F421437

General Info

Members Datasets Scaffolds Average Seq Length
359 221 718 128

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10020123|Ga0070709_100201233
Length 154
Sequence MERITESPLALYQAHLERGELAYQWSPEAARAVFYPRVICPFTGSDRLEWRVSAGFGTVYATTVTHPREGVPYNVALIDCDEGFRLMSRVEDIAPEAVKIGMRVRFRVHRPGGDEPAYPVFVPWVDSPQPALGQSPEPRSGIRPRGTGSVGETA

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.06
Nodule 0
Rhizoplane 3.34
Rhizosphere 89.97
Stem 0
Stem Tuber 0
Unclassified 23.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10020123 3300005434 Bacteria 3868
2 JGI24744J21845_10096757 3300002077 Unclassified 544
3 Ga0065714_10158206 3300005288 Bacteria 1051
4 Ga0070676_10382849 3300005328 Unclassified 974
5 Ga0070690_100152107 3300005330 Bacteria 1580
6 Ga0070670_100069884 3300005331 Bacteria 3014
7 Ga0070677_10103920 3300005333 Bacteria 1257
8 Ga0070666_10360366 3300005335 Bacteria 1041
9 Ga0068868_101701761 3300005338 Bacteria 594
10 Ga0070691_10008261 3300005341 Bacteria 4769
11 Ga0070687_100342416 3300005343 Unclassified 962
12 Ga0070687_100391782 3300005343 Bacteria 908
13 Ga0070661_101650503 3300005344 Unclassified 542
14 Ga0070668_100231366 3300005347 Bacteria 1528
15 Ga0070675_100085805 3300005354 Bacteria 2630
16 Ga0070675_100608398 3300005354 Unclassified 991
17 Ga0070671_100700040 3300005355 Bacteria 879
18 Ga0070671_100738918 3300005355 Bacteria 855
19 Ga0070674_100438587 3300005356 Bacteria 1075
20 Ga0070673_100424537 3300005364 Bacteria 1192
21 Ga0070688_100617429 3300005365 Unclassified 831
22 Ga0070659_100571189 3300005366 Bacteria 970
23 Ga0070659_101085604 3300005366 Bacteria 705
24 Ga0070659_102091645 3300005366 Unclassified 509
25 Ga0070667_101302621 3300005367 Bacteria 681
26 Ga0070667_101361716 3300005367 Bacteria 665
27 Ga0070714_100012804 3300005435 Bacteria 6703
28 Ga0070714_100082291 3300005435 Bacteria 2804
29 Ga0070713_100004027 3300005436 Bacteria 9788
30 Ga0070713_100013900 3300005436 Bacteria 5959
31 Ga0070713_100255582 3300005436 Bacteria 1600
32 Ga0070713_101435066 3300005436 Bacteria 669
33 Ga0070710_10006836 3300005437 Bacteria 5503
34 Ga0070710_10020347 3300005437 Bacteria 3442
35 Ga0070710_10072902 3300005437 Bacteria 1984
36 Ga0070710_10317141 3300005437 Bacteria 1022
37 Ga0070701_10055908 3300005438 Bacteria 2063
38 Ga0070711_100002575 3300005439 Bacteria 10377
39 Ga0070711_100016279 3300005439 Bacteria 4721
40 Ga0070711_100026150 3300005439 Bacteria 3823
41 Ga0070711_100062177 3300005439 Bacteria 2602
42 Ga0070705_100001752 3300005440 Bacteria 11274
43 Ga0070700_100001240 3300005441 Bacteria 12647
44 Ga0070700_100302674 3300005441 Bacteria 1168
45 Ga0070694_100000721 3300005444 Bacteria 18419
46 Ga0070708_100018150 3300005445 Bacteria 5885
47 Ga0070663_100001836 3300005455 Bacteria 11831
48 Ga0070662_100061568 3300005457 Bacteria 2740
49 Ga0070662_100175570 3300005457 Bacteria 1686
50 Ga0070662_100929530 3300005457 Bacteria 743
51 Ga0070662_101267166 3300005457 Unclassified 634
52 Ga0070681_10041585 3300005458 Bacteria 4607
53 Ga0070681_10313177 3300005458 Bacteria 1479
54 Ga0070681_11308385 3300005458 Bacteria 648
55 Ga0070681_11504470 3300005458 Unclassified 598
56 Ga0068867_100027133 3300005459 Bacteria 4115
57 Ga0068867_100924793 3300005459 Unclassified 786
58 Ga0070685_10152957 3300005466 Bacteria 1463
59 Ga0070706_100056180 3300005467 Bacteria 3633
60 Ga0070706_101060710 3300005467 Unclassified 746
61 Ga0070707_100356864 3300005468 Bacteria 1420
