F422298
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 361 | 157 | 722 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_1094263|Ga0436365_1094263_1147_1920 |
| Length | 251 |
| Sequence | LNDLAAQGVLNQGELEQILGGVFMGMNLKSYARVLAIAGTITPAVFAADREIKVADRLDASAETLTEMMKASDKGIPHDLLDKARCVVVIPGMKKAGFIVAAKYGRGFAVCRRQSGMGWSAPAAMRVEGGSVGFQIGASETDIILLVMNEGGMKHLLSDKFTIGGDATGAAGPIGRELTAQTDATLKTEMLSYSRAHGLFAGISLDGATLRPDADTNRELYAGGTTGDIKTPASAMKFEHALDRESPVKEH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 68 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 73 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300023547 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 120 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 124 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 131 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.75 |
| Metatranscriptomes | 10.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436365_1094263 | 3300039437 | Bacteria | 3131 |
| 2 | Ga0058863_11961407 | 3300004799 | Bacteria | 1158 |
| 3 | Ga0058861_10931303 | 3300004800 | Unclassified | 1146 |
| 4 | Ga0058862_12046379 | 3300004803 | Bacteria | 1014 |
| 5 | Ga0070658_10022404 | 3300005327 | Bacteria | 5068 |
| 6 | Ga0070658_10027745 | 3300005327 | Unclassified | 4544 |
| 7 | Ga0070683_100008700 | 3300005329 | Bacteria | 8631 |
| 8 | Ga0070683_100287227 | 3300005329 | Unclassified | 1565 |
| 9 | Ga0068869_100889634 | 3300005334 | Unclassified | 770 |
| 10 | Ga0070666_10008841 | 3300005335 | Bacteria | 6260 |
| 11 | Ga0070680_100394293 | 3300005336 | Bacteria | 1179 |
| 12 | Ga0070682_100129788 | 3300005337 | Unclassified | 1704 |
| 13 | Ga0068868_100001712 | 3300005338 | Bacteria | 15012 |
| 14 | Ga0068868_100104313 | 3300005338 | Bacteria | 2297 |
| 15 | Ga0068868_100169589 | 3300005338 | Bacteria | 1806 |
| 16 | Ga0070660_100010209 | 3300005339 | Bacteria | 6627 |
| 17 | Ga0070691_10041741 | 3300005341 | Bacteria | 2169 |
| 18 | Ga0070667_100026276 | 3300005367 | Bacteria | 4842 |
| 19 | Ga0070709_10512447 | 3300005434 | Bacteria | 913 |
| 20 | Ga0070714_100386133 | 3300005435 | Bacteria | 1321 |
| 21 | Ga0070713_100031939 | 3300005436 | Bacteria | 4200 |
| 22 | Ga0070710_10494669 | 3300005437 | Bacteria | 836 |
| 23 | Ga0070711_100107133 | 3300005439 | Unclassified | 2045 |
| 24 | Ga0070711_100197729 | 3300005439 | Bacteria | 1549 |
| 25 | Ga0070663_100505423 | 3300005455 | Bacteria | 1004 |
| 26 | Ga0070681_10011193 | 3300005458 | Bacteria | 8878 |
| 27 | Ga0070681_10020793 | 3300005458 | Bacteria | 6575 |
| 28 | Ga0070681_10036128 | 3300005458 | Bacteria | 4962 |
| 29 | Ga0070681_10089054 | 3300005458 | Bacteria | 3037 |
| 30 | Ga0070681_10136417 | 3300005458 | Bacteria | 2384 |
| 31 | Ga0070681_10193933 | 3300005458 | Bacteria | 1950 |
| 32 | Ga0070681_10259019 | 3300005458 | Unclassified | 1652 |
| 33 | Ga0068867_100147280 | 3300005459 | Unclassified | 1847 |
| 34 | Ga0070707_100757947 | 3300005468 | Bacteria | 934 |
| 35 | Ga0070679_100030167 | 3300005530 | Bacteria | 5353 |
| 36 | Ga0070679_100237123 | 3300005530 | Bacteria | 1782 |
| 37 | Ga0070679_100404219 | 3300005530 | Bacteria | 1311 |
| 38 | Ga0070684_100120843 | 3300005535 | Unclassified | 2356 |
| 39 | Ga0070684_100144580 | 3300005535 | Bacteria | 2152 |
| 40 | Ga0070684_100225691 | 3300005535 | Bacteria | 1709 |
| 41 | Ga0068853_100070888 | 3300005539 | Bacteria | 3034 |
| 42 | Ga0068853_100661542 | 3300005539 | Unclassified | 995 |
| 43 | Ga0068853_100718060 | 3300005539 | Unclassified | 954 |
| 44 | Ga0070693_100007418 | 3300005547 | Bacteria | 5361 |
| 45 | Ga0070665_100010083 | 3300005548 | Bacteria | 9561 |
| 46 | Ga0070665_100287078 | 3300005548 | Bacteria | 1647 |
| 47 | Ga0068855_100003260 | 3300005563 | Bacteria | 19855 |
| 48 | Ga0068855_100018356 | 3300005563 | Bacteria | 8403 |
| 49 | Ga0068855_100033829 | 3300005563 | Bacteria | 6097 |
| 50 | Ga0068855_100079785 | 3300005563 | Bacteria | 3795 |
| 51 | Ga0068855_100081824 | 3300005563 | Bacteria | 3742 |
| 52 | Ga0068855_100140518 | 3300005563 | Unclassified | 2753 |
| 53 | Ga0068855_100345096 | 3300005563 | Bacteria | 1641 |
| 54 | Ga0068855_100435174 | 3300005563 | Bacteria | 1433 |
| 55 | Ga0068855_100686489 | 3300005563 | Unclassified | 1097 |
| 56 | Ga0070664_100097012 | 3300005564 | Bacteria | 2559 |
| 57 | Ga0070664_100203301 | 3300005564 | Bacteria | 1768 |
| 58 | Ga0068857_100008051 | 3300005577 | Bacteria | 9090 |
| 59 | Ga0068857_100008737 | 3300005577 | Bacteria | 8772 |
| 60 | Ga0068857_100021162 | 3300005577 | Bacteria | 5723 |
