F422298

General Info

Members Datasets Scaffolds Average Seq Length
361 157 722 229

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1094263|Ga0436365_1094263_1147_1920
Length 251
Sequence LNDLAAQGVLNQGELEQILGGVFMGMNLKSYARVLAIAGTITPAVFAADREIKVADRLDASAETLTEMMKASDKGIPHDLLDKARCVVVIPGMKKAGFIVAAKYGRGFAVCRRQSGMGWSAPAAMRVEGGSVGFQIGASETDIILLVMNEGGMKHLLSDKFTIGGDATGAAGPIGRELTAQTDATLKTEMLSYSRAHGLFAGISLDGATLRPDADTNRELYAGGTTGDIKTPASAMKFEHALDRESPVKEH

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
127 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.75
Metatranscriptomes 10.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0
Rhizosphere 99.17
Stem 0
Stem Tuber 0
Unclassified 31.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1094263 3300039437 Bacteria 3131
2 Ga0058863_11961407 3300004799 Bacteria 1158
3 Ga0058861_10931303 3300004800 Unclassified 1146
4 Ga0058862_12046379 3300004803 Bacteria 1014
5 Ga0070658_10022404 3300005327 Bacteria 5068
6 Ga0070658_10027745 3300005327 Unclassified 4544
7 Ga0070683_100008700 3300005329 Bacteria 8631
8 Ga0070683_100287227 3300005329 Unclassified 1565
9 Ga0068869_100889634 3300005334 Unclassified 770
10 Ga0070666_10008841 3300005335 Bacteria 6260
11 Ga0070680_100394293 3300005336 Bacteria 1179
12 Ga0070682_100129788 3300005337 Unclassified 1704
13 Ga0068868_100001712 3300005338 Bacteria 15012
14 Ga0068868_100104313 3300005338 Bacteria 2297
15 Ga0068868_100169589 3300005338 Bacteria 1806
16 Ga0070660_100010209 3300005339 Bacteria 6627
17 Ga0070691_10041741 3300005341 Bacteria 2169
18 Ga0070667_100026276 3300005367 Bacteria 4842
19 Ga0070709_10512447 3300005434 Bacteria 913
20 Ga0070714_100386133 3300005435 Bacteria 1321
21 Ga0070713_100031939 3300005436 Bacteria 4200
22 Ga0070710_10494669 3300005437 Bacteria 836
23 Ga0070711_100107133 3300005439 Unclassified 2045
24 Ga0070711_100197729 3300005439 Bacteria 1549
25 Ga0070663_100505423 3300005455 Bacteria 1004
26 Ga0070681_10011193 3300005458 Bacteria 8878
27 Ga0070681_10020793 3300005458 Bacteria 6575
28 Ga0070681_10036128 3300005458 Bacteria 4962
29 Ga0070681_10089054 3300005458 Bacteria 3037
30 Ga0070681_10136417 3300005458 Bacteria 2384
31 Ga0070681_10193933 3300005458 Bacteria 1950
32 Ga0070681_10259019 3300005458 Unclassified 1652
33 Ga0068867_100147280 3300005459 Unclassified 1847
34 Ga0070707_100757947 3300005468 Bacteria 934
35 Ga0070679_100030167 3300005530 Bacteria 5353
36 Ga0070679_100237123 3300005530 Bacteria 1782
37 Ga0070679_100404219 3300005530 Bacteria 1311
38 Ga0070684_100120843 3300005535 Unclassified 2356
39 Ga0070684_100144580 3300005535 Bacteria 2152
40 Ga0070684_100225691 3300005535 Bacteria 1709
41 Ga0068853_100070888 3300005539 Bacteria 3034
42 Ga0068853_100661542 3300005539 Unclassified 995
43 Ga0068853_100718060 3300005539 Unclassified 954
44 Ga0070693_100007418 3300005547 Bacteria 5361
45 Ga0070665_100010083 3300005548 Bacteria 9561
46 Ga0070665_100287078 3300005548 Bacteria 1647
47 Ga0068855_100003260 3300005563 Bacteria 19855
48 Ga0068855_100018356 3300005563 Bacteria 8403
49 Ga0068855_100033829 3300005563 Bacteria 6097
50 Ga0068855_100079785 3300005563 Bacteria 3795
51 Ga0068855_100081824 3300005563 Bacteria 3742
52 Ga0068855_100140518 3300005563 Unclassified 2753
53 Ga0068855_100345096 3300005563 Bacteria 1641
54 Ga0068855_100435174 3300005563 Bacteria 1433
55 Ga0068855_100686489 3300005563 Unclassified 1097
56 Ga0070664_100097012 3300005564 Bacteria 2559
57 Ga0070664_100203301 3300005564 Bacteria 1768
58 Ga0068857_100008051 3300005577 Bacteria 9090
