179
315 Ga0495674_0032201 3300047319 Bacteria 4758
316 Ga0495675_0009964 3300047444 Bacteria 5926
317 Ga0495602_0083403 3300048088 Unclassified 2678
318 Ga0496100_0184830 3300048903 Unclassified 1509
319 Ga0496101_0185232 3300048904 Bacteria 1604
320 Ga0496102_0001608 3300048905 Bacteria 19914
321 Ga0496103_0006832 3300048906 Bacteria 6810
322 Ga0496103_0017166 3300048906 Bacteria 4328
323 Ga0496104_0052789 3300048907 Bacteria 3840
324 Ga0496106_0038344 3300048909 Bacteria 3585
325 Ga0496107_0094843 3300048910 Bacteria 2183
326 Ga0496108_0370934 3300048911 Unclassified 1249
327 Ga0496112_0010318 3300048915 Bacteria 8471
328 Ga0496112_0027058 3300048915 Bacteria 5529
329 Ga0496112_0240985 3300048915 Unclassified 1761
330 Ga0496112_0292543 3300048915 Bacteria 1574
331 Ga0501032_0047553 3300049569 Bacteria 2896
332 Ga0501032_0104212 3300049569 Unclassified 1879
333 Ga0501032_0133705 3300049569 Bacteria 1635
334 Ga0501033_0035362 3300049570 Bacteria 3745
335 Ga0501034_0090036 3300049571 Bacteria 3066
336 Ga0501034_0325389 3300049571 Unclassified 1469
337 Ga0501036_0014104 3300049572 Bacteria 6643
338 Ga0501038_0161662 3300049574 Bacteria 1819
339 Ga0501038_0162587 3300049574 Bacteria 1813
340 Ga0501039_0216893 3300049575 Bacteria 1504
341 Ga0501043_0058153 3300049579 Bacteria 3035
342 Ga0501046_0019319 3300049580 Bacteria 5653
343 Ga0501047_0114454 3300049581 Bacteria 2579
344 Ga0501067_0100800 3300049583 Bacteria 1604
345 Ga0501068_0022228 3300049584 Bacteria 3707
346 Ga0501074_0071326 3300049590 Bacteria 2497
347 Ga0501076_0276638 3300049592 Unclassified 1375
348 Ga0501080_0010622 3300049742 Bacteria 8429
349 Ga0501080_0089609 3300049742 Bacteria 2857
350 Ga0501083_0002489 3300049744 Bacteria 12636
351 Ga0501083_0081448 3300049744 Bacteria 2146
352 Ga0501044_0094648 3300049823 Bacteria 3011
353 Ga0501044_0258929 3300049823 Bacteria 1678
354 nmdc:mga05p37_60452_c1 3300050507 Bacteria 4665
355 nmdc:mga0n895_31_c1 3300050512 Bacteria 81579
356 nmdc:mga0n895_36500_c1 3300050512 Bacteria 4746
357 nmdc:mga0rr50_524_c1 3300050513 Bacteria 20451
358 nmdc:mga08x19_13899_c1 3300050514 Bacteria 4876
359 nmdc:mga08x19_36509_c1 3300050514 Unclassified 3113
360 nmdc:mga08x19_9756_c1 3300050514 Bacteria 5752
361 nmdc:mga0a205_136_c1 3300050515 Bacteria 46162
362 Ga0501082_0034318 3300060353 Bacteria 4375
363 Ga0495580_0004441
364 Ga0070676_10010004
365 Ga0070683_100011425
366 Ga0070683_100101504
367 Ga0070670_100009740
368 Ga0068869_100002113
369 Ga0068869_100165125
370 Ga0068868_100004078
371 Ga0068868_100013737
372 Ga0070661_100037555
373 Ga0070667_100282193
374 Ga0070709_10010323
375 Ga0070709_10016751
376 Ga0070709_10090513
377 Ga0070714_100000128
378 Ga0070714_100001298
379 Ga0070714_100001364
380 Ga0070713_100000133
381 Ga0070713_100001356
382 Ga0070713_100019779
383 Ga0070713_100072122
384 Ga0070713_100076354
385 Ga0070713_100077175
386 Ga0070713_100110904
387 Ga0070713_100111690
388 Ga0070713_100242848
389 Ga0070710_10003784
390 Ga0070710_10015129
391 Ga0070710_10043452
392 Ga0070711_100000189
393 Ga0070711_100005989
394 Ga0070708_100014435
395 Ga0070708_100025851
396 Ga0070708_100036944
397 Ga0070708_100083284
398 Ga0070708_100123344
399 Ga0070708_100158424
400 Ga0070708_100206347
401 Ga0070708_100254289
402 Ga0070678_100030993
403 Ga0070681_10000091
404 Ga0070681_10004214
405 Ga0070681_10263995
406 Ga0070681_10309021
407 Ga0068867_100007978
408 Ga0070706_100062814
409 Ga0070706_100207399
410 Ga0070707_100017398
411 Ga0070707_100112554
412 Ga0070707_100210667
413 Ga0070707_100299197
414 Ga0070707_100316624