| 61 | Ga0068857_100035466 | 3300005577 | Bacteria | 4418 |
| 62 | Ga0068856_100037797 | 3300005614 | Unclassified | 4737 |
| 63 | Ga0068856_100053466 | 3300005614 | Unclassified | 3982 |
| 64 | Ga0068856_100511311 | 3300005614 | Unclassified | 1222 |
| 65 | Ga0068856_100837453 | 3300005614 | Unclassified | 939 |
| 66 | Ga0068852_100006999 | 3300005616 | Bacteria | 8209 |
| 67 | Ga0068852_100091124 | 3300005616 | Bacteria | 2728 |
| 68 | Ga0068859_100070591 | 3300005617 | Bacteria | 3528 |
| 69 | Ga0068859_101181706 | 3300005617 | Unclassified | 842 |
| 70 | Ga0068864_100041595 | 3300005618 | Bacteria | 3931 |
| 71 | Ga0068863_100033479 | 3300005841 | Unclassified | 4896 |
| 72 | Ga0068863_100219264 | 3300005841 | Bacteria | 1832 |
| 73 | Ga0068858_100020165 | 3300005842 | Bacteria | 6233 |
| 74 | Ga0068858_100049631 | 3300005842 | Bacteria | 3886 |
| 75 | Ga0068858_100092100 | 3300005842 | Bacteria | 2821 |
| 76 | Ga0068860_100045187 | 3300005843 | Bacteria | 4199 |
| 77 | Ga0068860_100210685 | 3300005843 | Bacteria | 1885 |
| 78 | Ga0070717_10003231 | 3300006028 | Bacteria | 11640 |
| 79 | Ga0097621_100044593 | 3300006237 | Bacteria | 3578 |
| 80 | Ga0097621_100107107 | 3300006237 | Bacteria | 2358 |
| 81 | Ga0097621_100122350 | 3300006237 | Bacteria | 2208 |
| 82 | Ga0068871_100022907 | 3300006358 | Bacteria | 4821 |
| 83 | Ga0068871_100073863 | 3300006358 | Bacteria | 2812 |
| 84 | Ga0068871_100553879 | 3300006358 | Unclassified | 1042 |
| 85 | Ga0068865_100026202 | 3300006881 | Bacteria | 3842 |
| 86 | Ga0068865_100027314 | 3300006881 | Bacteria | 3769 |
| 87 | Ga0097620_100070588 | 3300006931 | Bacteria | 3528 |
| 88 | Ga0097620_101181653 | 3300006931 | Unclassified | 842 |
| 89 | Ga0105240_10008037 | 3300009093 | Bacteria | 15182 |
| 90 | Ga0105240_10018954 | 3300009093 | Bacteria | 9214 |
| 91 | Ga0105240_10145284 | 3300009093 | Unclassified | 2831 |
| 92 | Ga0105240_10156150 | 3300009093 | Unclassified | 2713 |
| 93 | Ga0105240_10187137 | 3300009093 | Bacteria | 2438 |
| 94 | Ga0105240_10554369 | 3300009093 | Unclassified | 1271 |
| 95 | Ga0105240_10698405 | 3300009093 | Bacteria | 1108 |
| 96 | Ga0105245_10002433 | 3300009098 | Bacteria | 16849 |
| 97 | Ga0105245_10005126 | 3300009098 | Bacteria | 11513 |
| 98 | Ga0105245_10010337 | 3300009098 | Bacteria | 8130 |
| 99 | Ga0105245_10015676 | 3300009098 | Bacteria | 6608 |
| 100 | Ga0105245_10026070 | 3300009098 | Bacteria | 5144 |
| 101 | Ga0105245_10052648 | 3300009098 | Unclassified | 3651 |
| 102 | Ga0105245_10228696 | 3300009098 | Bacteria | 1798 |
| 103 | Ga0105245_10624257 | 3300009098 | Bacteria | 1106 |
| 104 | Ga0105247_10033163 | 3300009101 | Bacteria | 3139 |
| 105 | Ga0105247_10568532 | 3300009101 | Unclassified | 836 |
| 106 | Ga0105243_10424412 | 3300009148 | Bacteria | 1241 |
| 107 | Ga0105241_10086814 | 3300009174 | Unclassified | 2461 |
| 108 | Ga0105241_10191571 | 3300009174 | Bacteria | 1702 |
| 109 | Ga0105241_10234306 | 3300009174 | Unclassified | 1549 |
| 110 | Ga0105242_10069493 | 3300009176 | Bacteria | 2917 |
| 111 | Ga0105242_10096055 | 3300009176 | Bacteria | 2503 |
| 112 | Ga0105242_10154559 | 3300009176 | Unclassified | 2003 |
| 113 | Ga0105242_10165563 | 3300009176 | Bacteria | 1939 |
| 114 | Ga0105242_10338581 | 3300009176 | Bacteria | 1386 |
| 115 | Ga0105248_10025290 | 3300009177 | Bacteria | 6601 |
| 116 | Ga0105248_10125648 | 3300009177 | Bacteria | 2894 |
| 117 | Ga0105248_10148713 | 3300009177 | Unclassified | 2643 |
| 118 | Ga0105248_10172663 | 3300009177 | Bacteria | 2437 |
| 119 | Ga0105248_10205692 | 3300009177 | Bacteria | 2218 |
| 120 | Ga0105248_11305290 | 3300009177 | Unclassified | 821 |
| 121 | Ga0105237_10003231 | 3300009545 | Bacteria | 19491 |
| 122 | Ga0105237_10018922 | 3300009545 | Bacteria | 7119 |
| 123 | Ga0105237_10042967 | 3300009545 | Unclassified | 4555 |
| 124 | Ga0105237_10043895 | 3300009545 | Bacteria | 4502 |
| 125 | Ga0105237_10054332 | 3300009545 | Unclassified | 4013 |
| 126 | Ga0105237_10097170 | 3300009545 | Bacteria | 2935 |
| 127 | Ga0105237_10316613 | 3300009545 | Bacteria | 1563 |
| 128 | Ga0105237_10672398 | 3300009545 | Bacteria | 1042 |
| 129 | Ga0105238_10002276 | 3300009551 | Bacteria | 19349 |
| 130 | Ga0105238_10016492 | 3300009551 | Bacteria | 7477 |
| 131 | Ga0105238_10038258 | 3300009551 | Unclassified | 4872 |
| 132 | Ga0105238_10046113 | 3300009551 | Unclassified | 4401 |
| 133 | Ga0105238_10100906 | 3300009551 | Unclassified | 2869 |
| 134 | Ga0105249_10007342 | 3300009553 | Bacteria | 9607 |
| 135 | Ga0105239_10009588 | 3300010375 | Bacteria | 10891 |