59 Ga0068857_100008737 3300005577 Bacteria 8772
60 Ga0068857_100021162 3300005577 Bacteria 5723
61 Ga0068857_100035466 3300005577 Bacteria 4418
62 Ga0068856_100037797 3300005614 Unclassified 4737
63 Ga0068856_100053466 3300005614 Unclassified 3982
64 Ga0068856_100511311 3300005614 Unclassified 1222
65 Ga0068856_100837453 3300005614 Unclassified 939
66 Ga0068852_100006999 3300005616 Bacteria 8209
67 Ga0068852_100091124 3300005616 Bacteria 2728
68 Ga0068859_100070591 3300005617 Bacteria 3528
69 Ga0068859_101181706 3300005617 Unclassified 842
70 Ga0068864_100041595 3300005618 Bacteria 3931
71 Ga0068863_100033479 3300005841 Unclassified 4896
72 Ga0068863_100219264 3300005841 Bacteria 1832
73 Ga0068858_100020165 3300005842 Bacteria 6233
74 Ga0068858_100049631 3300005842 Bacteria 3886
75 Ga0068858_100092100 3300005842 Bacteria 2821
76 Ga0068860_100045187 3300005843 Bacteria 4199
77 Ga0068860_100210685 3300005843 Bacteria 1885
78 Ga0070717_10003231 3300006028 Bacteria 11640
79 Ga0097621_100044593 3300006237 Bacteria 3578
80 Ga0097621_100107107 3300006237 Bacteria 2358
81 Ga0097621_100122350 3300006237 Bacteria 2208
82 Ga0068871_100022907 3300006358 Bacteria 4821
83 Ga0068871_100073863 3300006358 Bacteria 2812
84 Ga0068871_100553879 3300006358 Unclassified 1042
85 Ga0068865_100026202 3300006881 Bacteria 3842
86 Ga0068865_100027314 3300006881 Bacteria 3769
87 Ga0097620_100070588 3300006931 Bacteria 3528
88 Ga0097620_101181653 3300006931 Unclassified 842
89 Ga0105240_10008037 3300009093 Bacteria 15182
90 Ga0105240_10018954 3300009093 Bacteria 9214
91 Ga0105240_10145284 3300009093 Unclassified 2831
92 Ga0105240_10156150 3300009093 Unclassified 2713
93 Ga0105240_10187137 3300009093 Bacteria 2438
94 Ga0105240_10554369 3300009093 Unclassified 1271
95 Ga0105240_10698405 3300009093 Bacteria 1108
96 Ga0105245_10002433 3300009098 Bacteria 16849
97 Ga0105245_10005126 3300009098 Bacteria 11513
98 Ga0105245_10010337 3300009098 Bacteria 8130
99 Ga0105245_10015676 3300009098 Bacteria 6608
100 Ga0105245_10026070 3300009098 Bacteria 5144
101 Ga0105245_10052648 3300009098 Unclassified 3651
102 Ga0105245_10228696 3300009098 Bacteria 1798
103 Ga0105245_10624257 3300009098 Bacteria 1106
104 Ga0105247_10033163 3300009101 Bacteria 3139
105 Ga0105247_10568532 3300009101 Unclassified 836
106 Ga0105243_10424412 3300009148 Bacteria 1241
107 Ga0105241_10086814 3300009174 Unclassified 2461
108 Ga0105241_10191571 3300009174 Bacteria 1702
109 Ga0105241_10234306 3300009174 Unclassified 1549
110 Ga0105242_10069493 3300009176 Bacteria 2917
111 Ga0105242_10096055 3300009176 Bacteria 2503
112 Ga0105242_10154559 3300009176 Unclassified 2003
113 Ga0105242_10165563 3300009176 Bacteria 1939
114 Ga0105242_10338581 3300009176 Bacteria 1386
115 Ga0105248_10025290 3300009177 Bacteria 6601
116 Ga0105248_10125648 3300009177 Bacteria 2894
117 Ga0105248_10148713 3300009177 Unclassified 2643
118 Ga0105248_10172663 3300009177 Bacteria 2437
119 Ga0105248_10205692 3300009177 Bacteria 2218
120 Ga0105248_11305290 3300009177 Unclassified 821
121 Ga0105237_10003231 3300009545 Bacteria 19491
122 Ga0105237_10018922 3300009545 Bacteria 7119
123 Ga0105237_10042967 3300009545 Unclassified 4555
124 Ga0105237_10043895 3300009545 Bacteria 4502
125 Ga0105237_10054332 3300009545 Unclassified 4013
126 Ga0105237_10097170 3300009545 Bacteria 2935
127 Ga0105237_10316613 3300009545 Bacteria 1563
128 Ga0105237_10672398 3300009545 Bacteria 1042
129 Ga0105238_10002276 3300009551 Bacteria 19349
130 Ga0105238_10016492 3300009551 Bacteria 7477