415 Ga0070698_100427494
416 Ga0070699_100014922
417 Ga0070679_100014241
418 Ga0070679_100128748
419 Ga0070679_100260186
420 Ga0070684_100059249
421 Ga0068853_100038362
422 Ga0068855_100001496
423 Ga0068855_100003961
424 Ga0068855_100099937
425 Ga0068855_100212246
426 Ga0068855_100328458
427 Ga0070664_100000896
428 Ga0068857_100000994
429 Ga0068857_100003030
430 Ga0068857_100039568
431 Ga0068854_100003448
432 Ga0068854_100020942
433 Ga0068854_100033068
434 Ga0068856_100000252
435 Ga0068856_100009195
436 Ga0068856_100041001
437 Ga0068856_100070452
438 Ga0068852_100063293
439 Ga0068852_100160174
440 Ga0068859_100033819
441 Ga0068864_100002339
442 Ga0068864_100226556
443 Ga0068861_100185811
444 Ga0068851_10021068
445 Ga0068858_100000597
446 Ga0068858_100001669
447 Ga0068858_100004008
448 Ga0068858_100046351
449 Ga0068860_100029686
450 Ga0070717_10001834
451 Ga0070717_10005530
452 Ga0070717_10033848
453 Ga0070717_10080184
454 Ga0070717_10134889
455 Ga0070717_10154995
456 Ga0070715_10020823
457 Ga0070715_10049826
458 Ga0070716_100004231
459 Ga0070716_100078925
460 Ga0070716_100210379
461 Ga0070712_100000290
462 Ga0070712_100000843
463 Ga0070712_100003362
464 Ga0070712_100008291
465 Ga0070712_100022800
466 Ga0097621_100001438
467 Ga0097621_100002641
468 Ga0097621_100017459
469 Ga0068871_100040795
470 Ga0068871_100067612
471 Ga0068871_100189083
472 Ga0075433_10000824
473 Ga0075434_100000005
474 Ga0075434_100026274
475 Ga0068865_100021584
476 Ga0068865_100032540
477 Ga0075436_100003195
478 Ga0075436_100004595
479 Ga0075436_100083974
480 Ga0097620_100033819
481 Ga0075435_100000726
482 Ga0075435_100050198
483 Ga0099794_10021761
484 Ga0105240_10009266
485 Ga0105240_10032867
486 Ga0105240_10050355
487 Ga0105240_10081273
488 Ga0105245_10032011
489 Ga0105245_10067237
490 Ga0105245_10071386
491 Ga0114129_10453841
492 Ga0105241_10000531
493 Ga0105241_10006292
494 Ga0105241_10011537
495 Ga0105241_10028158
496 Ga0105242_10028072
497 Ga0105248_10008859
498 Ga0105248_10110762
499 Ga0105237_10028718
500 Ga0105237_10073224
501 Ga0105238_10000090
502 Ga0105238_10030926
503 Ga0105239_10030221
504 Ga0105239_10053030
505 Ga0157373_10003966
506 Ga0157373_10121584
507 Ga0157373_10145355
508 Ga0157373_10211355
509 Ga0157370_10046123
510 Ga0157370_10050395
511 Ga0157369_10000102
512 Ga0157369_10037172
513 Ga0157369_10169725
514 Ga0157369_10244075
515 Ga0157374_10000097
516 Ga0157374_10000567
517 Ga0157374_10008103
518 Ga0157374_10064698
519 Ga0157374_10162692
520 Ga0157374_10381338
521 Ga0157378_10000104
522 Ga0157378_10035666
523 Ga0157378_10112054
524 Ga0157378_10281113
525 Ga0163162_10033104
526 Ga0163162_10144795
527 Ga0157372_10000242
528 Ga0157372_10011058
529 Ga0157372_10019054
530 Ga0157372_10024135
531 Ga0157372_10043574
532 Ga0163163_10006440
533 Ga0163163_10011071
534 Ga0163163_10014046
535 Ga0163163_10040334
536 Ga0163163_10170167
537 Ga0182008_10010659
538 Ga0157377_10033355
539 Ga0157379_10003230
540 Ga0157376_10052580
541 Ga0182005_1031483
542 Ga0213875_10001723
543 Ga0213875_10040025
544 Ga0213875_10068316
545 Ga0228598_1001911
546 Ga0207692_10036607
547 Ga0207647_10013986
548 Ga0207699_10002271
549 Ga0207699_10163632
550 Ga0207684_10000238
551 Ga0207684_10281571
552 Ga0207654_10011997
553 Ga0207654_10014018
554 Ga0207654_10016355
555 Ga0207707_10000127
556 Ga0207707_10003926
557 Ga0207707_10005395
558 Ga0207695_10151931
559 Ga0207671_10030522
560 Ga0207693_10000044
561 Ga0207693_10000097
562 Ga0207693_10002115
563 Ga0207693_10010881
564 Ga0207693_10023063
565 Ga0207663_10001259
566 Ga0207663_10012407
567 Ga0207663_10021271
