F420657

General Info

Members Datasets Scaffolds Average Seq Length
356 193 712 238

Family's Representative Sequence

Representative Sequence 3300050495|nmdc:mga04h51_32151_c1|nmdc:mga04h51_32151_c1_74_946
Length 290
Sequence LAWNLPVVLAPLIATTLRPASWAYPGAEAPGLPGQNRNARIRRDARDSDNIPPMSGNAATPLKTGEYAERGDYHRQPDQAWDYLPTFLAKLEYVRGYLSALAPGTRVLDAGCGEGILVEEFAGRLAIEGVDPNYVSAHVRRASLLELPYGGGVFERVLCLDVLEHLTYEEQPRALAELHRVLAPSGELLVSSPNLAHLQSRVHFLLTGRLIRTASEIKHPGDRPIAEYLRLFERAGFVVVERRGIFPTVPVLTAWIRRRPAERAWLHRLLTRLIPVPGLAFLNLIRLRRA

Samples

Sample ID Description Type Environment
1 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
139 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
140 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
141 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 0
Rhizoplane 8.71
Rhizosphere 80.06
Stem 0
Stem Tuber 0
Unclassified 19.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga04h51_32151_c1 3300050495 Unclassified 1662
2 Ga0065712_10001426 3300005290 Bacteria 6615
3 Ga0065712_10148379 3300005290 Unclassified 1389
4 Ga0065715_10089094 3300005293 Bacteria 14501
5 Ga0065715_10157753 3300005293 Bacteria 1647
6 Ga0070683_100006066 3300005329 Bacteria 10132
7 Ga0070683_100009991 3300005329 Bacteria 8137
8 Ga0070683_100914841 3300005329 Bacteria 842
9 Ga0070670_100017474 3300005331 Bacteria 6153
10 Ga0070670_100020809 3300005331 Bacteria 5641
11 Ga0068869_100298508 3300005334 Bacteria 1300
12 Ga0068868_100597702 3300005338 Bacteria 977
13 Ga0070689_100218040 3300005340 Bacteria 1564
14 Ga0070668_100058776 3300005347 Bacteria 2975
15 Ga0070669_100000591 3300005353 Bacteria 26963
16 Ga0070675_100037009 3300005354 Bacteria 3973
17 Ga0070675_100194819 3300005354 Bacteria 1757
18 Ga0070671_100024766 3300005355 Bacteria 4915
19 Ga0070671_100179125 3300005355 Bacteria 1794
20 Ga0070674_100006875 3300005356 Bacteria 6667
21 Ga0070673_100005521 3300005364 Bacteria 8101
22 Ga0070673_100675026 3300005364 Unclassified 947
23 Ga0070688_100083639 3300005365 Bacteria 2071
24 Ga0070659_100185280 3300005366 Bacteria 1709
25 Ga0070659_100274989 3300005366 Bacteria 1400
26 Ga0070667_100191584 3300005367 Unclassified 1811
27 Ga0070667_100342002 3300005367 Unclassified 1353
28 Ga0070701_10110488 3300005438 Bacteria 1535
29 Ga0070711_100046400 3300005439 Unclassified 2960
30 Ga0070663_100048041 3300005455 Bacteria 3025
31 Ga0070663_100059271 3300005455 Bacteria 2751
32 Ga0070663_100068398 3300005455 Bacteria 2578
33 Ga0070663_100124514 3300005455 Bacteria 1951
34 Ga0070663_100777988 3300005455 Bacteria 819
35 Ga0070678_100167810 3300005456 Bacteria 1784
36 Ga0070678_100240950 3300005456 Bacteria 1512
37 Ga0070678_100301478 3300005456 Unclassified 1362
38 Ga0070678_100816791 3300005456 Bacteria 847
39 Ga0070662_100137546 3300005457 Bacteria 1890
40 Ga0070662_100319426 3300005457 Bacteria 1266
41 Ga0070662_100419144 3300005457 Bacteria 1107
42 Ga0070662_100521203 3300005457 Bacteria 993
43 Ga0068867_100186380 3300005459 Bacteria 1653
44 Ga0070685_10090468 3300005466 Bacteria 1851
45 Ga0070685_10096314 3300005466 Bacteria 1800
46 Ga0070685_10305040 3300005466 Bacteria 1074
47 Ga0070679_100224453 3300005530 Bacteria 1839
48 Ga0070684_100000794 3300005535 Bacteria 21947
49 Ga0070684_100058079 3300005535 Bacteria 3380
50 Ga0070684_100190455 3300005535 Bacteria 1866
51 Ga0070672_100004257 3300005543 Bacteria 9357
52 Ga0070672_100021194 3300005543 Unclassified 4751
53 Ga0070672_100118059 3300005543 Bacteria 2169
54 Ga0070672_100238479 3300005543 Unclassified 1529
55 Ga0070686_100189997 3300005544 Bacteria 1465
56 Ga0070696_100261301 3300005546 Bacteria 1313
57 Ga0070665_100173543 3300005548 Bacteria 2157
58 Ga0070665_100483603 3300005548 Bacteria 1249
59 Ga0070664_100099364 3300005564 Unclassified 2529
60 Ga0070664_100285785 3300005564 Bacteria 1488