| 136 | Ga0105239_10012990 | 3300010375 | Bacteria | 9264 |
| 137 | Ga0105239_10032963 | 3300010375 | Bacteria | 5691 |
| 138 | Ga0105239_10079297 | 3300010375 | Bacteria | 3613 |
| 139 | Ga0157370_10003674 | 3300013104 | Bacteria | 17919 |
| 140 | Ga0157370_10012618 | 3300013104 | Bacteria | 8755 |
| 141 | Ga0157370_10036798 | 3300013104 | Unclassified | 4748 |
| 142 | Ga0157370_10542334 | 3300013104 | Unclassified | 1067 |
| 143 | Ga0157370_10657762 | 3300013104 | Unclassified | 957 |
| 144 | Ga0157369_10011055 | 3300013105 | Bacteria | 10271 |
| 145 | Ga0157369_10012914 | 3300013105 | Bacteria | 9466 |
| 146 | Ga0157369_10029090 | 3300013105 | Bacteria | 6108 |
| 147 | Ga0157369_10151875 | 3300013105 | Bacteria | 2448 |
| 148 | Ga0157369_10160682 | 3300013105 | Bacteria | 2371 |
| 149 | Ga0157369_10309807 | 3300013105 | Bacteria | 1642 |
| 150 | Ga0157369_10539205 | 3300013105 | Bacteria | 1206 |
| 151 | Ga0157374_10020694 | 3300013296 | Bacteria | 5841 |
| 152 | Ga0157374_10062758 | 3300013296 | Bacteria | 3484 |
| 153 | Ga0157374_10119275 | 3300013296 | Bacteria | 2545 |
| 154 | Ga0157374_10251649 | 3300013296 | Unclassified | 1739 |
| 155 | Ga0157374_10415344 | 3300013296 | Bacteria | 1344 |
| 156 | Ga0157378_10013102 | 3300013297 | Bacteria | 7254 |
| 157 | Ga0163162_10001848 | 3300013306 | Bacteria | 19926 |
| 158 | Ga0163162_10048771 | 3300013306 | Bacteria | 4243 |
| 159 | Ga0163162_10065117 | 3300013306 | Unclassified | 3691 |
| 160 | Ga0163162_10194702 | 3300013306 | Bacteria | 2155 |
| 161 | Ga0163162_10411590 | 3300013306 | Unclassified | 1485 |
| 162 | Ga0157372_10019367 | 3300013307 | Bacteria | 7333 |
| 163 | Ga0157372_10053444 | 3300013307 | Unclassified | 4502 |
| 164 | Ga0157372_10112833 | 3300013307 | Unclassified | 3115 |
| 165 | Ga0157372_10187460 | 3300013307 | Bacteria | 2395 |
| 166 | Ga0157372_10381406 | 3300013307 | Unclassified | 1642 |
| 167 | Ga0157375_10005440 | 3300013308 | Bacteria | 11072 |
| 168 | Ga0157375_10055172 | 3300013308 | Unclassified | 3917 |
| 169 | Ga0163163_10003894 | 3300014325 | Bacteria | 12725 |
| 170 | Ga0163163_10004958 | 3300014325 | Bacteria | 11455 |
| 171 | Ga0163163_10043466 | 3300014325 | Bacteria | 4405 |
| 172 | Ga0163163_10095276 | 3300014325 | Bacteria | 2996 |
| 173 | Ga0163163_10130542 | 3300014325 | Bacteria | 2552 |
| 174 | Ga0163163_10164873 | 3300014325 | Bacteria | 2262 |
| 175 | Ga0157379_10231591 | 3300014968 | Bacteria | 1674 |
| 176 | Ga0157379_10668346 | 3300014968 | Unclassified | 973 |
| 177 | Ga0157376_10023450 | 3300014969 | Bacteria | 4829 |
| 178 | Ga0157376_10037727 | 3300014969 | Bacteria | 3926 |
| 179 | Ga0157376_10277626 | 3300014969 | Bacteria | 1577 |
| 180 | Ga0157376_10445386 | 3300014969 | Bacteria | 1262 |
| 181 | Ga0184598_140489 | 3300019182 | Unclassified | 1222 |
| 182 | Ga0184599_131657 | 3300019188 | Unclassified | 1546 |
| 183 | Ga0184600_109838 | 3300019190 | Unclassified | 920 |
| 184 | Ga0184600_136517 | 3300019190 | Bacteria | 1433 |
| 185 | Ga0184600_143208 | 3300019190 | Unclassified | 1233 |
| 186 | Ga0184603_123930 | 3300019192 | Bacteria | 1861 |
| 187 | Ga0197907_10513497 | 3300020069 | Bacteria | 1781 |
| 188 | Ga0206356_11227259 | 3300020070 | Unclassified | 780 |
| 189 | Ga0206352_10778193 | 3300020078 | Bacteria | 734 |
| 190 | Ga0213871_10011061 | 3300021441 | Bacteria | 2063 |
| 191 | Ga0224712_10041468 | 3300022467 | Bacteria | 1738 |
| 192 | Ga0247554_100209 | 3300023547 | Unclassified | 1523 |
| 193 | Ga0247553_100250 | 3300023672 | Bacteria | 1827 |
| 194 | Ga0207692_10255896 | 3300025898 | Bacteria | 1051 |
| 195 | Ga0207710_10034113 | 3300025900 | Bacteria | 2235 |
| 196 | Ga0207680_10058775 | 3300025903 | Bacteria | 2332 |
| 197 | Ga0207705_10106540 | 3300025909 | Bacteria | 2067 |
| 198 | Ga0207705_10163674 | 3300025909 | Bacteria | 1672 |
| 199 | Ga0207654_10275650 | 3300025911 | Bacteria | 1136 |
| 200 | Ga0207707_10001236 | 3300025912 | Bacteria | 23977 |
| 201 | Ga0207707_10045979 | 3300025912 | Bacteria | 3802 |
| 202 | Ga0207707_10260017 | 3300025912 | Bacteria | 1506 |
| 203 | Ga0207707_10354130 | 3300025912 | Unclassified | 1264 |
| 204 | Ga0207707_10621577 | 3300025912 | Bacteria | 913 |
| 205 | Ga0207695_10025831 | 3300025913 | Bacteria | 6566 |
| 206 | Ga0207695_10033014 | 3300025913 | Bacteria | 5655 |
| 207 | Ga0207695_10042401 | 3300025913 | Bacteria | 4861 |
| 208 | Ga0207695_10525463 | 3300025913 | Unclassified | 1065 |
| 209 | Ga0207695_10577660 | 3300025913 | Bacteria | 1005 |
| 210 | Ga0207671_10041640 | 3300025914 | Bacteria | 3399 |
