F421413

General Info

Members Datasets Scaffolds Average Seq Length
359 190 718 239

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100026720|Ga0070683_1000267202
Length 272
Sequence MPQTFPKNQRNSDWLVGSAVKILDTDHRKRPKGPKPHPXVDNYXXXXTEIEEHFQRRRGSILLLSTLDWALIETWKDAGVPLEAVLRGIDSAFERYDLRPSKTKKINSLAYCAQEVLAASEDMKEASMGVATESKPETGFEVAKIAEFLRRCANQLRSAKLPCATGISAEAVAGDVSVRLQELAEELEAKAFPSRLEDLERRLAVLEEKLFAVLLAALPDDEVGAVRAQSNRELAPYRGKMTAGQIEQLQKQYLHKKLMEKYKLPRVSLFYM

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.89
Metatranscriptomes 1.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.9
Rhizosphere 93.59
Stem 0
Stem Tuber 0
Unclassified 25.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100026720 3300005329 Bacteria 5202
2 rootH1_10068868 3300003323 Bacteria 1245
3 Ga0065712_10080104 3300005290 Unclassified 3143
4 Ga0070683_100133013 3300005329 Bacteria 2354
5 Ga0070683_100218984 3300005329 Unclassified 1809
6 Ga0070670_100001444 3300005331 Bacteria 19071
7 Ga0070670_100071211 3300005331 Unclassified 2985
8 Ga0068869_100153613 3300005334 Bacteria 1787
9 Ga0070666_10006876 3300005335 Bacteria 7008
10 Ga0070680_100107613 3300005336 Unclassified 2319
11 Ga0070682_100067479 3300005337 Unclassified 2278
12 Ga0068868_100000574 3300005338 Bacteria 24648
13 Ga0068868_100005980 3300005338 Bacteria 8588
14 Ga0068868_100016657 3300005338 Bacteria 5465
15 Ga0068868_100021849 3300005338 Bacteria 4823
16 Ga0068868_100382645 3300005338 Bacteria 1211
17 Ga0070687_100032450 3300005343 Bacteria 2569
18 Ga0070661_100016372 3300005344 Bacteria 5240
19 Ga0070661_100225541 3300005344 Bacteria 1438
20 Ga0070671_100234869 3300005355 Bacteria 1556
21 Ga0070673_100078256 3300005364 Unclassified 2675
22 Ga0070659_100051720 3300005366 Unclassified 3230
23 Ga0070709_10024029 3300005434 Bacteria 3585
24 Ga0070709_10028787 3300005434 Unclassified 3316
25 Ga0070714_100425414 3300005435 Bacteria 1258
26 Ga0070713_100245944 3300005436 Unclassified 1630
27 Ga0070713_100658214 3300005436 Bacteria 998
28 Ga0070710_10101138 3300005437 Bacteria 1717
29 Ga0070710_10127234 3300005437 Bacteria 1549
30 Ga0070711_100000532 3300005439 Bacteria 19811
31 Ga0070711_100090640 3300005439 Bacteria 2202
32 Ga0070711_100106981 3300005439 Bacteria 2046
33 Ga0070663_100414029 3300005455 Unclassified 1104
34 Ga0070662_100010913 3300005457 Bacteria 5986
35 Ga0070681_10014252 3300005458 Bacteria 7913
36 Ga0070681_10077487 3300005458 Unclassified 3282
37 Ga0068867_100119869 3300005459 Bacteria 2032
38 Ga0070685_10477777 3300005466 Unclassified 878
39 Ga0070707_100503897 3300005468 Bacteria 1172
40 Ga0070679_100143897 3300005530 Unclassified 2362
41 Ga0070679_100387990 3300005530 Bacteria 1343
42 Ga0070684_100007906 3300005535 Bacteria 8296
43 Ga0070684_100016409 3300005535 Bacteria 6053
44 Ga0070684_100056563 3300005535 Unclassified 3424
45 Ga0070697_100094188 3300005536 Bacteria 2481
46 Ga0068853_100044760 3300005539 Unclassified 3789
47 Ga0068853_100119609 3300005539 Bacteria 2348
48 Ga0070693_100105516 3300005547 Unclassified 1724
49 Ga0070693_100212716 3300005547 Bacteria 1262
50 Ga0070665_100715862 3300005548 Unclassified 1014
51 Ga0068855_100000935 3300005563 Bacteria 36342
52 Ga0068855_100004923 3300005563 Bacteria 16298
53 Ga0068855_100022403 3300005563 Bacteria 7571
54 Ga0068855_100099396 3300005563 Unclassified 3351