61 Ga0068857_100011444 3300005577 Bacteria 7720
62 Ga0068857_100246983 3300005577 Bacteria 1635
63 Ga0068854_100102538 3300005578 Bacteria 2147
64 Ga0070702_100140405 3300005615 Bacteria 1538
65 Ga0068852_100031548 3300005616 Bacteria 4375
66 Ga0068859_100438330 3300005617 Bacteria 1403
67 Ga0068864_100003748 3300005618 Bacteria 12551
68 Ga0068866_10146413 3300005718 Unclassified 1362
69 Ga0068861_100042493 3300005719 Unclassified 3407
70 Ga0068870_10149361 3300005840 Bacteria 1375
71 Ga0068863_100080040 3300005841 Bacteria 3095
72 Ga0068863_100181637 3300005841 Bacteria 2020
73 Ga0068858_100037953 3300005842 Bacteria 4468
74 Ga0068858_100780323 3300005842 Unclassified 932
75 Ga0068860_100096141 3300005843 Bacteria 2824
76 Ga0068860_100451431 3300005843 Bacteria 1278
77 Ga0068862_100075382 3300005844 Bacteria 2918
78 Ga0068862_100156555 3300005844 Bacteria 2031
79 Ga0068862_100377822 3300005844 Bacteria 1321
80 Ga0075368_10007991 3300006042 Bacteria 3752
81 Ga0075368_10075548 3300006042 Bacteria 1366
82 Ga0075363_100017770 3300006048 Bacteria 3532
83 Ga0075364_10023220 3300006051 Bacteria 3925
84 Ga0075364_10180484 3300006051 Bacteria 1428
85 Ga0075364_10180814 3300006051 Unclassified 1427
86 Ga0075362_10000172 3300006177 Bacteria 17809
87 Ga0075367_10001714 3300006178 Bacteria 9599
88 Ga0075367_10118580 3300006178 Bacteria 1629
89 Ga0075367_10124036 3300006178 Unclassified 1593
90 Ga0075366_10010371 3300006195 Bacteria 5231
91 Ga0075366_10019756 3300006195 Bacteria 3904
92 Ga0075366_10040428 3300006195 Bacteria 2758
93 Ga0075366_10040638 3300006195 Bacteria 2751
94 Ga0097621_100112057 3300006237 Unclassified 2306
95 Ga0097621_100122902 3300006237 Unclassified 2203
96 Ga0097621_100123938 3300006237 Bacteria 2194
97 Ga0075370_10019409 3300006353 Bacteria 3702
98 Ga0075370_10023058 3300006353 Bacteria 3424
99 Ga0075370_10200358 3300006353 Unclassified 1177
100 Ga0068871_100457489 3300006358 Bacteria 1145
101 Ga0075428_100052367 3300006844 Unclassified 4474
102 Ga0075428_100082046 3300006844 Bacteria 3518
103 Ga0075428_100309227 3300006844 Bacteria 1699
104 Ga0075430_100214823 3300006846 Bacteria 1596
105 Ga0075430_100649257 3300006846 Unclassified 870
106 Ga0075431_100046933 3300006847 Unclassified 4454
107 Ga0075431_100104348 3300006847 Bacteria 2925
108 Ga0075431_100588037 3300006847 Bacteria 1098
109 Ga0075433_10065901 3300006852 Unclassified 3177
110 Ga0075434_100036651 3300006871 Bacteria 4852
111 Ga0068865_100046035 3300006881 Unclassified 2992
112 Ga0068865_100077126 3300006881 Unclassified 2380
113 Ga0097620_100230264 3300006931 Unclassified 1941
114 Ga0097620_100438378 3300006931 Bacteria 1403
115 Ga0097620_100928278 3300006931 Bacteria 954
116 Ga0075435_100007573 3300007076 Bacteria 7754
117 Ga0105240_10060893 3300009093 Bacteria 4705
118 Ga0111539_10007621 3300009094 Bacteria 13832
119 Ga0111539_10034317 3300009094 Bacteria 6154
120 Ga0111539_10052174 3300009094 Bacteria 4868
121 Ga0105245_10051387 3300009098 Unclassified 3695
122 Ga0114129_10003376 3300009147 Bacteria 22429
123 Ga0114129_10063604 3300009147 Bacteria 5152
124 Ga0105243_10086638 3300009148 Unclassified 2569
125 Ga0105243_10133631 3300009148 Unclassified 2108
126 Ga0105242_10208677 3300009176 Unclassified 1739
127 Ga0105242_10753114 3300009176 Bacteria 959
128 Ga0105248_10011919 3300009177 Bacteria 9587
129 Ga0105248_10030443 3300009177 Bacteria 6025
130 Ga0105248_10137826 3300009177 Unclassified 2753
131 Ga0105248_11141528 3300009177 Bacteria 881
132 Ga0105249_10005392 3300009553 Bacteria 11041
133 Ga0105249_10047632 3300009553 Bacteria 3906
134 Ga0105246_10237183 3300011119 Bacteria 1440
135 Ga0157374_10007676 3300013296 Bacteria 9210
136 Ga0157374_10207361 3300013296 Bacteria 1921
137 Ga0157375_10011766 3300013308 Bacteria 7737
138 Ga0157375_10175910 3300013308 Bacteria 2290