131 Ga0105238_10038258 3300009551 Unclassified 4872
132 Ga0105238_10046113 3300009551 Unclassified 4401
133 Ga0105238_10100906 3300009551 Unclassified 2869
134 Ga0105249_10007342 3300009553 Bacteria 9607
135 Ga0105239_10009588 3300010375 Bacteria 10891
136 Ga0105239_10012990 3300010375 Bacteria 9264
137 Ga0105239_10032963 3300010375 Bacteria 5691
138 Ga0105239_10079297 3300010375 Bacteria 3613
139 Ga0157370_10003674 3300013104 Bacteria 17919
140 Ga0157370_10012618 3300013104 Bacteria 8755
141 Ga0157370_10036798 3300013104 Unclassified 4748
142 Ga0157370_10542334 3300013104 Unclassified 1067
143 Ga0157370_10657762 3300013104 Unclassified 957
144 Ga0157369_10011055 3300013105 Bacteria 10271
145 Ga0157369_10012914 3300013105 Bacteria 9466
146 Ga0157369_10029090 3300013105 Bacteria 6108
147 Ga0157369_10151875 3300013105 Bacteria 2448
148 Ga0157369_10160682 3300013105 Bacteria 2371
149 Ga0157369_10309807 3300013105 Bacteria 1642
150 Ga0157369_10539205 3300013105 Bacteria 1206
151 Ga0157374_10020694 3300013296 Bacteria 5841
152 Ga0157374_10062758 3300013296 Bacteria 3484
153 Ga0157374_10119275 3300013296 Bacteria 2545
154 Ga0157374_10251649 3300013296 Unclassified 1739
155 Ga0157374_10415344 3300013296 Bacteria 1344
156 Ga0157378_10013102 3300013297 Bacteria 7254
157 Ga0163162_10001848 3300013306 Bacteria 19926
158 Ga0163162_10048771 3300013306 Bacteria 4243
159 Ga0163162_10065117 3300013306 Unclassified 3691
160 Ga0163162_10194702 3300013306 Bacteria 2155
161 Ga0163162_10411590 3300013306 Unclassified 1485
162 Ga0157372_10019367 3300013307 Bacteria 7333
163 Ga0157372_10053444 3300013307 Unclassified 4502
164 Ga0157372_10112833 3300013307 Unclassified 3115
165 Ga0157372_10187460 3300013307 Bacteria 2395
166 Ga0157372_10381406 3300013307 Unclassified 1642
167 Ga0157375_10005440 3300013308 Bacteria 11072
168 Ga0157375_10055172 3300013308 Unclassified 3917
169 Ga0163163_10003894 3300014325 Bacteria 12725
170 Ga0163163_10004958 3300014325 Bacteria 11455
171 Ga0163163_10043466 3300014325 Bacteria 4405
172 Ga0163163_10095276 3300014325 Bacteria 2996
173 Ga0163163_10130542 3300014325 Bacteria 2552
174 Ga0163163_10164873 3300014325 Bacteria 2262
175 Ga0157379_10231591 3300014968 Bacteria 1674
176 Ga0157379_10668346 3300014968 Unclassified 973
177 Ga0157376_10023450 3300014969 Bacteria 4829
178 Ga0157376_10037727 3300014969 Bacteria 3926
179 Ga0157376_10277626 3300014969 Bacteria 1577
180 Ga0157376_10445386 3300014969 Bacteria 1262
181 Ga0184598_140489 3300019182 Unclassified 1222
182 Ga0184599_131657 3300019188 Unclassified 1546
183 Ga0184600_109838 3300019190 Unclassified 920
184 Ga0184600_136517 3300019190 Bacteria 1433
185 Ga0184600_143208 3300019190 Unclassified 1233
186 Ga0184603_123930 3300019192 Bacteria 1861
187 Ga0197907_10513497 3300020069 Bacteria 1781
188 Ga0206356_11227259 3300020070 Unclassified 780
189 Ga0206352_10778193 3300020078 Bacteria 734
190 Ga0213871_10011061 3300021441 Bacteria 2063
191 Ga0224712_10041468 3300022467 Bacteria 1738
192 Ga0247554_100209 3300023547 Unclassified 1523
193 Ga0247553_100250 3300023672 Bacteria 1827
194 Ga0207692_10255896 3300025898 Bacteria 1051
195 Ga0207710_10034113 3300025900 Bacteria 2235
196 Ga0207680_10058775 3300025903 Bacteria 2332
197 Ga0207705_10106540 3300025909 Bacteria 2067
198 Ga0207705_10163674 3300025909 Bacteria 1672
199 Ga0207654_10275650 3300025911 Bacteria 1136
200 Ga0207707_10001236 3300025912 Bacteria 23977
201 Ga0207707_10045979 3300025912 Bacteria 3802
202 Ga0207707_10260017 3300025912 Bacteria 1506