62 Ga0070698_100001462 3300005471 Bacteria 26223
63 Ga0070699_100004791 3300005518 Bacteria 11959
64 Ga0070699_100609625 3300005518 Bacteria 996
65 Ga0070679_100331193 3300005530 Bacteria 1471
66 Ga0070684_100033728 3300005535 Bacteria 4374
67 Ga0070697_100096778 3300005536 Bacteria 2449
68 Ga0070697_100297119 3300005536 Bacteria 1388
69 Ga0068853_100158753 3300005539 Bacteria 2039
70 Ga0068853_100593196 3300005539 Unclassified 1052
71 Ga0068853_101474312 3300005539 Unclassified 659
72 Ga0070672_100147070 3300005543 Bacteria 1947
73 Ga0070686_100134181 3300005544 Unclassified 1715
74 Ga0070695_100000491 3300005545 Bacteria 20670
75 Ga0070696_100001188 3300005546 Bacteria 16894
76 Ga0070693_100011736 3300005547 Bacteria 4417
77 Ga0070693_100219407 3300005547 Bacteria 1245
78 Ga0070693_100577912 3300005547 Bacteria 808
79 Ga0070693_100766628 3300005547 Bacteria 712
80 Ga0070665_100356733 3300005548 Bacteria 1468
81 Ga0070665_100532502 3300005548 Bacteria 1187
82 Ga0070665_101617365 3300005548 Unclassified 656
83 Ga0070704_100000359 3300005549 Bacteria 20656
84 Ga0070664_100088593 3300005564 Bacteria 2676
85 Ga0070664_102001431 3300005564 Unclassified 550
86 Ga0068857_100106734 3300005577 Bacteria 2515
87 Ga0068857_100412227 3300005577 Bacteria 1258
88 Ga0068854_100514339 3300005578 Bacteria 1010
89 Ga0068856_100344913 3300005614 Bacteria 1508
90 Ga0070702_100034295 3300005615 Bacteria 2797
91 Ga0070702_100694647 3300005615 Bacteria 775
92 Ga0068859_100001076 3300005617 Bacteria 27913
93 Ga0068859_101902113 3300005617 Bacteria 657
94 Ga0068864_100080843 3300005618 Bacteria 2848
95 Ga0068864_100188787 3300005618 Bacteria 1888
96 Ga0068864_100529499 3300005618 Bacteria 1137
97 Ga0068864_102361008 3300005618 Bacteria 538
98 Ga0068866_10363919 3300005718 Unclassified 923
99 Ga0068861_100132537 3300005719 Unclassified 2024
100 Ga0068861_100249583 3300005719 Bacteria 1513
101 Ga0068870_10082466 3300005840 Bacteria 1781
102 Ga0068870_10671274 3300005840 Unclassified 712
103 Ga0068863_100915664 3300005841 Unclassified 877
104 Ga0068858_100320131 3300005842 Bacteria 1482
105 Ga0068858_100721194 3300005842 Unclassified 971
106 Ga0068860_100023650 3300005843 Bacteria 5938
107 Ga0068860_100267469 3300005843 Bacteria 1668
108 Ga0068860_100732288 3300005843 Bacteria 1000
109 Ga0068862_100002529 3300005844 Bacteria 16186
110 Ga0068862_102132184 3300005844 Unclassified 572
111 Ga0070717_10000568 3300006028 Bacteria 23584
112 Ga0070717_10015958 3300006028 Bacteria 5814
113 Ga0070717_10112082 3300006028 Bacteria 2328
114 Ga0070717_10191795 3300006028 Bacteria 1786
115 Ga0075363_100487968 3300006048 Bacteria 730
116 Ga0075364_10090758 3300006051 Bacteria 2026
117 Ga0070715_10131587 3300006163 Bacteria 1205
118 Ga0070715_10495012 3300006163 Bacteria 699
119 Ga0070716_100326376 3300006173 Bacteria 1077
120 Ga0070716_100402545 3300006173 Unclassified 985
121 Ga0070716_100408331 3300006173 Unclassified 979
122 Ga0070712_100003850 3300006175 Bacteria 9237
123 Ga0070712_100012033 3300006175 Bacteria 5498
124 Ga0070712_100044087 3300006175 Bacteria 3074
125 Ga0075362_10076304 3300006177 Bacteria 1538
126 Ga0075367_10299084 3300006178 Unclassified 1013
127 Ga0075366_10021166 3300006195 Bacteria 3780
128 Ga0075366_10228970 3300006195 Bacteria 1132
129 Ga0097621_100318236 3300006237 Unclassified 1377
130 Ga0097621_100472089 3300006237 Bacteria 1133
131 Ga0097621_101355067 3300006237 Bacteria 673
132 Ga0097621_101743533 3300006237 Bacteria 593