| 211 | Ga0207671_10046082 | 3300025914 | Bacteria | 3225 |
| 212 | Ga0207671_10181131 | 3300025914 | Unclassified | 1640 |
| 213 | Ga0207671_10234632 | 3300025914 | Bacteria | 1440 |
| 214 | Ga0207671_10362004 | 3300025914 | Bacteria | 1151 |
| 215 | Ga0207660_10659551 | 3300025917 | Unclassified | 853 |
| 216 | Ga0207657_10006644 | 3300025919 | Bacteria | 11969 |
| 217 | Ga0207652_10028026 | 3300025921 | Bacteria | 4696 |
| 218 | Ga0207652_10290423 | 3300025921 | Bacteria | 1475 |
| 219 | Ga0207646_10236925 | 3300025922 | Bacteria | 1649 |
| 220 | Ga0207694_10003194 | 3300025924 | Bacteria | 13070 |
| 221 | Ga0207694_10005744 | 3300025924 | Bacteria | 9506 |
| 222 | Ga0207694_10091797 | 3300025924 | Unclassified | 2396 |
| 223 | Ga0207694_10125545 | 3300025924 | Bacteria | 2052 |
| 224 | Ga0207694_10134350 | 3300025924 | Unclassified | 1985 |
| 225 | Ga0207694_10235755 | 3300025924 | Bacteria | 1495 |
| 226 | Ga0207687_10006365 | 3300025927 | Bacteria | 7802 |
| 227 | Ga0207687_10060229 | 3300025927 | Bacteria | 2677 |
| 228 | Ga0207687_10178130 | 3300025927 | Unclassified | 1645 |
| 229 | Ga0207687_10560279 | 3300025927 | Unclassified | 959 |
| 230 | Ga0207687_10699720 | 3300025927 | Unclassified | 860 |
| 231 | Ga0207700_10218495 | 3300025928 | Unclassified | 1614 |
| 232 | Ga0207700_10475815 | 3300025928 | Unclassified | 1103 |
| 233 | Ga0207686_10005399 | 3300025934 | Bacteria | 6853 |
| 234 | Ga0207686_10104447 | 3300025934 | Bacteria | 1898 |
| 235 | Ga0207686_10142932 | 3300025934 | Bacteria | 1656 |
| 236 | Ga0207704_10007428 | 3300025938 | Bacteria | 5176 |
| 237 | Ga0207711_10007039 | 3300025941 | Bacteria | 9421 |
| 238 | Ga0207711_10078027 | 3300025941 | Unclassified | 2888 |
| 239 | Ga0207661_10022499 | 3300025944 | Unclassified | 4750 |
| 240 | Ga0207661_10033393 | 3300025944 | Bacteria | 3993 |
| 241 | Ga0207661_10119127 | 3300025944 | Bacteria | 2245 |
| 242 | Ga0207661_10552261 | 3300025944 | Unclassified | 1055 |
| 243 | Ga0207679_10069728 | 3300025945 | Bacteria | 2647 |
| 244 | Ga0207679_10340880 | 3300025945 | Bacteria | 1303 |
| 245 | Ga0207667_10027366 | 3300025949 | Bacteria | 6207 |
| 246 | Ga0207667_10029011 | 3300025949 | Bacteria | 6005 |
| 247 | Ga0207667_10122842 | 3300025949 | Bacteria | 2675 |
| 248 | Ga0207667_10691962 | 3300025949 | Unclassified | 1022 |
| 249 | Ga0207712_10050271 | 3300025961 | Bacteria | 2910 |
| 250 | Ga0207712_10092558 | 3300025961 | Bacteria | 2229 |
| 251 | Ga0207658_10094658 | 3300025986 | Bacteria | 2325 |
| 252 | Ga0207677_10094113 | 3300026023 | Bacteria | 2186 |
| 253 | Ga0207677_10176445 | 3300026023 | Bacteria | 1676 |
| 254 | Ga0207677_10601232 | 3300026023 | Bacteria | 965 |
| 255 | Ga0207703_10005850 | 3300026035 | Bacteria | 9848 |
| 256 | Ga0207703_10042668 | 3300026035 | Bacteria | 3639 |
| 257 | Ga0207703_10156560 | 3300026035 | Unclassified | 1992 |
| 258 | Ga0207703_10524270 | 3300026035 | Bacteria | 1115 |
| 259 | Ga0207639_10115400 | 3300026041 | Bacteria | 2196 |
| 260 | Ga0207639_10655378 | 3300026041 | Bacteria | 971 |
| 261 | Ga0207702_10036651 | 3300026078 | Unclassified | 4103 |
| 262 | Ga0207702_10102429 | 3300026078 | Bacteria | 2530 |
| 263 | Ga0207702_10117093 | 3300026078 | Unclassified | 2379 |
| 264 | Ga0207702_10277116 | 3300026078 | Unclassified | 1584 |
| 265 | Ga0207702_10565889 | 3300026078 | Unclassified | 1113 |
| 266 | Ga0207702_10616754 | 3300026078 | Bacteria | 1065 |
| 267 | Ga0207702_10639761 | 3300026078 | Bacteria | 1045 |
| 268 | Ga0207641_10029523 | 3300026088 | Unclassified | 4536 |
| 269 | Ga0207641_10102534 | 3300026088 | Bacteria | 2523 |
| 270 | Ga0207641_10995171 | 3300026088 | Unclassified | 835 |
| 271 | Ga0207648_10013416 | 3300026089 | Bacteria | 7626 |
| 272 | Ga0207648_10065596 | 3300026089 | Bacteria | 3165 |
| 273 | Ga0207676_10059427 | 3300026095 | Unclassified | 3019 |
| 274 | Ga0207676_10480136 | 3300026095 | Unclassified | 1177 |
| 275 | Ga0207674_10001790 | 3300026116 | Bacteria | 27420 |
| 276 | Ga0207674_10017870 | 3300026116 | Bacteria | 7730 |
| 277 | Ga0207674_10072129 | 3300026116 | Bacteria | 3469 |
| 278 | Ga0207674_10078283 | 3300026116 | Bacteria | 3311 |
| 279 | Ga0207698_10266079 | 3300026142 | Unclassified | 1578 |
| 280 | Ga0268264_10007357 | 3300028381 | Bacteria | 9196 |
| 281 | Ga0265338_10289075 | 3300028800 | Bacteria | 1195 |
| 282 | Ga0265338_10433674 | 3300028800 | Bacteria | 932 |
| 283 | Ga0265324_10006307 | 3300029957 | Unclassified | 4974 |
| 284 | Ga0265775_103853 | 3300030762 | Bacteria | 824 |
| 285 | Ga0265777_101624 | 3300030877 | Bacteria | 1226 |