203 Ga0207707_10354130 3300025912 Unclassified 1264
204 Ga0207707_10621577 3300025912 Bacteria 913
205 Ga0207695_10025831 3300025913 Bacteria 6566
206 Ga0207695_10033014 3300025913 Bacteria 5655
207 Ga0207695_10042401 3300025913 Bacteria 4861
208 Ga0207695_10525463 3300025913 Unclassified 1065
209 Ga0207695_10577660 3300025913 Bacteria 1005
210 Ga0207671_10041640 3300025914 Bacteria 3399
211 Ga0207671_10046082 3300025914 Bacteria 3225
212 Ga0207671_10181131 3300025914 Unclassified 1640
213 Ga0207671_10234632 3300025914 Bacteria 1440
214 Ga0207671_10362004 3300025914 Bacteria 1151
215 Ga0207660_10659551 3300025917 Unclassified 853
216 Ga0207657_10006644 3300025919 Bacteria 11969
217 Ga0207652_10028026 3300025921 Bacteria 4696
218 Ga0207652_10290423 3300025921 Bacteria 1475
219 Ga0207646_10236925 3300025922 Bacteria 1649
220 Ga0207694_10003194 3300025924 Bacteria 13070
221 Ga0207694_10005744 3300025924 Bacteria 9506
222 Ga0207694_10091797 3300025924 Unclassified 2396
223 Ga0207694_10125545 3300025924 Bacteria 2052
224 Ga0207694_10134350 3300025924 Unclassified 1985
225 Ga0207694_10235755 3300025924 Bacteria 1495
226 Ga0207687_10006365 3300025927 Bacteria 7802
227 Ga0207687_10060229 3300025927 Bacteria 2677
228 Ga0207687_10178130 3300025927 Unclassified 1645
229 Ga0207687_10560279 3300025927 Unclassified 959
230 Ga0207687_10699720 3300025927 Unclassified 860
231 Ga0207700_10218495 3300025928 Unclassified 1614
232 Ga0207700_10475815 3300025928 Unclassified 1103
233 Ga0207686_10005399 3300025934 Bacteria 6853
234 Ga0207686_10104447 3300025934 Bacteria 1898
235 Ga0207686_10142932 3300025934 Bacteria 1656
236 Ga0207704_10007428 3300025938 Bacteria 5176
237 Ga0207711_10007039 3300025941 Bacteria 9421
238 Ga0207711_10078027 3300025941 Unclassified 2888
239 Ga0207661_10022499 3300025944 Unclassified 4750
240 Ga0207661_10033393 3300025944 Bacteria 3993
241 Ga0207661_10119127 3300025944 Bacteria 2245
242 Ga0207661_10552261 3300025944 Unclassified 1055
243 Ga0207679_10069728 3300025945 Bacteria 2647
244 Ga0207679_10340880 3300025945 Bacteria 1303
245 Ga0207667_10027366 3300025949 Bacteria 6207
246 Ga0207667_10029011 3300025949 Bacteria 6005
247 Ga0207667_10122842 3300025949 Bacteria 2675
248 Ga0207667_10691962 3300025949 Unclassified 1022
249 Ga0207712_10050271 3300025961 Bacteria 2910
250 Ga0207712_10092558 3300025961 Bacteria 2229
251 Ga0207658_10094658 3300025986 Bacteria 2325
252 Ga0207677_10094113 3300026023 Bacteria 2186
253 Ga0207677_10176445 3300026023 Bacteria 1676
254 Ga0207677_10601232 3300026023 Bacteria 965
255 Ga0207703_10005850 3300026035 Bacteria 9848
256 Ga0207703_10042668 3300026035 Bacteria 3639
257 Ga0207703_10156560 3300026035 Unclassified 1992
258 Ga0207703_10524270 3300026035 Bacteria 1115
259 Ga0207639_10115400 3300026041 Bacteria 2196
260 Ga0207639_10655378 3300026041 Bacteria 971
261 Ga0207702_10036651 3300026078 Unclassified 4103
262 Ga0207702_10102429 3300026078 Bacteria 2530
263 Ga0207702_10117093 3300026078 Unclassified 2379
264 Ga0207702_10277116 3300026078 Unclassified 1584
265 Ga0207702_10565889 3300026078 Unclassified 1113
266 Ga0207702_10616754 3300026078 Bacteria 1065
267 Ga0207702_10639761 3300026078 Bacteria 1045
268 Ga0207641_10029523 3300026088 Unclassified 4536
269 Ga0207641_10102534 3300026088 Bacteria 2523
270 Ga0207641_10995171 3300026088 Unclassified 835
271 Ga0207648_10013416 3300026089 Bacteria 7626
272 Ga0207648_10065596 3300026089 Bacteria 3165
273 Ga0207676_10059427 3300026095 Unclassified 3019
274 Ga0207676_10480136 3300026095 Unclassified 1177