55 Ga0068855_100407377 3300005563 Bacteria 1489
56 Ga0070664_100006160 3300005564 Bacteria 9696
57 Ga0070664_100098359 3300005564 Unclassified 2542
58 Ga0068857_100000081 3300005577 Bacteria 55561
59 Ga0068854_100019693 3300005578 Bacteria 4552
60 Ga0068854_100021592 3300005578 Unclassified 4370
61 Ga0068854_100046491 3300005578 Bacteria 3090
62 Ga0068854_100075360 3300005578 Bacteria 2477
63 Ga0068856_100000153 3300005614 Bacteria 70644
64 Ga0068856_100001083 3300005614 Bacteria 28733
65 Ga0068856_100021554 3300005614 Bacteria 6262
66 Ga0068856_100035300 3300005614 Unclassified 4899
67 Ga0068856_100042602 3300005614 Unclassified 4466
68 Ga0070702_100221450 3300005615 Unclassified 1265
69 Ga0070702_100233510 3300005615 Bacteria 1237
70 Ga0068852_100094495 3300005616 Bacteria 2682
71 Ga0068852_100550776 3300005616 Bacteria 1154
72 Ga0068859_100000124 3300005617 Bacteria 73706
73 Ga0068859_100164097 3300005617 Bacteria 2301
74 Ga0068864_100000790 3300005618 Bacteria 26566
75 Ga0068864_100035028 3300005618 Bacteria 4272
76 Ga0068866_10004251 3300005718 Bacteria 5879
77 Ga0068866_10061121 3300005718 Bacteria 1955
78 Ga0068861_100065754 3300005719 Bacteria 2794
79 Ga0068861_100467739 3300005719 Bacteria 1133
80 Ga0068861_100502780 3300005719 Unclassified 1096
81 Ga0068861_100651370 3300005719 Unclassified 973
82 Ga0068851_10080638 3300005834 Unclassified 1699
83 Ga0068863_100008060 3300005841 Bacteria 10287
84 Ga0068863_100083019 3300005841 Bacteria 3036
85 Ga0068863_100128153 3300005841 Unclassified 2422
86 Ga0068863_100184374 3300005841 Unclassified 2004
87 Ga0068863_100219565 3300005841 Bacteria 1831
88 Ga0068858_100000985 3300005842 Bacteria 29388
89 Ga0068858_100002106 3300005842 Bacteria 20203
90 Ga0068858_100013171 3300005842 Bacteria 7794
91 Ga0068858_100020067 3300005842 Bacteria 6250
92 Ga0068858_100338874 3300005842 Bacteria 1439
93 Ga0068860_100033246 3300005843 Bacteria 4950
94 Ga0068860_100508548 3300005843 Unclassified 1203
95 Ga0068862_100076594 3300005844 Unclassified 2895
96 Ga0081455_10172415 3300005937 Unclassified 1646
97 Ga0070717_10065144 3300006028 Unclassified 3028
98 Ga0070717_10080154 3300006028 Bacteria 2739
99 Ga0070717_10247225 3300006028 Bacteria 1575
100 Ga0070715_10006988 3300006163 Bacteria 3863
101 Ga0070716_100003417 3300006173 Bacteria 7468
102 Ga0070716_100015174 3300006173 Unclassified 3953
103 Ga0070712_100007954 3300006175 Bacteria 6647
104 Ga0070712_100098586 3300006175 Bacteria 2156
105 Ga0097621_100000415 3300006237 Bacteria 29789
106 Ga0097621_100001353 3300006237 Bacteria 16875
107 Ga0097621_100006364 3300006237 Bacteria 8379
108 Ga0097621_100028230 3300006237 Bacteria 4422
109 Ga0097621_100099227 3300006237 Unclassified 2448
110 Ga0068871_100007073 3300006358 Bacteria 8000
111 Ga0068871_100059392 3300006358 Bacteria 3115
112 Ga0068871_100190566 3300006358 Bacteria 1766
113 Ga0068871_100457962 3300006358 Unclassified 1144
114 Ga0075430_100008262 3300006846 Bacteria 8789
115 Ga0075431_100012099 3300006847 Bacteria 8707
116 Ga0075433_10001054 3300006852 Bacteria 19757
117 Ga0075434_100000005 3300006871 Bacteria 104425
118 Ga0075434_100011482 3300006871 Bacteria 8359
119 Ga0068865_100062121 3300006881 Bacteria 2621
120 Ga0068865_100485732 3300006881 Bacteria 1027
121 Ga0075436_100000692 3300006914 Bacteria 22235