133 Ga0075370_10846921 3300006353 Unclassified 558
134 Ga0075428_100379633 3300006844 Bacteria 1515
135 Ga0075433_10110770 3300006852 Bacteria 2436
136 Ga0075434_100012749 3300006871 Bacteria 7979
137 Ga0075434_100486351 3300006871 Bacteria 1255
138 Ga0075434_101569142 3300006871 Unclassified 667
139 Ga0068865_100403804 3300006881 Bacteria 1120
140 Ga0097620_100001076 3300006931 Bacteria 27913
141 Ga0097620_101901589 3300006931 Bacteria 657
142 Ga0075435_100075028 3300007076 Unclassified 2768
143 Ga0075435_101264445 3300007076 Bacteria 646
144 Ga0105240_10176465 3300009093 Bacteria 2526
145 Ga0111539_10235866 3300009094 Bacteria 2130
146 Ga0111539_11709061 3300009094 Bacteria 730
147 Ga0105245_10961150 3300009098 Unclassified 897
148 Ga0105245_11526373 3300009098 Bacteria 719
149 Ga0105247_10016070 3300009101 Bacteria 4484
150 Ga0105247_10137423 3300009101 Unclassified 1598
151 Ga0114129_13107816 3300009147 Unclassified 542
152 Ga0114129_13451757 3300009147 Bacteria 507
153 Ga0105243_10440592 3300009148 Unclassified 1220
154 Ga0105243_10629185 3300009148 Unclassified 1037
155 Ga0105241_10682662 3300009174 Unclassified 936
156 Ga0105242_10486612 3300009176 Bacteria 1170
157 Ga0105242_10824192 3300009176 Unclassified 921
158 Ga0105242_11910006 3300009176 Unclassified 634
159 Ga0105248_10111030 3300009177 Bacteria 3092
160 Ga0105248_10325301 3300009177 Unclassified 1732
161 Ga0105237_11283934 3300009545 Bacteria 738
162 Ga0105238_10175947 3300009551 Bacteria 2117
163 Ga0105238_10234264 3300009551 Bacteria 1813
164 Ga0105249_10015125 3300009553 Bacteria 6828
165 Ga0105249_10493036 3300009553 Bacteria 1269
166 Ga0105249_10567974 3300009553 Bacteria 1186
167 Ga0105249_10650097 3300009553 Bacteria 1112
168 Ga0099796_10085319 3300010159 Bacteria 1165
169 Ga0099796_10325200 3300010159 Bacteria 657
170 Ga0105239_10020621 3300010375 Bacteria 7271
171 Ga0105239_11137236 3300010375 Unclassified 899
172 Ga0105246_10054173 3300011119 Bacteria 2763
173 Ga0105246_10563407 3300011119 Bacteria 978
174 Ga0157374_10360606 3300013296 Bacteria 1445
175 Ga0157374_10583221 3300013296 Bacteria 1127
176 Ga0157378_10885805 3300013297 Unclassified 923
177 Ga0157378_11423645 3300013297 Unclassified 736
178 Ga0163162_11087828 3300013306 Bacteria 906
179 Ga0157375_10262533 3300013308 Bacteria 1888
180 Ga0163163_10158569 3300014325 Bacteria 2308
181 Ga0157379_10397341 3300014968 Bacteria 1267
182 Ga0157379_11187708 3300014968 Bacteria 733
183 Ga0157376_10114296 3300014969 Bacteria 2381
184 Ga0163161_10467227 3300017792 Bacteria 1022
185 Ga0213876_10587142 3300021384 Bacteria 593
186 Ga0213875_10000507 3300021388 Bacteria 32619
187 Ga0213875_10176853 3300021388 Bacteria 1002
188 Ga0213875_10328340 3300021388 Bacteria 725
189 Ga0207697_10252801 3300025315 Bacteria 780
190 Ga0207653_10001065 3300025885 Bacteria 9012
191 Ga0207682_10023924 3300025893 Bacteria 2416
192 Ga0207692_10074255 3300025898 Bacteria 1801
193 Ga0207692_10205870 3300025898 Unclassified 1159
194 Ga0207692_10271472 3300025898 Bacteria 1023
195 Ga0207692_10314244 3300025898 Unclassified 957
196 Ga0207710_10107022 3300025900 Unclassified 1325
197 Ga0207688_10034707 3300025901 Bacteria 2794
198 Ga0207685_10159156 3300025905 Bacteria 1029
199 Ga0207699_10007070 3300025906 Bacteria 5470
200 Ga0207645_10035587 3300025907 Bacteria 3197
201 Ga0207684_10071453 3300025910 Bacteria 2949
202 Ga0207684_10866170 3300025910 Unclassified 761
203 Ga0207654_10533115 3300025911 Unclassified 832