275 Ga0207674_10001790 3300026116 Bacteria 27420
276 Ga0207674_10017870 3300026116 Bacteria 7730
277 Ga0207674_10072129 3300026116 Bacteria 3469
278 Ga0207674_10078283 3300026116 Bacteria 3311
279 Ga0207698_10266079 3300026142 Unclassified 1578
280 Ga0268264_10007357 3300028381 Bacteria 9196
281 Ga0265338_10289075 3300028800 Bacteria 1195
282 Ga0265338_10433674 3300028800 Bacteria 932
283 Ga0265324_10006307 3300029957 Unclassified 4974
284 Ga0265775_103853 3300030762 Bacteria 824
285 Ga0265777_101624 3300030877 Bacteria 1226
286 Ga0265777_104845 3300030877 Unclassified 873
287 Ga0265777_106509 3300030877 Unclassified 798
288 Ga0265777_107282 3300030877 Bacteria 769
289 Ga0265779_101044 3300031043 Bacteria 1161
290 Ga0265760_10045326 3300031090 Unclassified 1317
291 Ga0265332_10085422 3300031238 Bacteria 1337
292 Ga0265328_10050897 3300031239 Unclassified 1521
293 Ga0265320_10000779 3300031240 Bacteria 24375
294 Ga0265325_10001705 3300031241 Bacteria 15283
295 Ga0265325_10047172 3300031241 Unclassified 2231
296 Ga0265325_10078391 3300031241 Bacteria 1646
297 Ga0265329_10008974 3300031242 Unclassified 3758
298 Ga0265339_10049867 3300031249 Unclassified 2291
299 Ga0265331_10003601 3300031250 Bacteria 9924
300 Ga0265331_10117021 3300031250 Unclassified 1220
301 Ga0265316_10001298 3300031344 Bacteria 26881
302 Ga0265316_10007261 3300031344 Bacteria 10457
303 Ga0265316_10197842 3300031344 Bacteria 1491
304 Ga0265316_10333756 3300031344 Unclassified 1100
305 Ga0310117_109268 3300031592 Bacteria 1046
306 Ga0265313_10061234 3300031595 Bacteria 1762
307 Ga0265313_10112129 3300031595 Bacteria 1198
308 Ga0265314_10001835 3300031711 Bacteria 22830
309 Ga0265314_10005185 3300031711 Bacteria 11831
310 Ga0265314_10266275 3300031711 Bacteria 976
311 Ga0265342_10020418 3300031712 Unclassified 4249
312 Ga0316053_100463 3300032120 Bacteria 1867
313 Ga0373934_0006803 3300035086 Bacteria 4246
314 Ga0373953_0004738 3300035117 Unclassified 4361
315 Ga0373954_0010480 3300035118 Bacteria 4090
316 Ga0373946_0282990 3300035171 Unclassified 816
317 Ga0373955_0309569 3300035172 Unclassified 953
318 Ga0373931_0288011 3300035691 Archaea 1011
319 Ga0373935_0044987 3300035692 Bacteria 2784
320 Ga0373927_0001625 3300035695 Bacteria 16846
321 Ga0373947_0035533 3300035725 Bacteria 2950
322 Ga0373937_0014919 3300036401 Bacteria 6864
323 Ga0373937_0342278 3300036401 Unclassified 1416
324 Ga0265778_001259 3300036457 Bacteria 2270
325 Ga0265778_003139 3300036457 Bacteria 1650
326 Ga0265778_004236 3300036457 Unclassified 1479
327 Ga0265778_005463 3300036457 Unclassified 1345
328 Ga0265778_005593 3300036457 Bacteria 1334
329 Ga0265778_006407 3300036457 Bacteria 1267
330 Ga0265778_006637 3300036457 Unclassified 1251
331 Ga0265778_007714 3300036457 Unclassified 1186
332 Ga0265778_015077 3300036457 Bacteria 917
333 Ga0265778_015431 3300036457 Bacteria 908
334 Ga0265778_020314 3300036457 Unclassified 817
335 Ga0265778_022756 3300036457 Bacteria 781
336 Ga0265778_025844 3300036457 Unclassified 743
337 Ga0373925_0066891 3300037068 Bacteria 2709
338 Ga0373925_0356552 3300037068 Unclassified 1188
339 Ga0466970_0260482 3300044765 Unclassified 973
340 Ga0466967_0164423 3300045976 Bacteria 2085
341 Ga0495651_0417035 3300046462 Unclassified 873
342 Ga0495651_0550497 3300046462 Unclassified 733
343 Ga0495580_0002841 3300046472 Bacteria 14894
344 Ga0495580_0235321 3300046472 Unclassified 1256
345 Ga0495639_0195444 3300046475 Unclassified 989
346 Ga0495664_0054244 3300046477 Bacteria 2384