122 Ga0097620_100000124 3300006931 Bacteria 73706
123 Ga0097620_100164098 3300006931 Bacteria 2301
124 Ga0075435_100000481 3300007076 Bacteria 24216
125 Ga0075435_100055673 3300007076 Bacteria 3195
126 Ga0105240_10013590 3300009093 Bacteria 11171
127 Ga0105240_10026310 3300009093 Bacteria 7633
128 Ga0105240_10254988 3300009093 Bacteria 2027
129 Ga0105245_10000384 3300009098 Bacteria 41154
130 Ga0105245_10041915 3300009098 Bacteria 4082
131 Ga0105245_10101093 3300009098 Unclassified 2668
132 Ga0105245_10993498 3300009098 Bacteria 883
133 Ga0114129_10532764 3300009147 Bacteria 1530
134 Ga0105243_10801045 3300009148 Bacteria 929
135 Ga0105241_10056869 3300009174 Unclassified 3000
136 Ga0105241_10097754 3300009174 Unclassified 2328
137 Ga0105241_10110720 3300009174 Bacteria 2197
138 Ga0105241_10475104 3300009174 Bacteria 1110
139 Ga0105242_10120698 3300009176 Bacteria 2249
140 Ga0105242_10484048 3300009176 Bacteria 1173
141 Ga0105248_10004721 3300009177 Bacteria 15086
142 Ga0105248_10007045 3300009177 Bacteria 12316
143 Ga0105248_10128449 3300009177 Bacteria 2859
144 Ga0105248_10344829 3300009177 Bacteria 1677
145 Ga0105248_10538475 3300009177 Bacteria 1317
146 Ga0105248_10616839 3300009177 Bacteria 1224
147 Ga0105237_10070920 3300009545 Bacteria 3480
148 Ga0105237_10834075 3300009545 Unclassified 929
149 Ga0105238_10029742 3300009551 Bacteria 5564
150 Ga0105238_10032956 3300009551 Bacteria 5273
151 Ga0105238_10185499 3300009551 Unclassified 2056
152 Ga0105239_10107877 3300010375 Bacteria 3085
153 Ga0105239_10145575 3300010375 Bacteria 2642
154 Ga0105239_10398291 3300010375 Bacteria 1558
155 Ga0157373_10378675 3300013100 Bacteria 1012
156 Ga0157370_10037817 3300013104 Bacteria 4673
157 Ga0157370_10261754 3300013104 Bacteria 1598
158 Ga0157369_10013187 3300013105 Bacteria 9353
159 Ga0157369_10033952 3300013105 Bacteria 5603
160 Ga0157369_10307037 3300013105 Bacteria 1650
161 Ga0157369_10661232 3300013105 Bacteria 1077
162 Ga0157374_10000309 3300013296 Bacteria 45241
163 Ga0157374_10000438 3300013296 Bacteria 37746
164 Ga0157374_10027982 3300013296 Bacteria 5090
165 Ga0157374_10114144 3300013296 Unclassified 2600
166 Ga0157374_10817080 3300013296 Unclassified 948
167 Ga0157378_10000014 3300013297 Bacteria 144214
168 Ga0157378_10000169 3300013297 Bacteria 62092
169 Ga0157378_10119361 3300013297 Bacteria 2428
170 Ga0163162_10004993 3300013306 Bacteria 12784
171 Ga0163162_10165275 3300013306 Unclassified 2336
172 Ga0163162_10415078 3300013306 Bacteria 1478
173 Ga0157372_10001303 3300013307 Bacteria 26974
174 Ga0157372_10003244 3300013307 Bacteria 17585
175 Ga0157372_10034710 3300013307 Bacteria 5548
176 Ga0157375_10034994 3300013308 Bacteria 4790
177 Ga0157375_10139743 3300013308 Bacteria 2548
178 Ga0157375_10314502 3300013308 Bacteria 1730
179 Ga0157375_10400882 3300013308 Bacteria 1538
180 Ga0157375_10505354 3300013308 Bacteria 1373
181 Ga0163163_10167177 3300014325 Unclassified 2246
182 Ga0163163_10433157 3300014325 Bacteria 1374
183 Ga0157377_10112717 3300014745 Bacteria 1637
184 Ga0157379_10032014 3300014968 Bacteria 4687
185 Ga0157376_10002277 3300014969 Bacteria 12968
186 Ga0157376_10111024 3300014969 Bacteria 2413
187 Ga0157376_10478101 3300014969 Bacteria 1220
188 Ga0182006_1099737 3300015261 Unclassified 1032
189 Ga0182007_10006869 3300015262 Unclassified 4837
190 Ga0213874_10035056 3300021377 Unclassified 1472