204 Ga0207707_10014686 3300025912 Bacteria 6823
205 Ga0207693_10001671 3300025915 Bacteria 19555
206 Ga0207693_10002405 3300025915 Bacteria 16247
207 Ga0207693_10025036 3300025915 Bacteria 4734
208 Ga0207693_10074641 3300025915 Bacteria 2656
209 Ga0207693_10094327 3300025915 Bacteria 2345
210 Ga0207693_10877535 3300025915 Unclassified 689
211 Ga0207663_10009646 3300025916 Bacteria 5108
212 Ga0207660_10027676 3300025917 Bacteria 3872
213 Ga0207662_10049984 3300025918 Bacteria 2482
214 Ga0207662_10241800 3300025918 Unclassified 1182
215 Ga0207657_11177561 3300025919 Unclassified 583
216 Ga0207657_11186915 3300025919 Bacteria 580
217 Ga0207652_10298631 3300025921 Bacteria 1454
218 Ga0207694_10160115 3300025924 Bacteria 1818
219 Ga0207694_10274357 3300025924 Bacteria 1384
220 Ga0207650_10113167 3300025925 Bacteria 2104
221 Ga0207650_11112209 3300025925 Unclassified 672
222 Ga0207659_10291943 3300025926 Bacteria 1336
223 Ga0207687_10246080 3300025927 Bacteria 1419
224 Ga0207687_10405755 3300025927 Bacteria 1122
225 Ga0207700_10035557 3300025928 Bacteria 3589
226 Ga0207700_10099792 3300025928 Bacteria 2312
227 Ga0207664_10031783 3300025929 Bacteria 4042
228 Ga0207664_10387488 3300025929 Bacteria 1241
229 Ga0207664_10585819 3300025929 Unclassified 1001
230 Ga0207644_10759312 3300025931 Bacteria 810
231 Ga0207644_11231165 3300025931 Unclassified 629
232 Ga0207690_10509934 3300025932 Unclassified 974
233 Ga0207706_10099431 3300025933 Bacteria 2559
234 Ga0207706_10124198 3300025933 Bacteria 2271
235 Ga0207686_10309865 3300025934 Unclassified 1175
236 Ga0207669_10395002 3300025937 Bacteria 1081
237 Ga0207704_10347289 3300025938 Bacteria 1154
238 Ga0207665_10205373 3300025939 Bacteria 1437
239 Ga0207665_10213685 3300025939 Unclassified 1410
240 Ga0207665_10509151 3300025939 Bacteria 931
241 Ga0207691_10131962 3300025940 Bacteria 2205
242 Ga0207711_11010593 3300025941 Unclassified 771
243 Ga0207689_10466876 3300025942 Bacteria 1056
244 Ga0207679_10117931 3300025945 Bacteria 2107
245 Ga0207679_10899814 3300025945 Bacteria 809
246 Ga0207651_10818111 3300025960 Unclassified 826
247 Ga0207712_10004848 3300025961 Bacteria 8501
248 Ga0207712_10427391 3300025961 Bacteria 1119
249 Ga0207712_11169958 3300025961 Unclassified 686
250 Ga0207712_11238283 3300025961 Bacteria 666
251 Ga0207677_10151782 3300026023 Unclassified 1788
252 Ga0207677_10578678 3300026023 Unclassified 982
253 Ga0207703_10249834 3300026035 Bacteria 1598
254 Ga0207703_10731390 3300026035 Unclassified 942
255 Ga0207639_10187704 3300026041 Bacteria 1763
256 Ga0207639_10196078 3300026041 Bacteria 1729
257 Ga0207639_10569997 3300026041 Bacteria 1041
258 Ga0207678_10008871 3300026067 Bacteria 8855
259 Ga0207678_10952431 3300026067 Unclassified 759
260 Ga0207678_11500204 3300026067 Bacteria 595
261 Ga0207708_10002036 3300026075 Bacteria 14911
262 Ga0207708_10508226 3300026075 Unclassified 1011
263 Ga0207702_10192773 3300026078 Bacteria 1884
264 Ga0207702_11099638 3300026078 Bacteria 789
265 Ga0207641_10289633 3300026088 Bacteria 1543
266 Ga0207641_10393743 3300026088 Bacteria 1329
267 Ga0207648_10031256 3300026089 Bacteria 4707
268 Ga0207676_10027191 3300026095 Bacteria 4259
269 Ga0207676_10051757 3300026095 Bacteria 3207
270 Ga0207674_10042073 3300026116 Bacteria 4722
271 Ga0207674_10252531 3300026116 Bacteria 1710
272 Ga0207675_100091163 3300026118 Bacteria 2866
273 Ga0207675_100695515 3300026118 Bacteria 1025
274 Ga0207675_100795741 3300026118 Bacteria 959