347 Ga0495594_0216912 3300046499 Unclassified 1091
348 Ga0495586_0259209 3300046535 Bacteria 993
349 Ga0495587_0067746 3300046536 Unclassified 2080
350 Ga0495633_0136866 3300046558 Bacteria 1133
351 Ga0495667_0224834 3300046559 Bacteria 1197
352 Ga0495599_0064865 3300046678 Bacteria 2282
353 Ga0495599_0158626 3300046678 Unclassified 1399
354 Ga0495604_0388420 3300047317 Unclassified 921
355 Ga0495675_0282759 3300047444 Unclassified 989
356 Ga0495684_0021708 3300047471 Unclassified 4943
357 Ga0495684_0586609 3300047471 Bacteria 754
358 Ga0495602_0115227 3300048088 Bacteria 2175
359 Ga0495602_0124824 3300048088 Unclassified 2064
360 Ga0501083_0327974 3300049744 Unclassified 995
361 Ga0500616_0000172 3300053153 Bacteria 107729
362 Ga0436365_1094263
363 Ga0058863_11961407
364 Ga0058861_10931303
365 Ga0058862_12046379
366 Ga0070658_10022404
367 Ga0070658_10027745
368 Ga0070683_100008700
369 Ga0070683_100287227
370 Ga0068869_100889634
371 Ga0070666_10008841
372 Ga0070680_100394293
373 Ga0070682_100129788
374 Ga0068868_100001712
375 Ga0068868_100104313
376 Ga0068868_100169589
377 Ga0070660_100010209
378 Ga0070691_10041741
379 Ga0070667_100026276
380 Ga0070709_10512447
381 Ga0070714_100386133
382 Ga0070713_100031939
383 Ga0070710_10494669
384 Ga0070711_100107133
385 Ga0070711_100197729
386 Ga0070663_100505423
387 Ga0070681_10011193
388 Ga0070681_10020793
389 Ga0070681_10036128
390 Ga0070681_10089054
391 Ga0070681_10136417
392 Ga0070681_10193933
393 Ga0070681_10259019
394 Ga0068867_100147280
395 Ga0070707_100757947
396 Ga0070679_100030167
397 Ga0070679_100237123
398 Ga0070679_100404219
399 Ga0070684_100120843
400 Ga0070684_100144580
401 Ga0070684_100225691
402 Ga0068853_100070888
403 Ga0068853_100661542
404 Ga0068853_100718060
405 Ga0070693_100007418
406 Ga0070665_100010083
407 Ga0070665_100287078
408 Ga0068855_100003260
409 Ga0068855_100018356
410 Ga0068855_100033829
411 Ga0068855_100079785
412 Ga0068855_100081824
413 Ga0068855_100140518
414 Ga0068855_100345096
415 Ga0068855_100435174
416 Ga0068855_100686489
417 Ga0070664_100097012
418 Ga0070664_100203301
419 Ga0068857_100008051
420 Ga0068857_100008737
421 Ga0068857_100021162
422 Ga0068857_100035466
423 Ga0068856_100037797
424 Ga0068856_100053466
425 Ga0068856_100511311
426 Ga0068856_100837453
427 Ga0068852_100006999
428 Ga0068852_100091124
429 Ga0068859_100070591
430 Ga0068859_101181706
431 Ga0068864_100041595
432 Ga0068863_100033479
433 Ga0068863_100219264
434 Ga0068858_100020165
435 Ga0068858_100049631
436 Ga0068858_100092100
437 Ga0068860_100045187
438 Ga0068860_100210685
439 Ga0070717_10003231
440 Ga0097621_100044593
441 Ga0097621_100107107
442 Ga0097621_100122350
443 Ga0068871_100022907
444 Ga0068871_100073863
445 Ga0068871_100553879
446 Ga0068865_100026202
447 Ga0068865_100027314
448 Ga0097620_100070588
449 Ga0097620_101181653
450 Ga0105240_10008037
451 Ga0105240_10018954
452 Ga0105240_10145284
453 Ga0105240_10156150
454 Ga0105240_10187137
455 Ga0105240_10554369
456 Ga0105240_10698405
457 Ga0105245_10002433
458 Ga0105245_10005126
459 Ga0105245_10010337
460 Ga0105245_10015676
461 Ga0105245_10026070
462 Ga0105245_10052648
463 Ga0105245_10228696
464 Ga0105245_10624257
465 Ga0105247_10033163
466 Ga0105247_10568532
467 Ga0105243_10424412
468 Ga0105241_10086814
469 Ga0105241_10191571
470 Ga0105241_10234306
471 Ga0105242_10069493
472 Ga0105242_10096055
473 Ga0105242_10154559
474 Ga0105242_10165563
475 Ga0105242_10338581
476 Ga0105248_10025290
477 Ga0105248_10125648
478 Ga0105248_10148713
479 Ga0105248_10172663
480 Ga0105248_10205692