191 Ga0213876_10048528 3300021384 Bacteria 2243
192 Ga0224569_100440 3300022732 Bacteria 3555
193 Ga0224569_105217 3300022732 Unclassified 967
194 Ga0224572_1000824 3300024225 Bacteria 4128
195 Ga0224572_1002693 3300024225 Bacteria 2911
196 Ga0228598_1007798 3300024227 Bacteria 2173
197 Ga0207656_10084188 3300025321 Unclassified 1434
198 Ga0207692_10112921 3300025898 Bacteria 1509
199 Ga0207642_10188754 3300025899 Bacteria 1129
200 Ga0207680_10121695 3300025903 Bacteria 1707
201 Ga0207647_10038042 3300025904 Bacteria 3045
202 Ga0207685_10006278 3300025905 Bacteria 3223
203 Ga0207699_10025598 3300025906 Bacteria 3241
204 Ga0207699_10029893 3300025906 Bacteria 3043
205 Ga0207654_10045492 3300025911 Bacteria 2498
206 Ga0207654_10336778 3300025911 Bacteria 1035
207 Ga0207707_10042466 3300025912 Bacteria 3968
208 Ga0207695_10009961 3300025913 Bacteria 11680
209 Ga0207695_10097721 3300025913 Bacteria 2937
210 Ga0207695_10453035 3300025913 Bacteria 1166
211 Ga0207671_10014606 3300025914 Bacteria 6196
212 Ga0207693_10002166 3300025915 Bacteria 17115
213 Ga0207693_10003898 3300025915 Bacteria 12705
214 Ga0207693_10236623 3300025915 Unclassified 1434
215 Ga0207663_10000987 3300025916 Bacteria 13003
216 Ga0207663_10087892 3300025916 Bacteria 2054
217 Ga0207663_10370763 3300025916 Bacteria 1088
218 Ga0207660_10381719 3300025917 Bacteria 1133
219 Ga0207657_10003283 3300025919 Bacteria 17308
220 Ga0207649_10241126 3300025920 Unclassified 1298
221 Ga0207652_10034544 3300025921 Bacteria 4262
222 Ga0207652_10126837 3300025921 Unclassified 2274
223 Ga0207652_10370630 3300025921 Bacteria 1292
224 Ga0207646_10302394 3300025922 Unclassified 1445
225 Ga0207694_10050821 3300025924 Bacteria 3212
226 Ga0207694_10118110 3300025924 Unclassified 2115
227 Ga0207694_10148285 3300025924 Bacteria 1889
228 Ga0207650_10001853 3300025925 Bacteria 14906
229 Ga0207687_10003488 3300025927 Bacteria 10583
230 Ga0207687_10093203 3300025927 Unclassified 2201
231 Ga0207687_10510572 3300025927 Bacteria 1004
232 Ga0207700_10043185 3300025928 Unclassified 3310
233 Ga0207700_10475078 3300025928 Bacteria 1104
234 Ga0207706_10026687 3300025933 Bacteria 5170
235 Ga0207709_10596501 3300025935 Bacteria 874
236 Ga0207704_10041501 3300025938 Bacteria 2699
237 Ga0207665_10000998 3300025939 Bacteria 19108
238 Ga0207665_10016299 3300025939 Bacteria 4878
239 Ga0207665_10589130 3300025939 Unclassified 867
240 Ga0207711_10004378 3300025941 Bacteria 12044
241 Ga0207711_10267606 3300025941 Bacteria 1572
242 Ga0207711_10361567 3300025941 Bacteria 1345
243 Ga0207689_10208796 3300025942 Bacteria 1613
244 Ga0207689_10392669 3300025942 Unclassified 1156
245 Ga0207661_10107328 3300025944 Bacteria 2355
246 Ga0207661_10253894 3300025944 Bacteria 1564
247 Ga0207679_10007461 3300025945 Bacteria 6939
248 Ga0207667_10027301 3300025949 Bacteria 6216
249 Ga0207667_10039294 3300025949 Bacteria 5044
250 Ga0207651_10170886 3300025960 Bacteria 1714
251 Ga0207640_10008231 3300025981 Bacteria 5782
252 Ga0207677_10030979 3300026023 Bacteria 3422
253 Ga0207677_10254850 3300026023 Bacteria 1427
254 Ga0207677_10435176 3300026023 Bacteria 1120
255 Ga0207703_10001379 3300026035 Bacteria 22200
256 Ga0207703_10006413 3300026035 Bacteria 9403
257 Ga0207703_10037492 3300026035 Bacteria 3862
258 Ga0207703_10186750 3300026035 Bacteria 1833