139 Ga0163163_10000071 3300014325 Bacteria 112778
140 Ga0163163_10039373 3300014325 Unclassified 4613
141 Ga0163163_10050297 3300014325 Bacteria 4104
142 Ga0163163_10120454 3300014325 Bacteria 2658
143 Ga0157376_10005550 3300014969 Bacteria 8822
144 Ga0157376_10171589 3300014969 Bacteria 1976
145 Ga0157376_10430180 3300014969 Bacteria 1283
146 Ga0163161_10006816 3300017792 Bacteria 7899
147 Ga0207697_10001192 3300025315 Bacteria 14265
148 Ga0207697_10094932 3300025315 Unclassified 1267
149 Ga0207656_10146830 3300025321 Bacteria 1114
150 Ga0207682_10023014 3300025893 Bacteria 2459
151 Ga0207642_10047091 3300025899 Unclassified 1926
152 Ga0207688_10001657 3300025901 Bacteria 11775
153 Ga0207680_10232202 3300025903 Bacteria 1268
154 Ga0207643_10141035 3300025908 Bacteria 1440
155 Ga0207695_10144431 3300025913 Bacteria 2325
156 Ga0207663_10091444 3300025916 Unclassified 2020
157 Ga0207681_10008075 3300025923 Bacteria 6440
158 Ga0207681_10078292 3300025923 Bacteria 2326
159 Ga0207681_10273611 3300025923 Unclassified 1327
160 Ga0207650_10004419 3300025925 Bacteria 9604
161 Ga0207650_10059042 3300025925 Bacteria 2858
162 Ga0207650_10077802 3300025925 Bacteria 2508
163 Ga0207659_10022055 3300025926 Bacteria 4237
164 Ga0207659_10035620 3300025926 Bacteria 3442
165 Ga0207659_10054761 3300025926 Bacteria 2850
166 Ga0207659_10570384 3300025926 Bacteria 963
167 Ga0207687_10065291 3300025927 Unclassified 2584
168 Ga0207700_10043891 3300025928 Bacteria 3287
169 Ga0207644_10104618 3300025931 Bacteria 2131
170 Ga0207690_10380786 3300025932 Bacteria 1121
171 Ga0207706_10048109 3300025933 Bacteria 3772
172 Ga0207706_10186854 3300025933 Bacteria 1819
173 Ga0207686_10188022 3300025934 Unclassified 1470
174 Ga0207709_10455884 3300025935 Bacteria 989
175 Ga0207670_10060210 3300025936 Bacteria 2586
176 Ga0207669_10004380 3300025937 Bacteria 6210
177 Ga0207691_10009602 3300025940 Bacteria 9285
178 Ga0207691_10018514 3300025940 Bacteria 6600
179 Ga0207691_10058361 3300025940 Bacteria 3510
180 Ga0207691_10268287 3300025940 Unclassified 1470
181 Ga0207711_10077056 3300025941 Unclassified 2905
182 Ga0207711_10175518 3300025941 Unclassified 1946
183 Ga0207711_10187316 3300025941 Bacteria 1884
184 Ga0207689_10054112 3300025942 Bacteria 3306
185 Ga0207661_10012911 3300025944 Bacteria 6091
186 Ga0207661_10573852 3300025944 Bacteria 1034
187 Ga0207661_10693696 3300025944 Bacteria 936
188 Ga0207679_10013518 3300025945 Bacteria 5351
189 Ga0207679_10429572 3300025945 Bacteria 1167
190 Ga0207651_10045802 3300025960 Bacteria 2936
191 Ga0207651_10574170 3300025960 Unclassified 983
192 Ga0207712_10167266 3300025961 Bacteria 1715
193 Ga0207712_10339464 3300025961 Bacteria 1245
194 Ga0207668_10045042 3300025972 Bacteria 3006
195 Ga0207668_10186661 3300025972 Bacteria 1640
196 Ga0207668_10254985 3300025972 Bacteria 1427
197 Ga0207668_10293485 3300025972 Unclassified 1339
198 Ga0207640_10080928 3300025981 Bacteria 2219
199 Ga0207640_10513119 3300025981 Bacteria 1000
200 Ga0207658_10202314 3300025986 Bacteria 1659
201 Ga0207677_10029854 3300026023 Unclassified 3471
202 Ga0207677_10103814 3300026023 Bacteria 2099
203 Ga0207677_10172005 3300026023 Bacteria 1695
204 Ga0207703_10220450 3300026035 Bacteria 1696
205 Ga0207678_10042956 3300026067 Bacteria 3913
206 Ga0207678_10062582 3300026067 Bacteria 3198
207 Ga0207678_10068105 3300026067 Bacteria 3055
208 Ga0207678_10093767 3300026067 Unclassified 2565
209 Ga0207678_10703105 3300026067 Bacteria 890
210 Ga0207641_10118241 3300026088 Unclassified 2361
211 Ga0207648_10028213 3300026089 Bacteria 4978
212 Ga0207648_10075461 3300026089 Bacteria 2939
213 Ga0207676_10017916 3300026095 Bacteria 5139
214 Ga0207676_10117993 3300026095 Unclassified 2233
215 Ga0207674_10017837 3300026116 Bacteria 7737
216 Ga0207674_10084373 3300026116 Bacteria 3175