275 Ga0207683_10008635 3300026121 Bacteria 8711
276 Ga0207698_10337557 3300026142 Bacteria 1418
277 Ga0268265_10001384 3300028380 Bacteria 20558
278 Ga0268265_12364763 3300028380 Bacteria 538
279 Ga0268264_10129893 3300028381 Bacteria 2231
280 Ga0268264_10632436 3300028381 Bacteria 1058
281 Ga0265762_1031564 3300030760 Bacteria 1008
282 Ga0265325_10004299 3300031241 Bacteria 9029
283 Ga0373940_0247286 3300035088 Unclassified 600
284 Ga0373945_0305746 3300035116 Bacteria 682
285 Ga0373953_0015017 3300035117 Unclassified 2797
286 Ga0373943_0264341 3300035170 Bacteria 969
287 Ga0373946_0398889 3300035171 Unclassified 694
288 Ga0373931_0215067 3300035691 Bacteria 1155
289 Ga0373931_0770297 3300035691 Bacteria 640
290 Ga0373927_0473210 3300035695 Bacteria 828
291 Ga0373927_0621193 3300035695 Bacteria 714
292 Ga0373933_0585498 3300035724 Bacteria 732
293 Ga0373925_0533143 3300037068 Unclassified 965
294 Ga0373925_1677049 3300037068 Unclassified 519
295 Ga0436364_0773657 3300037853 Bacteria 23513
296 Ga0436364_0811068 3300037853 Bacteria 1131
297 Ga0436364_1033644 3300037853 Bacteria 4694
298 Ga0436365_0565632 3300039437 Bacteria 1032
299 Ga0436365_1014785 3300039437 Bacteria 1167
300 Ga0436360_0473416 3300039438 Bacteria 1015
301 Ga0436360_0717056 3300039438 Bacteria 2111
302 Ga0436363_0079683 3300039450 Bacteria 5075
303 Ga0436363_1205318 3300039450 Bacteria 1076
304 Ga0436362_0130671 3300039453 Bacteria 2917
305 Ga0436362_0856830 3300039453 Bacteria 918
306 Ga0451798_0877005 3300041458 Bacteria 626
307 Ga0451849_1435615 3300041505 Bacteria 1014
308 Ga0451853_2076847 3300041512 Unclassified 999
309 Ga0439440_0203833 3300042993 Unclassified 587
310 Ga0495592_0427506 3300046454 Unclassified 834
311 Ga0495605_0072602 3300046474 Bacteria 1622
312 Ga0495662_0143391 3300046476 Bacteria 1176
313 Ga0495598_0014600 3300046537 Bacteria 1967
314 Ga0495656_0041795 3300046615 Bacteria 1917
315 Ga0495635_0262670 3300046663 Unclassified 1162
316 Ga0495657_0309447 3300046675 Bacteria 941
317 Ga0495636_0652332 3300047318 Unclassified 517
318 Ga0495685_069007 3300047447 Bacteria 1186
319 Ga0495684_0465477 3300047471 Bacteria 876
320 Ga0495602_0932835 3300048088 Bacteria 576
321 Ga0495602_0991302 3300048088 Bacteria 555
322 Ga0496102_0013045 3300048905 Bacteria 7194
323 Ga0496104_0681000 3300048907 Unclassified 936
324 Ga0496105_0117665 3300048908 Bacteria 2192
325 Ga0496106_0001409 3300048909 Bacteria 18039
326 Ga0496106_0662054 3300048909 Bacteria 834
327 Ga0496107_0012428 3300048910 Bacteria 5945
328 Ga0496108_0491144 3300048911 Unclassified 1072
329 Ga0496109_0526913 3300048912 Bacteria 1115
330 Ga0496110_0321275 3300048913 Bacteria 1410
331 Ga0496114_1071769 3300048917 Unclassified 690
332 Ga0496115_0046705 3300048918 Bacteria 3462
333 Ga0501036_0397383 3300049572 Unclassified 1150
334 Ga0501039_0386338 3300049575 Bacteria 1100
335 Ga0501040_0467687 3300049576 Bacteria 908
336 Ga0501071_0569507 3300049587 Bacteria 870
337 Ga0501071_0943576 3300049587 Unclassified 666
338 Ga0501072_0017498 3300049588 Bacteria 5509
339 Ga0501076_0165211 3300049592 Bacteria 1804
340 Ga0501077_0048290 3300049593 Bacteria 2704
341 Ga0501079_0043619 3300049741 Bacteria 3462
342 Ga0501081_0806192 3300049743 Bacteria 707
343 Ga0501045_0016140 3300049824 Bacteria 5300
344 nmdc:mga0k408_329561_c1 3300050493 Bacteria 911
345 nmdc:mga06z11_503006_c1 3300050494 Unclassified 734
346 nmdc:mga06z11_801996_c1 3300050494 Unclassified 574
347 nmdc:mga07m45_442225_c1 3300050496 Unclassified 754