259 Ga0207639_10093166 3300026041 Bacteria 2415
260 Ga0207639_10097882 3300026041 Bacteria 2364
261 Ga0207639_10143311 3300026041 Unclassified 1993
262 Ga0207678_10382588 3300026067 Unclassified 1217
263 Ga0207702_10003146 3300026078 Bacteria 15286
264 Ga0207702_10003214 3300026078 Bacteria 15088
265 Ga0207702_10052796 3300026078 Unclassified 3441
266 Ga0207641_10010710 3300026088 Bacteria 7520
267 Ga0207641_10105091 3300026088 Unclassified 2494
268 Ga0207641_10135505 3300026088 Bacteria 2216
269 Ga0207641_10187679 3300026088 Bacteria 1898
270 Ga0207648_10029224 3300026089 Bacteria 4888
271 Ga0207648_10049889 3300026089 Bacteria 3660
272 Ga0207676_10025760 3300026095 Unclassified 4366
273 Ga0207674_10001598 3300026116 Bacteria 29172
274 Ga0207674_10149739 3300026116 Unclassified 2291
275 Ga0207675_100354522 3300026118 Bacteria 1438
276 Ga0207675_100390308 3300026118 Bacteria 1370
277 Ga0265355_1003109 3300028036 Bacteria 1206
278 Ga0268264_10031077 3300028381 Bacteria 4378
279 Ga0268264_10348305 3300028381 Unclassified 1409
280 Ga0265762_1000340 3300030760 Bacteria 7915
281 Ga0265770_1003032 3300030878 Unclassified 2281
282 Ga0265760_10002445 3300031090 Bacteria 5418
283 Ga0265760_10003309 3300031090 Bacteria 4718
284 Ga0265340_10059023 3300031247 Unclassified 1841
285 Ga0265339_10101858 3300031249 Bacteria 1493
286 Ga0265331_10123241 3300031250 Bacteria 1185
287 Ga0265316_10000914 3300031344 Bacteria 32110
288 Ga0265316_10100575 3300031344 Bacteria 2198
289 Ga0307408_100029584 3300031548 Unclassified 3797
290 Ga0265314_10000915 3300031711 Bacteria 34762
291 Ga0307405_10075486 3300031731 Unclassified 2184
292 Ga0307410_10034707 3300031852 Unclassified 3270
293 Ga0307410_10430360 3300031852 Bacteria 1072
294 Ga0307409_100042299 3300031995 Bacteria 3411
295 Ga0307409_100066309 3300031995 Unclassified 2846
296 Ga0307411_10031605 3300032005 Bacteria 3260
297 Ga0373936_0040555 3300035113 Bacteria 1865
298 Ga0373943_0018246 3300035170 Bacteria 3222
299 Ga0373943_0134284 3300035170 Bacteria 1327
300 Ga0373931_0075649 3300035691 Bacteria 1847
301 Ga0373935_0330922 3300035692 Bacteria 1083
302 Ga0373927_0053822 3300035695 Bacteria 2604
303 Ga0373937_0389437 3300036401 Unclassified 1322
304 Ga0373925_0001347 3300037068 Bacteria 21411
305 Ga0373925_0033235 3300037068 Bacteria 3802
306 Ga0436364_1111155 3300037853 Bacteria 5901
307 Ga0436364_1174385 3300037853 Unclassified 974
308 Ga0436365_0241478 3300039437 Bacteria 1920
309 Ga0436363_0280122 3300039450 Bacteria 5437
310 Ga0436363_0456680 3300039450 Unclassified 2580
311 Ga0436363_1000482 3300039450 Unclassified 2738
312 Ga0451577_0470482 3300042876 Bacteria 1141
313 Ga0466959_0091385 3300045049 Unclassified 2186
314 Ga0451576_0602781 3300045051 Bacteria 1154
315 Ga0466967_0235777 3300045976 Unclassified 1744
316 Ga0466967_0247798 3300045976 Bacteria 1701
317 Ga0495580_0010988 3300046472 Bacteria 7017
318 Ga0495580_0024324 3300046472 Unclassified 4437
319 Ga0495580_0029412 3300046472 Bacteria 3987
320 Ga0495580_0136809 3300046472 Bacteria 1699
321 Ga0495580_0188844 3300046472 Unclassified 1421
322 Ga0495580_0224876 3300046472 Bacteria 1289
323 Ga0495580_0268746 3300046472 Bacteria 1165
324 Ga0495580_0366092 3300046472 Unclassified 975
325 Ga0495582_0207682 3300046473 Bacteria 1119
326 Ga0495630_0035198 3300046517 Bacteria 3742