481 Ga0105248_11305290
482 Ga0105237_10003231
483 Ga0105237_10018922
484 Ga0105237_10042967
485 Ga0105237_10043895
486 Ga0105237_10054332
487 Ga0105237_10097170
488 Ga0105237_10316613
489 Ga0105237_10672398
490 Ga0105238_10002276
491 Ga0105238_10016492
492 Ga0105238_10038258
493 Ga0105238_10046113
494 Ga0105238_10100906
495 Ga0105249_10007342
496 Ga0105239_10009588
497 Ga0105239_10012990
498 Ga0105239_10032963
499 Ga0105239_10079297
500 Ga0157370_10003674
501 Ga0157370_10012618
502 Ga0157370_10036798
503 Ga0157370_10542334
504 Ga0157370_10657762
505 Ga0157369_10011055
506 Ga0157369_10012914
507 Ga0157369_10029090
508 Ga0157369_10151875
509 Ga0157369_10160682
510 Ga0157369_10309807
511 Ga0157369_10539205
512 Ga0157374_10020694
513 Ga0157374_10062758
514 Ga0157374_10119275
515 Ga0157374_10251649
516 Ga0157374_10415344
517 Ga0157378_10013102
518 Ga0163162_10001848
519 Ga0163162_10048771
520 Ga0163162_10065117
521 Ga0163162_10194702
522 Ga0163162_10411590
523 Ga0157372_10019367
524 Ga0157372_10053444
525 Ga0157372_10112833
526 Ga0157372_10187460
527 Ga0157372_10381406
528 Ga0157375_10005440
529 Ga0157375_10055172
530 Ga0163163_10003894
531 Ga0163163_10004958
532 Ga0163163_10043466
533 Ga0163163_10095276
534 Ga0163163_10130542
535 Ga0163163_10164873
536 Ga0157379_10231591
537 Ga0157379_10668346
538 Ga0157376_10023450
539 Ga0157376_10037727
540 Ga0157376_10277626
541 Ga0157376_10445386
542 Ga0184598_140489
543 Ga0184599_131657
544 Ga0184600_109838
545 Ga0184600_136517
546 Ga0184600_143208
547 Ga0184603_123930
548 Ga0197907_10513497
549 Ga0206356_11227259
550 Ga0206352_10778193
551 Ga0213871_10011061
552 Ga0224712_10041468
553 Ga0247554_100209
554 Ga0247553_100250
555 Ga0207692_10255896
556 Ga0207710_10034113
557 Ga0207680_10058775
558 Ga0207705_10106540
559 Ga0207705_10163674
560 Ga0207654_10275650
561 Ga0207707_10001236
562 Ga0207707_10045979
563 Ga0207707_10260017
564 Ga0207707_10354130
565 Ga0207707_10621577
566 Ga0207695_10025831
567 Ga0207695_10033014
568 Ga0207695_10042401
569 Ga0207695_10525463
570 Ga0207695_10577660
571 Ga0207671_10041640
572 Ga0207671_10046082
573 Ga0207671_10181131
574 Ga0207671_10234632
575 Ga0207671_10362004
576 Ga0207660_10659551
577 Ga0207657_10006644
578 Ga0207652_10028026
579 Ga0207652_10290423
580 Ga0207646_10236925
581 Ga0207694_10003194
582 Ga0207694_10005744
583 Ga0207694_10091797
584 Ga0207694_10125545
585 Ga0207694_10134350
586 Ga0207694_10235755
587 Ga0207687_10006365
588 Ga0207687_10060229
589 Ga0207687_10178130
590 Ga0207687_10560279
591 Ga0207687_10699720
592 Ga0207700_10218495
593 Ga0207700_10475815
594 Ga0207686_10005399
595 Ga0207686_10104447
596 Ga0207686_10142932
597 Ga0207704_10007428
598 Ga0207711_10007039
599 Ga0207711_10078027
600 Ga0207661_10022499
601 Ga0207661_10033393
602 Ga0207661_10119127
603 Ga0207661_10552261
604 Ga0207679_10069728
605 Ga0207679_10340880
606 Ga0207667_10027366
607 Ga0207667_10029011
608 Ga0207667_10122842
609 Ga0207667_10691962
610 Ga0207712_10050271
611 Ga0207712_10092558
612 Ga0207658_10094658
613 Ga0207677_10094113
614 Ga0207677_10176445
615 Ga0207677_10601232
616 Ga0207703_10005850
617 Ga0207703_10042668
618 Ga0207703_10156560
619 Ga0207703_10524270
620 Ga0207639_10115400
621 Ga0207639_10655378
622 Ga0207702_10036651
623 Ga0207702_10102429
624 Ga0207702_10117093
625 Ga0207702_10277116
626 Ga0207702_10565889
627 Ga0207702_10616754
628 Ga0207702_10639761
629 Ga0207641_10029523
630 Ga0207641_10102534
631 Ga0207641_10995171
632 Ga0207648_10013416
633 Ga0207648_10065596
634 Ga0207676_10059427