348 nmdc:mga08y16_1096389_c1 3300050511 Bacteria 771
349 nmdc:mga0n895_1173014_c1 3300050512 Bacteria 743
350 nmdc:mga0n895_31799_c1 3300050512 Bacteria 5057
351 nmdc:mga0rr50_7998_c1 3300050513 Bacteria 6558
352 nmdc:mga08x19_1137611_c1 3300050514 Unclassified 554
353 nmdc:mga0a205_46071_c1 3300050515 Bacteria 4205
354 Ga0495601_0009728 3300053077 Bacteria 5686
355 Ga0495601_0024826 3300053077 Bacteria 3691
356 Ga0495595_0010985 3300053084 Bacteria 3779
357 Ga0495619_0354467 3300053085 Bacteria 1015
358 Ga0501082_0001201 3300060353 Bacteria 22794
359 Ga0530510_0123720 3300061734 Unclassified 1900
360 Ga0070709_10020123
361 JGI24744J21845_10096757
362 Ga0065714_10158206
363 Ga0070676_10382849
364 Ga0070690_100152107
365 Ga0070670_100069884
366 Ga0070677_10103920
367 Ga0070666_10360366
368 Ga0068868_101701761
369 Ga0070691_10008261
370 Ga0070687_100342416
371 Ga0070687_100391782
372 Ga0070661_101650503
373 Ga0070668_100231366
374 Ga0070675_100085805
375 Ga0070675_100608398
376 Ga0070671_100700040
377 Ga0070671_100738918
378 Ga0070674_100438587
379 Ga0070673_100424537
380 Ga0070688_100617429
381 Ga0070659_100571189
382 Ga0070659_101085604
383 Ga0070659_102091645
384 Ga0070667_101302621
385 Ga0070667_101361716
386 Ga0070714_100012804
387 Ga0070714_100082291
388 Ga0070713_100004027
389 Ga0070713_100013900
390 Ga0070713_100255582
391 Ga0070713_101435066
392 Ga0070710_10006836
393 Ga0070710_10020347
394 Ga0070710_10072902
395 Ga0070710_10317141
396 Ga0070701_10055908
397 Ga0070711_100002575
398 Ga0070711_100016279
399 Ga0070711_100026150
400 Ga0070711_100062177
401 Ga0070705_100001752
402 Ga0070700_100001240
403 Ga0070700_100302674
404 Ga0070694_100000721
405 Ga0070708_100018150
406 Ga0070663_100001836
407 Ga0070662_100061568
408 Ga0070662_100175570
409 Ga0070662_100929530
410 Ga0070662_101267166
411 Ga0070681_10041585
412 Ga0070681_10313177
413 Ga0070681_11308385
414 Ga0070681_11504470
415 Ga0068867_100027133
416 Ga0068867_100924793
417 Ga0070685_10152957
418 Ga0070706_100056180
419 Ga0070706_101060710
420 Ga0070707_100356864
421 Ga0070698_100001462
422 Ga0070699_100004791
423 Ga0070699_100609625
424 Ga0070679_100331193
425 Ga0070684_100033728
426 Ga0070697_100096778
427 Ga0070697_100297119
428 Ga0068853_100158753
429 Ga0068853_100593196
430 Ga0068853_101474312
431 Ga0070672_100147070
432 Ga0070686_100134181
433 Ga0070695_100000491
434 Ga0070696_100001188
435 Ga0070693_100011736
436 Ga0070693_100219407
437 Ga0070693_100577912
438 Ga0070693_100766628
439 Ga0070665_100356733
440 Ga0070665_100532502
441 Ga0070665_101617365
442 Ga0070704_100000359
443 Ga0070664_100088593
444 Ga0070664_102001431
445 Ga0068857_100106734
446 Ga0068857_100412227
447 Ga0068854_100514339
448 Ga0068856_100344913
449 Ga0070702_100034295
450 Ga0070702_100694647
451 Ga0068859_100001076
452 Ga0068859_101902113
453 Ga0068864_100080843
454 Ga0068864_100188787
455 Ga0068864_100529499
456 Ga0068864_102361008
457 Ga0068866_10363919
458 Ga0068861_100132537
459 Ga0068861_100249583
460 Ga0068870_10082466
461 Ga0068870_10671274
462 Ga0068863_100915664
463 Ga0068858_100320131
464 Ga0068858_100721194
465 Ga0068860_100023650
466 Ga0068860_100267469
467 Ga0068860_100732288
468 Ga0068862_100002529
469 Ga0068862_102132184
470 Ga0070717_10000568
471 Ga0070717_10015958
472 Ga0070717_10112082
473 Ga0070717_10191795
474 Ga0075363_100487968
475 Ga0075364_10090758
476 Ga0070715_10131587
477 Ga0070715_10495012
478 Ga0070716_100326376