217 Ga0207675_100022178 3300026118 Bacteria 5912
218 Ga0207683_10091622 3300026121 Bacteria 2708
219 Ga0207683_10201763 3300026121 Unclassified 1808
220 Ga0207683_10220917 3300026121 Bacteria 1726
221 Ga0207683_10265299 3300026121 Bacteria 1568
222 Ga0207683_10268713 3300026121 Bacteria 1558
223 Ga0207698_10039891 3300026142 Unclassified 3482
224 Ga0209971_1027381 3300027682 Bacteria 1364
225 Ga0207428_10004122 3300027907 Bacteria 13931
226 Ga0207428_10021671 3300027907 Bacteria 5437
227 Ga0207428_10032055 3300027907 Bacteria 4327
228 Ga0268266_10138814 3300028379 Bacteria 2180
229 Ga0268266_10434785 3300028379 Bacteria 1245
230 Ga0268265_10072277 3300028380 Bacteria 2690
231 Ga0307408_100016064 3300031548 Bacteria 4991
232 Ga0307408_100447506 3300031548 Unclassified 1120
233 Ga0307406_10129847 3300031901 Unclassified 1767
234 Ga0307407_10316655 3300031903 Unclassified 1093
235 Ga0307412_10080206 3300031911 Unclassified 2254
236 Ga0307409_100349400 3300031995 Bacteria 1395
237 Ga0307416_100705693 3300032002 Unclassified 1098
238 Ga0307411_10241669 3300032005 Unclassified 1414
239 Ga0373934_0017983 3300035086 Bacteria 2702
240 Ga0373934_0189481 3300035086 Bacteria 846
241 Ga0373956_0006502 3300035119 Bacteria 4684
242 Ga0373957_0232250 3300035120 Bacteria 774
243 Ga0373946_0276461 3300035171 Bacteria 825
244 Ga0373955_0001722 3300035172 Bacteria 9366
245 Ga0373955_0164766 3300035172 Unclassified 1310
246 Ga0373933_0014341 3300035724 Bacteria 4406
247 Ga0373947_0015502 3300035725 Bacteria 4378
248 Ga0373947_0159285 3300035725 Bacteria 1459
249 Ga0373937_0002816 3300036401 Bacteria 14530
250 Ga0373937_0009769 3300036401 Bacteria 8365
251 Ga0373937_0102218 3300036401 Bacteria 2661
252 Ga0373937_0482721 3300036401 Unclassified 1177
253 Ga0373925_0005688 3300037068 Bacteria 9267
254 Ga0373925_0305117 3300037068 Bacteria 1286
255 Ga0395905_0315761 3300037471 Unclassified 1452
256 Ga0450920_001817 3300042122 Bacteria 3578
257 Ga0450894_001967 3300042131 Bacteria 2835
258 Ga0450898_002120 3300042134 Bacteria 2737
259 Ga0450908_003328 3300042184 Unclassified 3125
260 Ga0450908_009422 3300042184 Bacteria 1813
261 Ga0450918_007598 3300042531 Bacteria 1915
262 Ga0453683_0156941 3300044673 Bacteria 1439
263 Ga0451576_1194671 3300045051 Unclassified 794
264 Ga0495638_0012848 3300046460 Bacteria 5722
265 Ga0495651_0084759 3300046462 Bacteria 2387
266 Ga0495613_0108219 3300046689 Bacteria 2005
267 Ga0495680_0063257 3300047322 Unclassified 2842
268 Ga0495680_0381494 3300047322 Unclassified 976
269 Ga0496101_0089408 3300048904 Bacteria 2289
270 Ga0496101_0143833 3300048904 Bacteria 1820
271 Ga0496102_0042682 3300048905 Bacteria 4110
272 Ga0496102_0189604 3300048905 Bacteria 1937
273 Ga0496104_0010994 3300048907 Bacteria 8098
274 Ga0496104_0032261 3300048907 Bacteria 4874
275 Ga0496104_0091142 3300048907 Bacteria 2913
276 Ga0496105_0023298 3300048908 Bacteria 5019
277 Ga0496105_0035576 3300048908 Bacteria 4099
278 Ga0496105_0326134 3300048908 Bacteria 1230
279 Ga0496106_0035343 3300048909 Bacteria 3737
280 Ga0496106_0163999 3300048909 Bacteria 1758
281 Ga0496107_0029675 3300048910 Unclassified 3893
282 Ga0496108_0006443 3300048911 Bacteria 9514
283 Ga0496108_0049980 3300048911 Bacteria 3499
284 Ga0496108_0056656 3300048911 Bacteria 3294
285 Ga0496108_0105465 3300048911 Bacteria 2406
286 Ga0496109_0036296 3300048912 Bacteria 4448
287 Ga0496109_0284139 3300048912 Bacteria 1559
288 Ga0496109_0609473 3300048912 Bacteria 1028
289 Ga0496110_0000816 3300048913 Bacteria 21833
290 Ga0496110_0034547 3300048913 Bacteria 4380
291 Ga0496110_0350436 3300048913 Bacteria 1345
292 Ga0496110_0363151 3300048913 Bacteria 1319
293 Ga0496111_0001752 3300048914 Bacteria 12708
294 Ga0496112_0000213 3300048915 Bacteria 37294
295 Ga0496112_0030034 3300048915 Bacteria 5259