635 Ga0207676_10480136
636 Ga0207674_10001790
637 Ga0207674_10017870
638 Ga0207674_10072129
639 Ga0207674_10078283
640 Ga0207698_10266079
641 Ga0268264_10007357
642 Ga0265338_10289075
643 Ga0265338_10433674
644 Ga0265324_10006307
645 Ga0265775_103853
646 Ga0265777_101624
647 Ga0265777_104845
648 Ga0265777_106509
649 Ga0265777_107282
650 Ga0265779_101044
651 Ga0265760_10045326
652 Ga0265332_10085422
653 Ga0265328_10050897
654 Ga0265320_10000779
655 Ga0265325_10001705
656 Ga0265325_10047172
657 Ga0265325_10078391
658 Ga0265329_10008974
659 Ga0265339_10049867
660 Ga0265331_10003601
661 Ga0265331_10117021
662 Ga0265316_10001298
663 Ga0265316_10007261
664 Ga0265316_10197842
665 Ga0265316_10333756
666 Ga0310117_109268
667 Ga0265313_10061234
668 Ga0265313_10112129
669 Ga0265314_10001835
670 Ga0265314_10005185
671 Ga0265314_10266275
672 Ga0265342_10020418
673 Ga0316053_100463
674 Ga0373934_0006803
675 Ga0373953_0004738
676 Ga0373954_0010480
677 Ga0373946_0282990
678 Ga0373955_0309569
679 Ga0373931_0288011
680 Ga0373935_0044987
681 Ga0373927_0001625
682 Ga0373947_0035533
683 Ga0373937_0014919
684 Ga0373937_0342278
685 Ga0265778_001259
686 Ga0265778_003139
687 Ga0265778_004236
688 Ga0265778_005463
689 Ga0265778_005593
690 Ga0265778_006407
691 Ga0265778_006637
692 Ga0265778_007714
693 Ga0265778_015077
694 Ga0265778_015431
695 Ga0265778_020314
696 Ga0265778_022756
697 Ga0265778_025844
698 Ga0373925_0066891
699 Ga0373925_0356552
700 Ga0466970_0260482
701 Ga0466967_0164423
702 Ga0495651_0417035
703 Ga0495651_0550497
704 Ga0495580_0002841
705 Ga0495580_0235321
706 Ga0495639_0195444
707 Ga0495664_0054244
708 Ga0495594_0216912
709 Ga0495586_0259209
710 Ga0495587_0067746
711 Ga0495633_0136866
712 Ga0495667_0224834
713 Ga0495599_0064865
714 Ga0495599_0158626
715 Ga0495604_0388420
716 Ga0495675_0282759
717 Ga0495684_0021708
718 Ga0495684_0586609
719 Ga0495602_0115227
720 Ga0495602_0124824
721 Ga0501083_0327974
722 Ga0500616_0000172

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04366

Ysc84

Las17-binding protein actin regulator

128

244

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.701 22 184
7ofn-assembly1.cif.gz_A nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 0.6826 22 184
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.6287 25 186
5uc0-assembly1.cif.gz_A crystal structure of beta-barrel-like, uncharacterized protein of cog5400 from brucella abortus 0.5198 55 184
7rfq-assembly1.cif.gz_A structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) 0.4766 25 186
ID Description Score Start End Superfamily
af_Q9GPT6_24_328_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6117 56 97 3.40.50.300
af_Q0P424_16_257_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.5786 56 99 3.40.50.300
af_Q1LXC9_1_246_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.54 15 54 1.25.40.180
af_G5EBZ8_106_381_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4602 62 100 1.10.510.10
af_P47042_168_280_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4414 62 106 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A2W0AZ58-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9037 21 222 GO:0035091
AF-A0A1F2RLU0-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9024 25 227 GO:0035091
AF-A0A2V9ZXT5-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9018 25 224 GO:0035091
AF-A0A1Q6XHR1-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9017 26 223 GO:0035091
AF-A0A2V9VGL0-F1-model_v4 Ysc84 actin-binding domain-containing protein 0.9005 26 223 GO:0035091

Map