327 Ga0495630_0203714 3300046517 Bacteria 1510
328 Ga0495665_0233186 3300046531 Bacteria 950
329 Ga0495670_0270665 3300046691 Bacteria 907
330 Ga0495674_0150551 3300047319 Bacteria 1951
331 Ga0495674_0303460 3300047319 Bacteria 1304
332 Ga0495602_0136506 3300048088 Bacteria 1948
333 Ga0496102_0080863 3300048905 Unclassified 2994
334 Ga0496102_0190421 3300048905 Bacteria 1933
335 Ga0496103_0059311 3300048906 Unclassified 2378
336 Ga0496104_0425688 3300048907 Unclassified 1239
337 Ga0496107_0038283 3300048910 Unclassified 3442
338 Ga0496108_0161040 3300048911 Unclassified 1939
339 Ga0496109_0062620 3300048912 Unclassified 3402
340 Ga0496110_0052784 3300048913 Unclassified 3572
341 Ga0496110_0149561 3300048913 Bacteria 2114
342 Ga0496111_0130892 3300048914 Bacteria 1856
343 Ga0496112_0003006 3300048915 Bacteria 13793
344 Ga0496112_0050160 3300048915 Bacteria 4092
345 Ga0496112_0219689 3300048915 Bacteria 1856
346 Ga0496113_0108066 3300048916 Unclassified 2162
347 Ga0501298_007107 3300049521 Unclassified 1851
348 Ga0501073_0021994 3300049589 Bacteria 4595
349 Ga0501083_0062017 3300049744 Unclassified 2496
350 Ga0501083_0117268 3300049744 Unclassified 1747
351 nmdc:mga05p37_495362_c1 3300050507 Bacteria 1404
352 nmdc:mga0qj67_162438_c1 3300050509 Bacteria 1813
353 nmdc:mga0n895_31_c1 3300050512 Bacteria 81579
354 nmdc:mga0n895_6801_c1 3300050512 Bacteria 9763
355 nmdc:mga0rr50_1154_c1 3300050513 Bacteria 14375
356 nmdc:mga0rr50_46420_c1 3300050513 Bacteria 3198
357 nmdc:mga08x19_3106_c1 3300050514 Bacteria 9030
358 nmdc:mga0a205_562_c1 3300050515 Bacteria 29493
359 Ga0501082_0115452 3300060353 Unclassified 2325
360 Ga0070683_100026720
361 rootH1_10068868
362 Ga0065712_10080104
363 Ga0070683_100133013
364 Ga0070683_100218984
365 Ga0070670_100001444
366 Ga0070670_100071211
367 Ga0068869_100153613
368 Ga0070666_10006876
369 Ga0070680_100107613
370 Ga0070682_100067479
371 Ga0068868_100000574
372 Ga0068868_100005980
373 Ga0068868_100016657
374 Ga0068868_100021849
375 Ga0068868_100382645
376 Ga0070687_100032450
377 Ga0070661_100016372
378 Ga0070661_100225541
379 Ga0070671_100234869
380 Ga0070673_100078256
381 Ga0070659_100051720
382 Ga0070709_10024029
383 Ga0070709_10028787
384 Ga0070714_100425414
385 Ga0070713_100245944
386 Ga0070713_100658214
387 Ga0070710_10101138
388 Ga0070710_10127234
389 Ga0070711_100000532
390 Ga0070711_100090640
391 Ga0070711_100106981
392 Ga0070663_100414029
393 Ga0070662_100010913
394 Ga0070681_10014252
395 Ga0070681_10077487
396 Ga0068867_100119869
397 Ga0070685_10477777
398 Ga0070707_100503897
399 Ga0070679_100143897
400 Ga0070679_100387990
401 Ga0070684_100007906
402 Ga0070684_100016409
403 Ga0070684_100056563
404 Ga0070697_100094188
405 Ga0068853_100044760
406 Ga0068853_100119609
407 Ga0070693_100105516
408 Ga0070693_100212716
409 Ga0070665_100715862
410 Ga0068855_100000935
411 Ga0068855_100004923
412 Ga0068855_100022403
413 Ga0068855_100099396
414 Ga0068855_100407377
415 Ga0070664_100006160
416 Ga0070664_100098359
417 Ga0068857_100000081
418 Ga0068854_100019693
419 Ga0068854_100021592
420 Ga0068854_100046491
421 Ga0068854_100075360
422 Ga0068856_100000153
423 Ga0068856_100001083
424 Ga0068856_100021554
425 Ga0068856_100035300
426 Ga0068856_100042602
427 Ga0070702_100221450
428 Ga0070702_100233510
429 Ga0068852_100094495
430 Ga0068852_100550776
431 Ga0068859_100000124