| 286 | Ga0265777_104845 | 3300030877 | Unclassified | 873 |
| 287 | Ga0265777_106509 | 3300030877 | Unclassified | 798 |
| 288 | Ga0265777_107282 | 3300030877 | Bacteria | 769 |
| 289 | Ga0265779_101044 | 3300031043 | Bacteria | 1161 |
| 290 | Ga0265760_10045326 | 3300031090 | Unclassified | 1317 |
| 291 | Ga0265332_10085422 | 3300031238 | Bacteria | 1337 |
| 292 | Ga0265328_10050897 | 3300031239 | Unclassified | 1521 |
| 293 | Ga0265320_10000779 | 3300031240 | Bacteria | 24375 |
| 294 | Ga0265325_10001705 | 3300031241 | Bacteria | 15283 |
| 295 | Ga0265325_10047172 | 3300031241 | Unclassified | 2231 |
| 296 | Ga0265325_10078391 | 3300031241 | Bacteria | 1646 |
| 297 | Ga0265329_10008974 | 3300031242 | Unclassified | 3758 |
| 298 | Ga0265339_10049867 | 3300031249 | Unclassified | 2291 |
| 299 | Ga0265331_10003601 | 3300031250 | Bacteria | 9924 |
| 300 | Ga0265331_10117021 | 3300031250 | Unclassified | 1220 |
| 301 | Ga0265316_10001298 | 3300031344 | Bacteria | 26881 |
| 302 | Ga0265316_10007261 | 3300031344 | Bacteria | 10457 |
| 303 | Ga0265316_10197842 | 3300031344 | Bacteria | 1491 |
| 304 | Ga0265316_10333756 | 3300031344 | Unclassified | 1100 |
| 305 | Ga0310117_109268 | 3300031592 | Bacteria | 1046 |
| 306 | Ga0265313_10061234 | 3300031595 | Bacteria | 1762 |
| 307 | Ga0265313_10112129 | 3300031595 | Bacteria | 1198 |
| 308 | Ga0265314_10001835 | 3300031711 | Bacteria | 22830 |
| 309 | Ga0265314_10005185 | 3300031711 | Bacteria | 11831 |
| 310 | Ga0265314_10266275 | 3300031711 | Bacteria | 976 |
| 311 | Ga0265342_10020418 | 3300031712 | Unclassified | 4249 |
| 312 | Ga0316053_100463 | 3300032120 | Bacteria | 1867 |
| 313 | Ga0373934_0006803 | 3300035086 | Bacteria | 4246 |
| 314 | Ga0373953_0004738 | 3300035117 | Unclassified | 4361 |
| 315 | Ga0373954_0010480 | 3300035118 | Bacteria | 4090 |
| 316 | Ga0373946_0282990 | 3300035171 | Unclassified | 816 |
| 317 | Ga0373955_0309569 | 3300035172 | Unclassified | 953 |
| 318 | Ga0373931_0288011 | 3300035691 | Archaea | 1011 |
| 319 | Ga0373935_0044987 | 3300035692 | Bacteria | 2784 |
| 320 | Ga0373927_0001625 | 3300035695 | Bacteria | 16846 |
| 321 | Ga0373947_0035533 | 3300035725 | Bacteria | 2950 |
| 322 | Ga0373937_0014919 | 3300036401 | Bacteria | 6864 |
| 323 | Ga0373937_0342278 | 3300036401 | Unclassified | 1416 |
| 324 | Ga0265778_001259 | 3300036457 | Bacteria | 2270 |
| 325 | Ga0265778_003139 | 3300036457 | Bacteria | 1650 |
| 326 | Ga0265778_004236 | 3300036457 | Unclassified | 1479 |
| 327 | Ga0265778_005463 | 3300036457 | Unclassified | 1345 |
| 328 | Ga0265778_005593 | 3300036457 | Bacteria | 1334 |
| 329 | Ga0265778_006407 | 3300036457 | Bacteria | 1267 |
| 330 | Ga0265778_006637 | 3300036457 | Unclassified | 1251 |
| 331 | Ga0265778_007714 | 3300036457 | Unclassified | 1186 |
| 332 | Ga0265778_015077 | 3300036457 | Bacteria | 917 |
| 333 | Ga0265778_015431 | 3300036457 | Bacteria | 908 |
| 334 | Ga0265778_020314 | 3300036457 | Unclassified | 817 |
| 335 | Ga0265778_022756 | 3300036457 | Bacteria | 781 |
| 336 | Ga0265778_025844 | 3300036457 | Unclassified | 743 |
| 337 | Ga0373925_0066891 | 3300037068 | Bacteria | 2709 |
| 338 | Ga0373925_0356552 | 3300037068 | Unclassified | 1188 |
| 339 | Ga0466970_0260482 | 3300044765 | Unclassified | 973 |
| 340 | Ga0466967_0164423 | 3300045976 | Bacteria | 2085 |
| 341 | Ga0495651_0417035 | 3300046462 | Unclassified | 873 |
| 342 | Ga0495651_0550497 | 3300046462 | Unclassified | 733 |
| 343 | Ga0495580_0002841 | 3300046472 | Bacteria | 14894 |
| 344 | Ga0495580_0235321 | 3300046472 | Unclassified | 1256 |
| 345 | Ga0495639_0195444 | 3300046475 | Unclassified | 989 |
| 346 | Ga0495664_0054244 | 3300046477 | Bacteria | 2384 |
| 347 | Ga0495594_0216912 | 3300046499 | Unclassified | 1091 |
| 348 | Ga0495586_0259209 | 3300046535 | Bacteria | 993 |
| 349 | Ga0495587_0067746 | 3300046536 | Unclassified | 2080 |
| 350 | Ga0495633_0136866 | 3300046558 | Bacteria | 1133 |
| 351 | Ga0495667_0224834 | 3300046559 | Bacteria | 1197 |
| 352 | Ga0495599_0064865 | 3300046678 | Bacteria | 2282 |
| 353 | Ga0495599_0158626 | 3300046678 | Unclassified | 1399 |
| 354 | Ga0495604_0388420 | 3300047317 | Unclassified | 921 |
| 355 | Ga0495675_0282759 | 3300047444 | Unclassified | 989 |
| 356 | Ga0495684_0021708 | 3300047471 | Unclassified | 4943 |
| 357 | Ga0495684_0586609 | 3300047471 | Bacteria | 754 |
| 358 | Ga0495602_0115227 | 3300048088 | Bacteria | 2175 |
| 359 | Ga0495602_0124824 | 3300048088 | Unclassified | 2064 |
| 360 | Ga0501083_0327974 | 3300049744 | Unclassified | 995 |