296 Ga0496112_0062483 3300048915 Bacteria 3673
297 Ga0496113_0004934 3300048916 Bacteria 8262
298 Ga0496114_0037065 3300048917 Bacteria 4032
299 Ga0496114_0276933 3300048917 Bacteria 1479
300 Ga0501034_0010143 3300049571 Bacteria 9829
301 Ga0501040_0018715 3300049576 Bacteria 4600
302 Ga0501041_0550488 3300049577 Unclassified 735
303 Ga0501042_0681891 3300049578 Unclassified 747
304 Ga0501072_0359813 3300049588 Bacteria 1155
305 Ga0501073_0436588 3300049589 Bacteria 905
306 Ga0501076_0022769 3300049592 Bacteria 4818
307 Ga0501079_0764974 3300049741 Unclassified 760
308 Ga0501080_0354726 3300049742 Bacteria 1324
309 nmdc:mga03683_650_c1 3300050489 Bacteria 9969
310 nmdc:mga03n38_263971_c1 3300050490 Unclassified 914
311 nmdc:mga00v17_2930_c1 3300050491 Bacteria 8751
312 nmdc:mga00v17_383758_c1 3300050491 Bacteria 913
313 nmdc:mga00v17_68436_c1 3300050491 Bacteria 2195
314 nmdc:mga0k408_11387_c1 3300050493 Bacteria 4843
315 nmdc:mga0k408_241842_c1 3300050493 Bacteria 1078
316 nmdc:mga0k408_259444_c1 3300050493 Bacteria 1038
317 nmdc:mga0k408_400915_c1 3300050493 Unclassified 816
318 nmdc:mga0k408_6654_c1 3300050493 Bacteria 6163
319 nmdc:mga0k408_7268_c1 3300050493 Bacteria 5918
320 nmdc:mga06z11_101861_c1 3300050494 Unclassified 1577
321 nmdc:mga06z11_310129_c1 3300050494 Archaea 940
322 nmdc:mga06z11_31891_c1 3300050494 Bacteria 2565
323 nmdc:mga06z11_3976_c1 3300050494 Bacteria 5765
324 nmdc:mga06z11_55326_c1 3300050494 Bacteria 2048
325 nmdc:mga04h51_10983_c1 3300050495 Bacteria 2503
326 nmdc:mga07m45_15727_c1 3300050496 Bacteria 4042
327 nmdc:mga07m45_29063_c1 3300050496 Bacteria 3054
328 nmdc:mga05p37_11149_c1 3300050507 Bacteria 10681
329 nmdc:mga05p37_4420_c1 3300050507 Bacteria 16424
330 nmdc:mga05p37_625_c2 3300050507 Bacteria 19945
331 nmdc:mga05p37_94334_c1 3300050507 Bacteria 3687
332 nmdc:mga0qj67_575340_c1 3300050509 Unclassified 902
333 nmdc:mga0qj67_8989_c1 3300050509 Bacteria 7411
334 nmdc:mga06r32_209832_c1 3300050510 Unclassified 1935
335 nmdc:mga06r32_49581_c1 3300050510 Bacteria 4015
336 nmdc:mga06r32_65586_c1 3300050510 Bacteria 3503
337 nmdc:mga06r32_892667_c1 3300050510 Bacteria 846
338 nmdc:mga08y16_112546_c1 3300050511 Bacteria 2833
339 nmdc:mga08y16_1617_c1 3300050511 Bacteria 22810
340 nmdc:mga08y16_3139_c1 3300050511 Bacteria 17106
341 nmdc:mga0n895_2195_c1 3300050512 Bacteria 15101
342 nmdc:mga0n895_8924_c1 3300050512 Bacteria 8736
343 nmdc:mga0a205_150419_c1 3300050515 Unclassified 2228
344 nmdc:mga0a205_437468_c1 3300050515 Bacteria 1169
345 Ga0495595_0119927 3300053084 Bacteria 1281
346 Ga0495619_0030965 3300053085 Bacteria 3465
347 Ga0495619_0147478 3300053085 Bacteria 1622
348 Ga0500555_000107 3300053103 Bacteria 39405
349 Ga0500616_0001026 3300053153 Bacteria 29622
350 Ga0500645_000553 3300053730 Bacteria 24693
351 Ga0501084_0668897 3300054114 Bacteria 876
352 Ga0590071_000557 3300059421 Bacteria 10786
353 Ga0590075_002743 3300059424 Bacteria 4218
354 Ga0590077_000276 3300059426 Bacteria 14588
355 Ga0501082_0330155 3300060353 Bacteria 1329
356 Ga0530510_0014629 3300061734 Bacteria 5539
357 nmdc:mga04h51_32151_c1
358 Ga0065712_10001426
359 Ga0065712_10148379
360 Ga0065715_10089094
361 Ga0065715_10157753
362 Ga0070683_100006066
363 Ga0070683_100009991
364 Ga0070683_100914841
365 Ga0070670_100017474
366 Ga0070670_100020809
367 Ga0068869_100298508
368 Ga0068868_100597702
369 Ga0070689_100218040
370 Ga0070668_100058776
371 Ga0070669_100000591
372 Ga0070675_100037009
373 Ga0070675_100194819
374 Ga0070671_100024766
375 Ga0070671_100179125
376 Ga0070674_100006875
377 Ga0070673_100005521
378 Ga0070673_100675026
379 Ga0070688_100083639
380 Ga0070659_100185280
381 Ga0070659_100274989
382 Ga0070667_100191584
383 Ga0070667_100342002
384 Ga0070701_10110488
385 Ga0070711_100046400
386 Ga0070663_100048041
387 Ga0070663_100059271
388 Ga0070663_100068398