479 Ga0070716_100402545
480 Ga0070716_100408331
481 Ga0070712_100003850
482 Ga0070712_100012033
483 Ga0070712_100044087
484 Ga0075362_10076304
485 Ga0075367_10299084
486 Ga0075366_10021166
487 Ga0075366_10228970
488 Ga0097621_100318236
489 Ga0097621_100472089
490 Ga0097621_101355067
491 Ga0097621_101743533
492 Ga0075370_10846921
493 Ga0075428_100379633
494 Ga0075433_10110770
495 Ga0075434_100012749
496 Ga0075434_100486351
497 Ga0075434_101569142
498 Ga0068865_100403804
499 Ga0097620_100001076
500 Ga0097620_101901589
501 Ga0075435_100075028
502 Ga0075435_101264445
503 Ga0105240_10176465
504 Ga0111539_10235866
505 Ga0111539_11709061
506 Ga0105245_10961150
507 Ga0105245_11526373
508 Ga0105247_10016070
509 Ga0105247_10137423
510 Ga0114129_13107816
511 Ga0114129_13451757
512 Ga0105243_10440592
513 Ga0105243_10629185
514 Ga0105241_10682662
515 Ga0105242_10486612
516 Ga0105242_10824192
517 Ga0105242_11910006
518 Ga0105248_10111030
519 Ga0105248_10325301
520 Ga0105237_11283934
521 Ga0105238_10175947
522 Ga0105238_10234264
523 Ga0105249_10015125
524 Ga0105249_10493036
525 Ga0105249_10567974
526 Ga0105249_10650097
527 Ga0099796_10085319
528 Ga0099796_10325200
529 Ga0105239_10020621
530 Ga0105239_11137236
531 Ga0105246_10054173
532 Ga0105246_10563407
533 Ga0157374_10360606
534 Ga0157374_10583221
535 Ga0157378_10885805
536 Ga0157378_11423645
537 Ga0163162_11087828
538 Ga0157375_10262533
539 Ga0163163_10158569
540 Ga0157379_10397341
541 Ga0157379_11187708
542 Ga0157376_10114296
543 Ga0163161_10467227
544 Ga0213876_10587142
545 Ga0213875_10000507
546 Ga0213875_10176853
547 Ga0213875_10328340
548 Ga0207697_10252801
549 Ga0207653_10001065
550 Ga0207682_10023924
551 Ga0207692_10074255
552 Ga0207692_10205870
553 Ga0207692_10271472
554 Ga0207692_10314244
555 Ga0207710_10107022
556 Ga0207688_10034707
557 Ga0207685_10159156
558 Ga0207699_10007070
559 Ga0207645_10035587
560 Ga0207684_10071453
561 Ga0207684_10866170
562 Ga0207654_10533115
563 Ga0207707_10014686
564 Ga0207693_10001671
565 Ga0207693_10002405
566 Ga0207693_10025036
567 Ga0207693_10074641
568 Ga0207693_10094327
569 Ga0207693_10877535
570 Ga0207663_10009646
571 Ga0207660_10027676
572 Ga0207662_10049984
573 Ga0207662_10241800
574 Ga0207657_11177561
575 Ga0207657_11186915
576 Ga0207652_10298631
577 Ga0207694_10160115
578 Ga0207694_10274357
579 Ga0207650_10113167
580 Ga0207650_11112209
581 Ga0207659_10291943
582 Ga0207687_10246080
583 Ga0207687_10405755
584 Ga0207700_10035557
585 Ga0207700_10099792
586 Ga0207664_10031783
587 Ga0207664_10387488
588 Ga0207664_10585819
589 Ga0207644_10759312
590 Ga0207644_11231165
591 Ga0207690_10509934
592 Ga0207706_10099431
593 Ga0207706_10124198
594 Ga0207686_10309865
595 Ga0207669_10395002
596 Ga0207704_10347289
597 Ga0207665_10205373
598 Ga0207665_10213685
599 Ga0207665_10509151
600 Ga0207691_10131962
601 Ga0207711_11010593
602 Ga0207689_10466876
603 Ga0207679_10117931
604 Ga0207679_10899814
605 Ga0207651_10818111
606 Ga0207712_10004848
607 Ga0207712_10427391
608 Ga0207712_11169958
609 Ga0207712_11238283
610 Ga0207677_10151782
611 Ga0207677_10578678
612 Ga0207703_10249834
613 Ga0207703_10731390
614 Ga0207639_10187704
615 Ga0207639_10196078
616 Ga0207639_10569997
617 Ga0207678_10008871
618 Ga0207678_10952431
619 Ga0207678_11500204
620 Ga0207708_10002036
621 Ga0207708_10508226
622 Ga0207702_10192773
623 Ga0207702_11099638
624 Ga0207641_10289633
625 Ga0207641_10393743
626 Ga0207648_10031256
627 Ga0207676_10027191
628 Ga0207676_10051757