| 361 | Ga0500616_0000172 | 3300053153 | Bacteria | 107729 |
| 362 | Ga0436365_1094263 | |||
| 363 | Ga0058863_11961407 | |||
| 364 | Ga0058861_10931303 | |||
| 365 | Ga0058862_12046379 | |||
| 366 | Ga0070658_10022404 | |||
| 367 | Ga0070658_10027745 | |||
| 368 | Ga0070683_100008700 | |||
| 369 | Ga0070683_100287227 | |||
| 370 | Ga0068869_100889634 | |||
| 371 | Ga0070666_10008841 | |||
| 372 | Ga0070680_100394293 | |||
| 373 | Ga0070682_100129788 | |||
| 374 | Ga0068868_100001712 | |||
| 375 | Ga0068868_100104313 | |||
| 376 | Ga0068868_100169589 | |||
| 377 | Ga0070660_100010209 | |||
| 378 | Ga0070691_10041741 | |||
| 379 | Ga0070667_100026276 | |||
| 380 | Ga0070709_10512447 | |||
| 381 | Ga0070714_100386133 | |||
| 382 | Ga0070713_100031939 | |||
| 383 | Ga0070710_10494669 | |||
| 384 | Ga0070711_100107133 | |||
| 385 | Ga0070711_100197729 | |||
| 386 | Ga0070663_100505423 | |||
| 387 | Ga0070681_10011193 | |||
| 388 | Ga0070681_10020793 | |||
| 389 | Ga0070681_10036128 | |||
| 390 | Ga0070681_10089054 | |||
| 391 | Ga0070681_10136417 | |||
| 392 | Ga0070681_10193933 | |||
| 393 | Ga0070681_10259019 | |||
| 394 | Ga0068867_100147280 | |||
| 395 | Ga0070707_100757947 | |||
| 396 | Ga0070679_100030167 | |||
| 397 | Ga0070679_100237123 | |||
| 398 | Ga0070679_100404219 | |||
| 399 | Ga0070684_100120843 | |||
| 400 | Ga0070684_100144580 | |||
| 401 | Ga0070684_100225691 | |||
| 402 | Ga0068853_100070888 | |||
| 403 | Ga0068853_100661542 | |||
| 404 | Ga0068853_100718060 | |||
| 405 | Ga0070693_100007418 | |||
| 406 | Ga0070665_100010083 | |||
| 407 | Ga0070665_100287078 | |||
| 408 | Ga0068855_100003260 | |||
| 409 | Ga0068855_100018356 | |||
| 410 | Ga0068855_100033829 | |||
| 411 | Ga0068855_100079785 | |||
| 412 | Ga0068855_100081824 | |||
| 413 | Ga0068855_100140518 | |||
| 414 | Ga0068855_100345096 | |||
| 415 | Ga0068855_100435174 | |||
| 416 | Ga0068855_100686489 | |||
| 417 | Ga0070664_100097012 | |||
| 418 | Ga0070664_100203301 | |||
| 419 | Ga0068857_100008051 | |||
| 420 | Ga0068857_100008737 | |||
| 421 | Ga0068857_100021162 | |||
| 422 | Ga0068857_100035466 | |||
| 423 | Ga0068856_100037797 | |||
| 424 | Ga0068856_100053466 | |||
| 425 | Ga0068856_100511311 | |||
| 426 | Ga0068856_100837453 | |||
| 427 | Ga0068852_100006999 | |||
| 428 | Ga0068852_100091124 | |||
| 429 | Ga0068859_100070591 | |||
| 430 | Ga0068859_101181706 | |||
| 431 | Ga0068864_100041595 | |||
| 432 | Ga0068863_100033479 | |||
| 433 | Ga0068863_100219264 | |||
| 434 | Ga0068858_100020165 | |||
| 435 | Ga0068858_100049631 | |||
| 436 | Ga0068858_100092100 | |||
| 437 | Ga0068860_100045187 | |||
| 438 | Ga0068860_100210685 | |||
| 439 | Ga0070717_10003231 | |||
| 440 | Ga0097621_100044593 | |||
| 441 | Ga0097621_100107107 | |||
| 442 | Ga0097621_100122350 | |||
| 443 | Ga0068871_100022907 | |||
| 444 | Ga0068871_100073863 | |||
| 445 | Ga0068871_100553879 | |||
| 446 | Ga0068865_100026202 | |||
| 447 | Ga0068865_100027314 | |||
| 448 | Ga0097620_100070588 | |||
| 449 | Ga0097620_101181653 | |||
| 450 | Ga0105240_10008037 | |||
| 451 | Ga0105240_10018954 | |||
| 452 | Ga0105240_10145284 | |||
| 453 | Ga0105240_10156150 | |||
| 454 | Ga0105240_10187137 | |||
| 455 | Ga0105240_10554369 | |||
| 456 | Ga0105240_10698405 | |||
| 457 | Ga0105245_10002433 | |||
| 458 | Ga0105245_10005126 | |||
| 459 | Ga0105245_10010337 | |||
| 460 | Ga0105245_10015676 | |||
| 461 | Ga0105245_10026070 | |||
| 462 | Ga0105245_10052648 | |||
| 463 | Ga0105245_10228696 | |||
| 464 | Ga0105245_10624257 | |||
| 465 | Ga0105247_10033163 | |||
| 466 | Ga0105247_10568532 | |||
| 467 | Ga0105243_10424412 | |||
| 468 | Ga0105241_10086814 | |||
| 469 | Ga0105241_10191571 | |||
| 470 | Ga0105241_10234306 | |||
| 471 | Ga0105242_10069493 | |||
| 472 | Ga0105242_10096055 | |||
| 473 | Ga0105242_10154559 | |||
| 474 | Ga0105242_10165563 | |||
| 475 | Ga0105242_10338581 | |||
| 476 | Ga0105248_10025290 | |||
| 477 | Ga0105248_10125648 | |||
| 478 | Ga0105248_10148713 | |||
| 479 | Ga0105248_10172663 | |||
| 480 | Ga0105248_10205692 | |||
| 481 | Ga0105248_11305290 | |||
| 482 | Ga0105237_10003231 | |||
| 483 | Ga0105237_10018922 | |||
| 484 | Ga0105237_10042967 | |||
| 485 | Ga0105237_10043895 | |||
| 486 | Ga0105237_10054332 | |||
| 487 | Ga0105237_10097170 | |||
| 488 | Ga0105237_10316613 | |||
| 489 | Ga0105237_10672398 | |||
| 490 | Ga0105238_10002276 | |||
| 491 | Ga0105238_10016492 | |||
| 492 | Ga0105238_10038258 | |||
| 493 | Ga0105238_10046113 | |||
| 494 | Ga0105238_10100906 | |||
| 495 | Ga0105249_10007342 | |||
| 496 | Ga0105239_10009588 | |||