432 Ga0068859_100164097
433 Ga0068864_100000790
434 Ga0068864_100035028
435 Ga0068866_10004251
436 Ga0068866_10061121
437 Ga0068861_100065754
438 Ga0068861_100467739
439 Ga0068861_100502780
440 Ga0068861_100651370
441 Ga0068851_10080638
442 Ga0068863_100008060
443 Ga0068863_100083019
444 Ga0068863_100128153
445 Ga0068863_100184374
446 Ga0068863_100219565
447 Ga0068858_100000985
448 Ga0068858_100002106
449 Ga0068858_100013171
450 Ga0068858_100020067
451 Ga0068858_100338874
452 Ga0068860_100033246
453 Ga0068860_100508548
454 Ga0068862_100076594
455 Ga0081455_10172415
456 Ga0070717_10065144
457 Ga0070717_10080154
458 Ga0070717_10247225
459 Ga0070715_10006988
460 Ga0070716_100003417
461 Ga0070716_100015174
462 Ga0070712_100007954
463 Ga0070712_100098586
464 Ga0097621_100000415
465 Ga0097621_100001353
466 Ga0097621_100006364
467 Ga0097621_100028230
468 Ga0097621_100099227
469 Ga0068871_100007073
470 Ga0068871_100059392
471 Ga0068871_100190566
472 Ga0068871_100457962
473 Ga0075430_100008262
474 Ga0075431_100012099
475 Ga0075433_10001054
476 Ga0075434_100000005
477 Ga0075434_100011482
478 Ga0068865_100062121
479 Ga0068865_100485732
480 Ga0075436_100000692
481 Ga0097620_100000124
482 Ga0097620_100164098
483 Ga0075435_100000481
484 Ga0075435_100055673
485 Ga0105240_10013590
486 Ga0105240_10026310
487 Ga0105240_10254988
488 Ga0105245_10000384
489 Ga0105245_10041915
490 Ga0105245_10101093
491 Ga0105245_10993498
492 Ga0114129_10532764
493 Ga0105243_10801045
494 Ga0105241_10056869
495 Ga0105241_10097754
496 Ga0105241_10110720
497 Ga0105241_10475104
498 Ga0105242_10120698
499 Ga0105242_10484048
500 Ga0105248_10004721
501 Ga0105248_10007045
502 Ga0105248_10128449
503 Ga0105248_10344829
504 Ga0105248_10538475
505 Ga0105248_10616839
506 Ga0105237_10070920
507 Ga0105237_10834075
508 Ga0105238_10029742
509 Ga0105238_10032956
510 Ga0105238_10185499
511 Ga0105239_10107877
512 Ga0105239_10145575
513 Ga0105239_10398291
514 Ga0157373_10378675
515 Ga0157370_10037817
516 Ga0157370_10261754
517 Ga0157369_10013187
518 Ga0157369_10033952
519 Ga0157369_10307037
520 Ga0157369_10661232
521 Ga0157374_10000309
522 Ga0157374_10000438
523 Ga0157374_10027982
524 Ga0157374_10114144
525 Ga0157374_10817080
526 Ga0157378_10000014
527 Ga0157378_10000169
528 Ga0157378_10119361
529 Ga0163162_10004993
530 Ga0163162_10165275
531 Ga0163162_10415078
532 Ga0157372_10001303
533 Ga0157372_10003244
534 Ga0157372_10034710
535 Ga0157375_10034994
536 Ga0157375_10139743
537 Ga0157375_10314502
538 Ga0157375_10400882
539 Ga0157375_10505354
540 Ga0163163_10167177
541 Ga0163163_10433157
542 Ga0157377_10112717
543 Ga0157379_10032014
544 Ga0157376_10002277
545 Ga0157376_10111024
546 Ga0157376_10478101
547 Ga0182006_1099737
548 Ga0182007_10006869
549 Ga0213874_10035056
550 Ga0213876_10048528
551 Ga0224569_100440
552 Ga0224569_105217
553 Ga0224572_1000824
554 Ga0224572_1002693
555 Ga0228598_1007798
556 Ga0207656_10084188
557 Ga0207692_10112921
558 Ga0207642_10188754
559 Ga0207680_10121695
560 Ga0207647_10038042
561 Ga0207685_10006278
562 Ga0207699_10025598
563 Ga0207699_10029893
564 Ga0207654_10045492
565 Ga0207654_10336778
566 Ga0207707_10042466
567 Ga0207695_10009961
568 Ga0207695_10097721
569 Ga0207695_10453035
570 Ga0207671_10014606
571 Ga0207693_10002166
572 Ga0207693_10003898
573 Ga0207693_10236623
574 Ga0207663_10000987