389 Ga0070663_100124514
390 Ga0070663_100777988
391 Ga0070678_100167810
392 Ga0070678_100240950
393 Ga0070678_100301478
394 Ga0070678_100816791
395 Ga0070662_100137546
396 Ga0070662_100319426
397 Ga0070662_100419144
398 Ga0070662_100521203
399 Ga0068867_100186380
400 Ga0070685_10090468
401 Ga0070685_10096314
402 Ga0070685_10305040
403 Ga0070679_100224453
404 Ga0070684_100000794
405 Ga0070684_100058079
406 Ga0070684_100190455
407 Ga0070672_100004257
408 Ga0070672_100021194
409 Ga0070672_100118059
410 Ga0070672_100238479
411 Ga0070686_100189997
412 Ga0070696_100261301
413 Ga0070665_100173543
414 Ga0070665_100483603
415 Ga0070664_100099364
416 Ga0070664_100285785
417 Ga0068857_100011444
418 Ga0068857_100246983
419 Ga0068854_100102538
420 Ga0070702_100140405
421 Ga0068852_100031548
422 Ga0068859_100438330
423 Ga0068864_100003748
424 Ga0068866_10146413
425 Ga0068861_100042493
426 Ga0068870_10149361
427 Ga0068863_100080040
428 Ga0068863_100181637
429 Ga0068858_100037953
430 Ga0068858_100780323
431 Ga0068860_100096141
432 Ga0068860_100451431
433 Ga0068862_100075382
434 Ga0068862_100156555
435 Ga0068862_100377822
436 Ga0075368_10007991
437 Ga0075368_10075548
438 Ga0075363_100017770
439 Ga0075364_10023220
440 Ga0075364_10180484
441 Ga0075364_10180814
442 Ga0075362_10000172
443 Ga0075367_10001714
444 Ga0075367_10118580
445 Ga0075367_10124036
446 Ga0075366_10010371
447 Ga0075366_10019756
448 Ga0075366_10040428
449 Ga0075366_10040638
450 Ga0097621_100112057
451 Ga0097621_100122902
452 Ga0097621_100123938
453 Ga0075370_10019409
454 Ga0075370_10023058
455 Ga0075370_10200358
456 Ga0068871_100457489
457 Ga0075428_100052367
458 Ga0075428_100082046
459 Ga0075428_100309227
460 Ga0075430_100214823
461 Ga0075430_100649257
462 Ga0075431_100046933
463 Ga0075431_100104348
464 Ga0075431_100588037
465 Ga0075433_10065901
466 Ga0075434_100036651
467 Ga0068865_100046035
468 Ga0068865_100077126
469 Ga0097620_100230264
470 Ga0097620_100438378
471 Ga0097620_100928278
472 Ga0075435_100007573
473 Ga0105240_10060893
474 Ga0111539_10007621
475 Ga0111539_10034317
476 Ga0111539_10052174
477 Ga0105245_10051387
478 Ga0114129_10003376
479 Ga0114129_10063604
480 Ga0105243_10086638
481 Ga0105243_10133631
482 Ga0105242_10208677
483 Ga0105242_10753114
484 Ga0105248_10011919
485 Ga0105248_10030443
486 Ga0105248_10137826
487 Ga0105248_11141528
488 Ga0105249_10005392
489 Ga0105249_10047632
490 Ga0105246_10237183
491 Ga0157374_10007676
492 Ga0157374_10207361
493 Ga0157375_10011766
494 Ga0157375_10175910
495 Ga0163163_10000071
496 Ga0163163_10039373
497 Ga0163163_10050297
498 Ga0163163_10120454
499 Ga0157376_10005550
500 Ga0157376_10171589
501 Ga0157376_10430180
502 Ga0163161_10006816
503 Ga0207697_10001192
504 Ga0207697_10094932
505 Ga0207656_10146830
506 Ga0207682_10023014
507 Ga0207642_10047091
508 Ga0207688_10001657
509 Ga0207680_10232202
510 Ga0207643_10141035
511 Ga0207695_10144431
512 Ga0207663_10091444
513 Ga0207681_10008075
514 Ga0207681_10078292
515 Ga0207681_10273611
516 Ga0207650_10004419
517 Ga0207650_10059042
518 Ga0207650_10077802
519 Ga0207659_10022055
520 Ga0207659_10035620
521 Ga0207659_10054761
522 Ga0207659_10570384
523 Ga0207687_10065291
524 Ga0207700_10043891
525 Ga0207644_10104618
526 Ga0207690_10380786
527 Ga0207706_10048109
528 Ga0207706_10186854
529 Ga0207686_10188022
530 Ga0207709_10455884
531 Ga0207670_10060210
532 Ga0207669_10004380
533 Ga0207691_10009602
534 Ga0207691_10018514
535 Ga0207691_10058361
536 Ga0207691_10268287
537 Ga0207711_10077056
538 Ga0207711_10175518
539 Ga0207711_10187316
540 Ga0207689_10054112
541 Ga0207661_10012911
542 Ga0207661_10573852
543 Ga0207661_10693696
544 Ga0207679_10013518
545 Ga0207679_10429572
546 Ga0207651_10045802
547 Ga0207651_10574170
548 Ga0207712_10167266
549 Ga0207712_10339464
550 Ga0207668_10045042
551 Ga0207668_10186661