568 Ga0207663_10048593
569 Ga0207657_10002133
570 Ga0207652_10009977
571 Ga0207646_10000073
572 Ga0207646_10102439
573 Ga0207646_10137178
574 Ga0207646_10211102
575 Ga0207646_10225912
576 Ga0207694_10001306
577 Ga0207694_10130677
578 Ga0207650_10136024
579 Ga0207687_10012001
580 Ga0207687_10039975
581 Ga0207687_10051353
582 Ga0207687_10055658
583 Ga0207687_10060174
584 Ga0207700_10000227
585 Ga0207700_10001543
586 Ga0207700_10013278
587 Ga0207700_10249172
588 Ga0207664_10000033
589 Ga0207664_10001957
590 Ga0207664_10024628
591 Ga0207664_10078102
592 Ga0207690_10273035
593 Ga0207686_10014218
594 Ga0207665_10003463
595 Ga0207665_10088874
596 Ga0207711_10182110
597 Ga0207689_10001202
598 Ga0207661_10077904
599 Ga0207661_10177375
600 Ga0207667_10000606
601 Ga0207667_10007926
602 Ga0207640_10007504
603 Ga0207640_10044705
604 Ga0207658_10128031
605 Ga0207677_10125713
606 Ga0207677_10257166
607 Ga0207703_10008432
608 Ga0207703_10012487
609 Ga0207703_10063863
610 Ga0207703_10139034
611 Ga0207639_10040958
612 Ga0207702_10000704
613 Ga0207702_10003921
614 Ga0207648_10066028
615 Ga0207648_10080782
616 Ga0207648_10107281
617 Ga0207676_10005340
618 Ga0207674_10003843
619 Ga0207674_10004539
620 Ga0207674_10007983
621 Ga0268264_10013069
622 Ga0268264_10065298
623 Ga0265338_10002093
624 Ga0265338_10016154
625 Ga0265325_10020270
626 Ga0265340_10004947
627 Ga0265339_10010003
628 Ga0265316_10019848
629 Ga0265316_10130649
630 Ga0316575_10013032
631 Ga0265314_10003474
632 Ga0316576_10080580
633 Ga0316578_10006978
634 Ga0307406_10081975
635 Ga0373934_0021266
636 Ga0373936_0002818
637 Ga0373945_0004096
638 Ga0373954_0030058
639 Ga0373943_0000271
640 Ga0316574_0100426
641 Ga0373924_0005373
642 Ga0373935_0003844
643 Ga0373927_0000123
644 Ga0373927_0025725
645 Ga0373927_0034340
646 Ga0373927_0035736
647 Ga0373933_0051434
648 Ga0373947_0002530
649 Ga0373947_0129642
650 Ga0373937_0017282
651 Ga0373937_0064652
652 Ga0373937_0121491
653 Ga0373925_0000915
654 Ga0373925_0001131
655 Ga0373925_0036232
656 Ga0373925_0082939
657 Ga0373925_0367471
658 Ga0436364_0445685
659 Ga0436364_0786434
660 Ga0436363_0154368
661 Ga0436363_0612232
662 Ga0436362_0797808
663 Ga0466964_0019856
664 Ga0451576_0053184
665 Ga0466967_0025667
666 Ga0466967_0044496
667 Ga0495629_0124529
668 Ga0495580_0001485
669 Ga0495580_0010193
670 Ga0495580_0015576
671 Ga0495580_0028075
672 Ga0495582_0000877
673 Ga0495594_0077712
674 Ga0495628_0088621
675 Ga0495665_0016465
676 Ga0495645_0026894
677 Ga0495674_0032201
678 Ga0495675_0009964
679 Ga0495602_0083403
680 Ga0496100_0184830
681 Ga0496101_0185232
682 Ga0496102_0001608
683 Ga0496103_0006832
684 Ga0496103_0017166
685 Ga0496104_0052789
686 Ga0496106_0038344
687 Ga0496107_0094843
688 Ga0496108_0370934
689 Ga0496112_0010318
690 Ga0496112_0027058
691 Ga0496112_0240985
692 Ga0496112_0292543
693 Ga0501032_0047553
694 Ga0501032_0104212
695 Ga0501032_0133705
696 Ga0501033_0035362
697 Ga0501034_0090036
698 Ga0501034_0325389
699 Ga0501036_0014104
700 Ga0501038_0161662
701 Ga0501038_0162587
702 Ga0501039_0216893
703 Ga0501043_0058153
704 Ga0501046_0019319
705 Ga0501047_0114454
706 Ga0501067_0100800
707 Ga0501068_0022228
708 Ga0501074_0071326
709 Ga0501076_0276638
710 Ga0501080_0010622
711 Ga0501080_0089609
712 Ga0501083_0002489
713 Ga0501083_0081448
714 Ga0501044_0094648
715 Ga0501044_0258929
716 nmdc:mga05p37_60452_c1
717 nmdc:mga0n895_31_c1
718 nmdc:mga0n895_36500_c1
719 nmdc:mga0rr50_524_c1
720 nmdc:mga08x19_13899_c1
721 nmdc:mga08x19_36509_c1
722 nmdc:mga08x19_9756_c1
723 nmdc:mga0a205_136_c1
724 Ga0501082_0034318