| 497 | Ga0105239_10012990 | |||
| 498 | Ga0105239_10032963 | |||
| 499 | Ga0105239_10079297 | |||
| 500 | Ga0157370_10003674 | |||
| 501 | Ga0157370_10012618 | |||
| 502 | Ga0157370_10036798 | |||
| 503 | Ga0157370_10542334 | |||
| 504 | Ga0157370_10657762 | |||
| 505 | Ga0157369_10011055 | |||
| 506 | Ga0157369_10012914 | |||
| 507 | Ga0157369_10029090 | |||
| 508 | Ga0157369_10151875 | |||
| 509 | Ga0157369_10160682 | |||
| 510 | Ga0157369_10309807 | |||
| 511 | Ga0157369_10539205 | |||
| 512 | Ga0157374_10020694 | |||
| 513 | Ga0157374_10062758 | |||
| 514 | Ga0157374_10119275 | |||
| 515 | Ga0157374_10251649 | |||
| 516 | Ga0157374_10415344 | |||
| 517 | Ga0157378_10013102 | |||
| 518 | Ga0163162_10001848 | |||
| 519 | Ga0163162_10048771 | |||
| 520 | Ga0163162_10065117 | |||
| 521 | Ga0163162_10194702 | |||
| 522 | Ga0163162_10411590 | |||
| 523 | Ga0157372_10019367 | |||
| 524 | Ga0157372_10053444 | |||
| 525 | Ga0157372_10112833 | |||
| 526 | Ga0157372_10187460 | |||
| 527 | Ga0157372_10381406 | |||
| 528 | Ga0157375_10005440 | |||
| 529 | Ga0157375_10055172 | |||
| 530 | Ga0163163_10003894 | |||
| 531 | Ga0163163_10004958 | |||
| 532 | Ga0163163_10043466 | |||
| 533 | Ga0163163_10095276 | |||
| 534 | Ga0163163_10130542 | |||
| 535 | Ga0163163_10164873 | |||
| 536 | Ga0157379_10231591 | |||
| 537 | Ga0157379_10668346 | |||
| 538 | Ga0157376_10023450 | |||
| 539 | Ga0157376_10037727 | |||
| 540 | Ga0157376_10277626 | |||
| 541 | Ga0157376_10445386 | |||
| 542 | Ga0184598_140489 | |||
| 543 | Ga0184599_131657 | |||
| 544 | Ga0184600_109838 | |||
| 545 | Ga0184600_136517 | |||
| 546 | Ga0184600_143208 | |||
| 547 | Ga0184603_123930 | |||
| 548 | Ga0197907_10513497 | |||
| 549 | Ga0206356_11227259 | |||
| 550 | Ga0206352_10778193 | |||
| 551 | Ga0213871_10011061 | |||
| 552 | Ga0224712_10041468 | |||
| 553 | Ga0247554_100209 | |||
| 554 | Ga0247553_100250 | |||
| 555 | Ga0207692_10255896 | |||
| 556 | Ga0207710_10034113 | |||
| 557 | Ga0207680_10058775 | |||
| 558 | Ga0207705_10106540 | |||
| 559 | Ga0207705_10163674 | |||
| 560 | Ga0207654_10275650 | |||
| 561 | Ga0207707_10001236 | |||
| 562 | Ga0207707_10045979 | |||
| 563 | Ga0207707_10260017 | |||
| 564 | Ga0207707_10354130 | |||
| 565 | Ga0207707_10621577 | |||
| 566 | Ga0207695_10025831 | |||
| 567 | Ga0207695_10033014 | |||
| 568 | Ga0207695_10042401 | |||
| 569 | Ga0207695_10525463 | |||
| 570 | Ga0207695_10577660 | |||
| 571 | Ga0207671_10041640 | |||
| 572 | Ga0207671_10046082 | |||
| 573 | Ga0207671_10181131 | |||
| 574 | Ga0207671_10234632 | |||
| 575 | Ga0207671_10362004 | |||
| 576 | Ga0207660_10659551 | |||
| 577 | Ga0207657_10006644 | |||
| 578 | Ga0207652_10028026 | |||
| 579 | Ga0207652_10290423 | |||
| 580 | Ga0207646_10236925 | |||
| 581 | Ga0207694_10003194 | |||
| 582 | Ga0207694_10005744 | |||
| 583 | Ga0207694_10091797 | |||
| 584 | Ga0207694_10125545 | |||
| 585 | Ga0207694_10134350 | |||
| 586 | Ga0207694_10235755 | |||
| 587 | Ga0207687_10006365 | |||
| 588 | Ga0207687_10060229 | |||
| 589 | Ga0207687_10178130 | |||
| 590 | Ga0207687_10560279 | |||
| 591 | Ga0207687_10699720 | |||
| 592 | Ga0207700_10218495 | |||
| 593 | Ga0207700_10475815 | |||
| 594 | Ga0207686_10005399 | |||
| 595 | Ga0207686_10104447 | |||
| 596 | Ga0207686_10142932 | |||
| 597 | Ga0207704_10007428 | |||
| 598 | Ga0207711_10007039 | |||
| 599 | Ga0207711_10078027 | |||
| 600 | Ga0207661_10022499 | |||
| 601 | Ga0207661_10033393 | |||
| 602 | Ga0207661_10119127 | |||
| 603 | Ga0207661_10552261 | |||
| 604 | Ga0207679_10069728 | |||
| 605 | Ga0207679_10340880 | |||
| 606 | Ga0207667_10027366 | |||
| 607 | Ga0207667_10029011 | |||
| 608 | Ga0207667_10122842 | |||
| 609 | Ga0207667_10691962 | |||
| 610 | Ga0207712_10050271 | |||
| 611 | Ga0207712_10092558 | |||
| 612 | Ga0207658_10094658 | |||
| 613 | Ga0207677_10094113 | |||
| 614 | Ga0207677_10176445 | |||
| 615 | Ga0207677_10601232 | |||
| 616 | Ga0207703_10005850 | |||
| 617 | Ga0207703_10042668 | |||
| 618 | Ga0207703_10156560 | |||
| 619 | Ga0207703_10524270 | |||
| 620 | Ga0207639_10115400 | |||
| 621 | Ga0207639_10655378 | |||
| 622 | Ga0207702_10036651 | |||
| 623 | Ga0207702_10102429 | |||
| 624 | Ga0207702_10117093 | |||
| 625 | Ga0207702_10277116 | |||
| 626 | Ga0207702_10565889 | |||
| 627 | Ga0207702_10616754 | |||
| 628 | Ga0207702_10639761 | |||
| 629 | Ga0207641_10029523 | |||
| 630 | Ga0207641_10102534 | |||
| 631 | Ga0207641_10995171 | |||
| 632 | Ga0207648_10013416 | |||
| 633 | Ga0207648_10065596 | |||
| 634 | Ga0207676_10059427 | |||
| 635 | Ga0207676_10480136 | |||