552 Ga0207668_10254985
553 Ga0207668_10293485
554 Ga0207640_10080928
555 Ga0207640_10513119
556 Ga0207658_10202314
557 Ga0207677_10029854
558 Ga0207677_10103814
559 Ga0207677_10172005
560 Ga0207703_10220450
561 Ga0207678_10042956
562 Ga0207678_10062582
563 Ga0207678_10068105
564 Ga0207678_10093767
565 Ga0207678_10703105
566 Ga0207641_10118241
567 Ga0207648_10028213
568 Ga0207648_10075461
569 Ga0207676_10017916
570 Ga0207676_10117993
571 Ga0207674_10017837
572 Ga0207674_10084373
573 Ga0207675_100022178
574 Ga0207683_10091622
575 Ga0207683_10201763
576 Ga0207683_10220917
577 Ga0207683_10265299
578 Ga0207683_10268713
579 Ga0207698_10039891
580 Ga0209971_1027381
581 Ga0207428_10004122
582 Ga0207428_10021671
583 Ga0207428_10032055
584 Ga0268266_10138814
585 Ga0268266_10434785
586 Ga0268265_10072277
587 Ga0307408_100016064
588 Ga0307408_100447506
589 Ga0307406_10129847
590 Ga0307407_10316655
591 Ga0307412_10080206
592 Ga0307409_100349400
593 Ga0307416_100705693
594 Ga0307411_10241669
595 Ga0373934_0017983
596 Ga0373934_0189481
597 Ga0373956_0006502
598 Ga0373957_0232250
599 Ga0373946_0276461
600 Ga0373955_0001722
601 Ga0373955_0164766
602 Ga0373933_0014341
603 Ga0373947_0015502
604 Ga0373947_0159285
605 Ga0373937_0002816
606 Ga0373937_0009769
607 Ga0373937_0102218
608 Ga0373937_0482721
609 Ga0373925_0005688
610 Ga0373925_0305117
611 Ga0395905_0315761
612 Ga0450920_001817
613 Ga0450894_001967
614 Ga0450898_002120
615 Ga0450908_003328
616 Ga0450908_009422
617 Ga0450918_007598
618 Ga0453683_0156941
619 Ga0451576_1194671
620 Ga0495638_0012848
621 Ga0495651_0084759
622 Ga0495613_0108219
623 Ga0495680_0063257
624 Ga0495680_0381494
625 Ga0496101_0089408
626 Ga0496101_0143833
627 Ga0496102_0042682
628 Ga0496102_0189604
629 Ga0496104_0010994
630 Ga0496104_0032261
631 Ga0496104_0091142
632 Ga0496105_0023298
633 Ga0496105_0035576
634 Ga0496105_0326134
635 Ga0496106_0035343
636 Ga0496106_0163999
637 Ga0496107_0029675
638 Ga0496108_0006443
639 Ga0496108_0049980
640 Ga0496108_0056656
641 Ga0496108_0105465
642 Ga0496109_0036296
643 Ga0496109_0284139
644 Ga0496109_0609473
645 Ga0496110_0000816
646 Ga0496110_0034547
647 Ga0496110_0350436
648 Ga0496110_0363151
649 Ga0496111_0001752
650 Ga0496112_0000213
651 Ga0496112_0030034
652 Ga0496112_0062483
653 Ga0496113_0004934
654 Ga0496114_0037065
655 Ga0496114_0276933
656 Ga0501034_0010143
657 Ga0501040_0018715
658 Ga0501041_0550488
659 Ga0501042_0681891
660 Ga0501072_0359813
661 Ga0501073_0436588
662 Ga0501076_0022769
663 Ga0501079_0764974
664 Ga0501080_0354726
665 nmdc:mga03683_650_c1
666 nmdc:mga03n38_263971_c1
667 nmdc:mga00v17_2930_c1
668 nmdc:mga00v17_383758_c1
669 nmdc:mga00v17_68436_c1
670 nmdc:mga0k408_11387_c1
671 nmdc:mga0k408_241842_c1
672 nmdc:mga0k408_259444_c1
673 nmdc:mga0k408_400915_c1
674 nmdc:mga0k408_6654_c1
675 nmdc:mga0k408_7268_c1
676 nmdc:mga06z11_101861_c1
677 nmdc:mga06z11_310129_c1
678 nmdc:mga06z11_31891_c1
679 nmdc:mga06z11_3976_c1
680 nmdc:mga06z11_55326_c1
681 nmdc:mga04h51_10983_c1
682 nmdc:mga07m45_15727_c1
683 nmdc:mga07m45_29063_c1
684 nmdc:mga05p37_11149_c1
685 nmdc:mga05p37_4420_c1
686 nmdc:mga05p37_625_c2
687 nmdc:mga05p37_94334_c1
688 nmdc:mga0qj67_575340_c1
689 nmdc:mga0qj67_8989_c1
690 nmdc:mga06r32_209832_c1
691 nmdc:mga06r32_49581_c1
692 nmdc:mga06r32_65586_c1
693 nmdc:mga06r32_892667_c1
694 nmdc:mga08y16_112546_c1
695 nmdc:mga08y16_1617_c1
696 nmdc:mga08y16_3139_c1
697 nmdc:mga0n895_2195_c1
698 nmdc:mga0n895_8924_c1
699 nmdc:mga0a205_150419_c1
700 nmdc:mga0a205_437468_c1
701 Ga0495595_0119927
702 Ga0495619_0030965
703 Ga0495619_0147478
704 Ga0500555_000107
705 Ga0500616_0001026
706 Ga0500645_000553
707 Ga0501084_0668897
708 Ga0590071_000557
709 Ga0590075_002743
710 Ga0590077_000276
711 Ga0501082_0330155
712 Ga0530510_0014629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