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02684

LpxB

Lipid-A-disaccharide synthetase

47

293

0.95

PF02684

LpxB

Lipid-A-disaccharide synthetase

310

455

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vyy-assembly1.cif.gz_B the crystal structure of non-hydrolyzing udpglcnac 2-epimerase 0.7256 2 386
7vyy-assembly1.cif.gz_B the crystal structure of non-hydrolyzing udpglcnac 2-epimerase 0.7237 2 386
7vza-assembly1.cif.gz_E-2 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp 0.709 1 383
7vyy-assembly1.cif.gz_A the crystal structure of non-hydrolyzing udpglcnac 2-epimerase 0.7078 3 386
7vz6-assembly1.cif.gz_D-2 the crystal structure of non-hydrolyzing udpglcnac 2-epimerase in complex with udp-glucose 0.7074 2 383
ID Description Score Start End Superfamily
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8898 7 381 3.40.50.2000
af_P10441_9_377_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8831 7 381 3.40.50.2000
af_F4IF99_42_436_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8235 7 372 3.40.50.2000
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7276 182 359 3.40.50.2000
2iyaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7244 196 361 3.40.50.2000
ID Description Score Start End GO Terms
AF-Q1INL4-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9652 4 386 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A317HT13-F1-model_v4 deleted 0.9553 1 133
AF-A0A2S8K594-F1-model_v4 deleted 0.9538 1 169
AF-A0A4R1KQV6-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9532 4 387 GO:0005543
GO:0008915
GO:0009245
GO:0016020
AF-A0A3D4TCA9-F1-model_v4 Lipid-A-disaccharide synthase (EC 2.4.1.182) 0.9506 4 149 GO:0005543
GO:0008915
GO:0009245
GO:0016020

Map