| 636 | Ga0207674_10001790 | |||
| 637 | Ga0207674_10017870 | |||
| 638 | Ga0207674_10072129 | |||
| 639 | Ga0207674_10078283 | |||
| 640 | Ga0207698_10266079 | |||
| 641 | Ga0268264_10007357 | |||
| 642 | Ga0265338_10289075 | |||
| 643 | Ga0265338_10433674 | |||
| 644 | Ga0265324_10006307 | |||
| 645 | Ga0265775_103853 | |||
| 646 | Ga0265777_101624 | |||
| 647 | Ga0265777_104845 | |||
| 648 | Ga0265777_106509 | |||
| 649 | Ga0265777_107282 | |||
| 650 | Ga0265779_101044 | |||
| 651 | Ga0265760_10045326 | |||
| 652 | Ga0265332_10085422 | |||
| 653 | Ga0265328_10050897 | |||
| 654 | Ga0265320_10000779 | |||
| 655 | Ga0265325_10001705 | |||
| 656 | Ga0265325_10047172 | |||
| 657 | Ga0265325_10078391 | |||
| 658 | Ga0265329_10008974 | |||
| 659 | Ga0265339_10049867 | |||
| 660 | Ga0265331_10003601 | |||
| 661 | Ga0265331_10117021 | |||
| 662 | Ga0265316_10001298 | |||
| 663 | Ga0265316_10007261 | |||
| 664 | Ga0265316_10197842 | |||
| 665 | Ga0265316_10333756 | |||
| 666 | Ga0310117_109268 | |||
| 667 | Ga0265313_10061234 | |||
| 668 | Ga0265313_10112129 | |||
| 669 | Ga0265314_10001835 | |||
| 670 | Ga0265314_10005185 | |||
| 671 | Ga0265314_10266275 | |||
| 672 | Ga0265342_10020418 | |||
| 673 | Ga0316053_100463 | |||
| 674 | Ga0373934_0006803 | |||
| 675 | Ga0373953_0004738 | |||
| 676 | Ga0373954_0010480 | |||
| 677 | Ga0373946_0282990 | |||
| 678 | Ga0373955_0309569 | |||
| 679 | Ga0373931_0288011 | |||
| 680 | Ga0373935_0044987 | |||
| 681 | Ga0373927_0001625 | |||
| 682 | Ga0373947_0035533 | |||
| 683 | Ga0373937_0014919 | |||
| 684 | Ga0373937_0342278 | |||
| 685 | Ga0265778_001259 | |||
| 686 | Ga0265778_003139 | |||
| 687 | Ga0265778_004236 | |||
| 688 | Ga0265778_005463 | |||
| 689 | Ga0265778_005593 | |||
| 690 | Ga0265778_006407 | |||
| 691 | Ga0265778_006637 | |||
| 692 | Ga0265778_007714 | |||
| 693 | Ga0265778_015077 | |||
| 694 | Ga0265778_015431 | |||
| 695 | Ga0265778_020314 | |||
| 696 | Ga0265778_022756 | |||
| 697 | Ga0265778_025844 | |||
| 698 | Ga0373925_0066891 | |||
| 699 | Ga0373925_0356552 | |||
| 700 | Ga0466970_0260482 | |||
| 701 | Ga0466967_0164423 | |||
| 702 | Ga0495651_0417035 | |||
| 703 | Ga0495651_0550497 | |||
| 704 | Ga0495580_0002841 | |||
| 705 | Ga0495580_0235321 | |||
| 706 | Ga0495639_0195444 | |||
| 707 | Ga0495664_0054244 | |||
| 708 | Ga0495594_0216912 | |||
| 709 | Ga0495586_0259209 | |||
| 710 | Ga0495587_0067746 | |||
| 711 | Ga0495633_0136866 | |||
| 712 | Ga0495667_0224834 | |||
| 713 | Ga0495599_0064865 | |||
| 714 | Ga0495599_0158626 | |||
| 715 | Ga0495604_0388420 | |||
| 716 | Ga0495675_0282759 | |||
| 717 | Ga0495684_0021708 | |||
| 718 | Ga0495684_0586609 | |||
| 719 | Ga0495602_0115227 | |||
| 720 | Ga0495602_0124824 | |||
| 721 | Ga0501083_0327974 | |||
| 722 | Ga0500616_0000172 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ofn-assembly1.cif.gz_A | nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 | 0.701 | 22 | 184 |
| 7ofn-assembly1.cif.gz_A | nmr solution structure of the sylf domain of burkholderia pseudomallei bpsl1445 | 0.6826 | 22 | 184 |
| 7rfq-assembly1.cif.gz_A | structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) | 0.6287 | 25 | 186 |
| 5uc0-assembly1.cif.gz_A | crystal structure of beta-barrel-like, uncharacterized protein of cog5400 from brucella abortus | 0.5198 | 55 | 184 |
| 7rfq-assembly1.cif.gz_A | structure of bacterial sylf domain containing protein, beta cell expansion factor a (befa) | 0.4766 | 25 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9GPT6_24_328_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6117 | 56 | 97 | 3.40.50.300 |
| af_Q0P424_16_257_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.5786 | 56 | 99 | 3.40.50.300 |
| af_Q1LXC9_1_246_1.25.40.180 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.54 | 15 | 54 | 1.25.40.180 |
| af_G5EBZ8_106_381_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.4602 | 62 | 100 | 1.10.510.10 |
| af_P47042_168_280_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.4414 | 62 | 106 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W0AZ58-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.9037 | 21 | 222 |
GO:0035091
|
| AF-A0A1F2RLU0-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.9024 | 25 | 227 |
GO:0035091
|
| AF-A0A2V9ZXT5-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.9018 | 25 | 224 |
GO:0035091
|
| AF-A0A1Q6XHR1-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.9017 | 26 | 223 |
GO:0035091
|
| AF-A0A2V9VGL0-F1-model_v4 | Ysc84 actin-binding domain-containing protein | 0.9005 | 26 | 223 |
GO:0035091
|