629 Ga0207674_10042073
630 Ga0207674_10252531
631 Ga0207675_100091163
632 Ga0207675_100695515
633 Ga0207675_100795741
634 Ga0207683_10008635
635 Ga0207698_10337557
636 Ga0268265_10001384
637 Ga0268265_12364763
638 Ga0268264_10129893
639 Ga0268264_10632436
640 Ga0265762_1031564
641 Ga0265325_10004299
642 Ga0373940_0247286
643 Ga0373945_0305746
644 Ga0373953_0015017
645 Ga0373943_0264341
646 Ga0373946_0398889
647 Ga0373931_0215067
648 Ga0373931_0770297
649 Ga0373927_0473210
650 Ga0373927_0621193
651 Ga0373933_0585498
652 Ga0373925_0533143
653 Ga0373925_1677049
654 Ga0436364_0773657
655 Ga0436364_0811068
656 Ga0436364_1033644
657 Ga0436365_0565632
658 Ga0436365_1014785
659 Ga0436360_0473416
660 Ga0436360_0717056
661 Ga0436363_0079683
662 Ga0436363_1205318
663 Ga0436362_0130671
664 Ga0436362_0856830
665 Ga0451798_0877005
666 Ga0451849_1435615
667 Ga0451853_2076847
668 Ga0439440_0203833
669 Ga0495592_0427506
670 Ga0495605_0072602
671 Ga0495662_0143391
672 Ga0495598_0014600
673 Ga0495656_0041795
674 Ga0495635_0262670
675 Ga0495657_0309447
676 Ga0495636_0652332
677 Ga0495685_069007
678 Ga0495684_0465477
679 Ga0495602_0932835
680 Ga0495602_0991302
681 Ga0496102_0013045
682 Ga0496104_0681000
683 Ga0496105_0117665
684 Ga0496106_0001409
685 Ga0496106_0662054
686 Ga0496107_0012428
687 Ga0496108_0491144
688 Ga0496109_0526913
689 Ga0496110_0321275
690 Ga0496114_1071769
691 Ga0496115_0046705
692 Ga0501036_0397383
693 Ga0501039_0386338
694 Ga0501040_0467687
695 Ga0501071_0569507
696 Ga0501071_0943576
697 Ga0501072_0017498
698 Ga0501076_0165211
699 Ga0501077_0048290
700 Ga0501079_0043619
701 Ga0501081_0806192
702 Ga0501045_0016140
703 nmdc:mga0k408_329561_c1
704 nmdc:mga06z11_503006_c1
705 nmdc:mga06z11_801996_c1
706 nmdc:mga07m45_442225_c1
707 nmdc:mga08y16_1096389_c1
708 nmdc:mga0n895_1173014_c1
709 nmdc:mga0n895_31799_c1
710 nmdc:mga0rr50_7998_c1
711 nmdc:mga08x19_1137611_c1
712 nmdc:mga0a205_46071_c1
713 Ga0495601_0009728
714 Ga0495601_0024826
715 Ga0495595_0010985
716 Ga0495619_0354467
717 Ga0501082_0001201
718 Ga0530510_0123720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01796

OB_aCoA_assoc

DUF35 OB-fold domain, acyl-CoA-associated

50

109

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.9166 11 123
8hkv-assembly1.cif.gz_L40E cryo-em structures and translocation mechanism of crenarchaeota ribosome 0.8563 23 51
6htj-assembly1.cif.gz_B crystal structure of the translation recovery factor trf from sulfolobus solfataricus 0.843 11 123
6ok1-assembly1.cif.gz_D ltp2-chsh2(duf35) aldolase 0.7984 1 123
6et9-assembly1.cif.gz_F structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.7971 11 123
ID Description Score Start End Superfamily
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8105 57 89 2.30.30.30
5j3bB01 Mainly Beta;Roll;SH3 type barrels.; 0.7846 55 89 2.30.30.30
3irbB01 Special;Helix non-globular;Lyase 2-enoyl-coa Hydratase; Chain; 0.7805 2 52 6.10.30.10
af_P95148_424_493_2.40.50.840 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7418 55 105 2.40.50.840
1vhgB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7392 58 93 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A4Q3PN72-F1-model_v4 deleted 0.9624 2 123
AF-A0A4Q7NH12-F1-model_v4 DUF35 domain-containing protein 0.9581 6 124
AF-A0A1B2R2B3-F1-model_v4 DUF35 domain-containing protein 0.9562 1 123
AF-A0A246Q1S2-F1-model_v4 DUF35 domain-containing protein 0.9539 1 126
AF-A0A811H2Y8-F1-model_v4 DUF35 domain-containing protein 0.953 3 124

Map