108

190

0.92

PF13649

Methyltransf_25

Methyltransferase domain

107

186

0.91

PF13489

Methyltransf_23

Methyltransferase domain

73

242

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zfu-assembly2.cif.gz_B structure of the methyltransferase-like domain of nucleomethylin 0.7468 28 233
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.7295 26 137
5wy0-assembly1.cif.gz_A crystal structure of the methyltranferase domain of human hen1 in complex with adomet 0.7184 31 233
8bii-assembly3.cif.gz_G-2 o-methyltransferase plu4895 (mutant h229n) in complex with sah 0.7178 29 234
2p7h-assembly1.cif.gz_A crystal structure of a sam dependent methyl-transferase type 12 family protein (eca1738) from pectobacterium atrosepticum scri1043 at 1.85 a resolution 0.7176 38 233
ID Description Score Start End Superfamily
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8954 40 142 3.40.50.150
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8696 37 136 3.40.50.150
af_O44410_182_343_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8552 34 233 3.40.50.150
af_Q7K2B0_198_358_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8409 34 233 3.40.50.150
af_A0A0P0XBA9_4_117_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8397 72 233 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A832UUD1-F1-model_v4 Class I SAM-dependent methyltransferase 0.9283 9 234 GO:0008757
GO:0032259
AF-A0A832UUD1-F1-model_v4 Class I SAM-dependent methyltransferase 0.8941 9 234 GO:0008757
GO:0032259
AF-A0A016T679-F1-model_v4 Ribosomal RNA-processing protein 8 (EC 2.1.1.-) 0.8211 34 233 GO:0000183
GO:0005677
GO:0005730
GO:0006364
GO:0008168
GO:0032259
GO:0033553
GO:0035064
GO:0042149
GO:0046015
AF-A0A3D2J1U9-F1-model_v4 SAM-dependent methyltransferase 0.8161 88 233 GO:0008757
GO:0032259
AF-A0A7J4AA14-F1-model_v4 Methyltransferase domain-containing protein 0.8043 27 135 GO:0008757
GO:0032259

Map