575 Ga0207663_10087892
576 Ga0207663_10370763
577 Ga0207660_10381719
578 Ga0207657_10003283
579 Ga0207649_10241126
580 Ga0207652_10034544
581 Ga0207652_10126837
582 Ga0207652_10370630
583 Ga0207646_10302394
584 Ga0207694_10050821
585 Ga0207694_10118110
586 Ga0207694_10148285
587 Ga0207650_10001853
588 Ga0207687_10003488
589 Ga0207687_10093203
590 Ga0207687_10510572
591 Ga0207700_10043185
592 Ga0207700_10475078
593 Ga0207706_10026687
594 Ga0207709_10596501
595 Ga0207704_10041501
596 Ga0207665_10000998
597 Ga0207665_10016299
598 Ga0207665_10589130
599 Ga0207711_10004378
600 Ga0207711_10267606
601 Ga0207711_10361567
602 Ga0207689_10208796
603 Ga0207689_10392669
604 Ga0207661_10107328
605 Ga0207661_10253894
606 Ga0207679_10007461
607 Ga0207667_10027301
608 Ga0207667_10039294
609 Ga0207651_10170886
610 Ga0207640_10008231
611 Ga0207677_10030979
612 Ga0207677_10254850
613 Ga0207677_10435176
614 Ga0207703_10001379
615 Ga0207703_10006413
616 Ga0207703_10037492
617 Ga0207703_10186750
618 Ga0207639_10093166
619 Ga0207639_10097882
620 Ga0207639_10143311
621 Ga0207678_10382588
622 Ga0207702_10003146
623 Ga0207702_10003214
624 Ga0207702_10052796
625 Ga0207641_10010710
626 Ga0207641_10105091
627 Ga0207641_10135505
628 Ga0207641_10187679
629 Ga0207648_10029224
630 Ga0207648_10049889
631 Ga0207676_10025760
632 Ga0207674_10001598
633 Ga0207674_10149739
634 Ga0207675_100354522
635 Ga0207675_100390308
636 Ga0265355_1003109
637 Ga0268264_10031077
638 Ga0268264_10348305
639 Ga0265762_1000340
640 Ga0265770_1003032
641 Ga0265760_10002445
642 Ga0265760_10003309
643 Ga0265340_10059023
644 Ga0265339_10101858
645 Ga0265331_10123241
646 Ga0265316_10000914
647 Ga0265316_10100575
648 Ga0307408_100029584
649 Ga0265314_10000915
650 Ga0307405_10075486
651 Ga0307410_10034707
652 Ga0307410_10430360
653 Ga0307409_100042299
654 Ga0307409_100066309
655 Ga0307411_10031605
656 Ga0373936_0040555
657 Ga0373943_0018246
658 Ga0373943_0134284
659 Ga0373931_0075649
660 Ga0373935_0330922
661 Ga0373927_0053822
662 Ga0373937_0389437
663 Ga0373925_0001347
664 Ga0373925_0033235
665 Ga0436364_1111155
666 Ga0436364_1174385
667 Ga0436365_0241478
668 Ga0436363_0280122
669 Ga0436363_0456680
670 Ga0436363_1000482
671 Ga0451577_0470482
672 Ga0466959_0091385
673 Ga0451576_0602781
674 Ga0466967_0235777
675 Ga0466967_0247798
676 Ga0495580_0010988
677 Ga0495580_0024324
678 Ga0495580_0029412
679 Ga0495580_0136809
680 Ga0495580_0188844
681 Ga0495580_0224876
682 Ga0495580_0268746
683 Ga0495580_0366092
684 Ga0495582_0207682
685 Ga0495630_0035198
686 Ga0495630_0203714
687 Ga0495665_0233186
688 Ga0495670_0270665
689 Ga0495674_0150551
690 Ga0495674_0303460
691 Ga0495602_0136506
692 Ga0496102_0080863
693 Ga0496102_0190421
694 Ga0496103_0059311
695 Ga0496104_0425688
696 Ga0496107_0038283
697 Ga0496108_0161040
698 Ga0496109_0062620
699 Ga0496110_0052784
700 Ga0496110_0149561
701 Ga0496111_0130892
702 Ga0496112_0003006
703 Ga0496112_0050160
704 Ga0496112_0219689
705 Ga0496113_0108066
706 Ga0501298_007107
707 Ga0501073_0021994
708 Ga0501083_0062017
709 Ga0501083_0117268
710 nmdc:mga05p37_495362_c1
711 nmdc:mga0qj67_162438_c1
712 nmdc:mga0n895_31_c1
713 nmdc:mga0n895_6801_c1
714 nmdc:mga0rr50_1154_c1
715 nmdc:mga0rr50_46420_c1
716 nmdc:mga08x19_3106_c1
717 nmdc:mga0a205_562_c1
718 Ga0501082_0115452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map